Literature DB >> 32495503

Dental malformations associated with biallelic MMP20 mutations.

Shih-Kai Wang1,2, Hong Zhang1, Michael B Chavez3, Yuanyuan Hu1, Figen Seymen4, Mine Koruyucu4, Yelda Kasimoglu4, Connor D Colvin3, Tamara N Kolli3, Michelle H Tan3, Yin-Lin Wang2, Pei-Ying Lu2, Jung-Wook Kim5,6, Brian L Foster3, John D Bartlett3, James P Simmer1, Jan C-C Hu1.   

Abstract

BACKGROUND: Matrix metallopeptidase 20 (MMP20) is an evolutionarily conserved protease that is essential for processing enamel matrix proteins during dental enamel formation. MMP20 mutations cause human autosomal recessive pigmented hypomaturation-type amelogenesis imperfecta (AI2A2; OMIM #612529). MMP20 is expressed in both odontoblasts and ameloblasts, but its function during dentinogenesis is unclear.
METHODS: We characterized 10 AI kindreds with MMP20 defects, characterized human third molars and/or Mmp20-/- mice by histology, Backscattered Scanning Electron Microscopy (bSEM), µCT, and nanohardness testing.
RESULTS: We identified six novel MMP20 disease-causing mutations. Four pathogenic variants were associated with exons encoding the MMP20 hemopexin-like (PEX) domain, suggesting a necessary regulatory function. Mutant human enamel hardness was softest (13% of normal) midway between the dentinoenamel junction (DEJ) and the enamel surface. bSEM and µCT analyses of the third molars revealed reduced mineral density in both enamel and dentin. Dentin close to the DEJ showed an average hardness number 62%-69% of control. Characterization of Mmp20-/- mouse dentin revealed a significant reduction in dentin thickness and mineral density and a transient increase in predentin thickness, indicating disturbances in dentin matrix secretion and mineralization.
CONCLUSION: These results expand the spectrum of MMP20 disease-causing mutations and provide the first evidence for MMP20 function during dentin formation.
© 2020 The Authors. Molecular Genetics & Genomic Medicine published by Wiley Periodicals LLC.

Entities:  

Keywords:  MMP20 mutations; amelogenesis imperfecta; dentin defects; enamel hardness; hypomineralization

Mesh:

Substances:

Year:  2020        PMID: 32495503      PMCID: PMC7434610          DOI: 10.1002/mgg3.1307

Source DB:  PubMed          Journal:  Mol Genet Genomic Med        ISSN: 2324-9269            Impact factor:   2.183


INTRODUCTION

MMP20 (matrix metallopeptidase 20; OMIM *604629) (Bartlett, Simmer, Xue, Margolis, & Moreno, 1996) and KLK4 (kallikrein‐related peptidase 4; OMIM *603767) (Simmer et al., 1998) are two major proteinases secreted by ameloblasts, and are expressed at sequential stages of enamel formation (Hu et al., 2002; Lu et al., 2008). MMP20 is expressed at the onset of amelogenesis (Begue‐Kirn, Krebsbach, Bartlett, & Butler, 1998) and is responsible for processing enamel matrix proteins (EMPs) (Iwata et al., 2007; Ryu et al., 1999) throughout the secretory stage when the enamel ribbons elongate and the enamel layer as a whole reaches its final dimensions. Mmp20 null mice exhibit a severe phenotype of hypoplastic enamel (Bartlett, Skobe, Nanci, & Smith, 2011; Caterina et al., 2002; Hu et al., 2016) and accumulate uncleaved EMPs in developing molars (Smith et al., 2011; Yamakoshi et al., 2011) indicating an indispensable role for MMP20 during enamel formation. In humans, MMP20 mutations cause autosomal recessive amelogenesis imperfecta (AI), in which the dental enamel of affected individuals is soft, and usually thin (Gasse et al., 2013; Gasse et al., 2017; Kim, Simmer, et al., 2005; Kim et al., 2017; Lee et al., 2010; Ozdemir et al., 2005; Papagerakis et al., 2008; Prasad et al., 2016; Seymen et al., 2015; Wang et al., 2013; Wright et al., 2011). OMIM (Online Mendelian Inheritance in Man) classifies the phenotype as pigmented hypomaturation type 2 (AI2A2; OMIM #612529). The human MMP20 gene is located on chromosome 11q22.2 in a cluster of MMP genes that apparently arose by tandem gene duplication (Llano et al., 1997). Accordingly, MMP20 has a multidomain protein structure similar to that of other MMPs: a signal peptide (Met1‐Ala22), a putative peptidoglycan‐binding domain (Arg35‐Ile95), a catalytic domain (Lys116Gly271), and a hemopexin‐like domain (Cys296Cys483) (Bartlett & Simmer, 1999; Ryu et al., 2000). The putative peptidoglycan‐binding domain (pfam01471) is comprised of three α‐helices and is N‐terminal to the catalytic domain of most MMPs, although its contribution to the functions of MMPs is unclear. The Zn‐dependent catalytic metalloproteinase domain (cd04278) of MMP20 contains the consensus motif (HEFGHALGLAH) that is characteristic of MMP active sites and critical for their proteolytic activity. MMP20 binds TIMP‐2 (metallopeptidase inhibitor 2) in a concentration‐dependent manor, which permits quantification of MMP20 by active site titration (Llano et al., 1997). Separated from the catalytic domain by a hinge region, the hemopexin‐like domain of MMP20 is flanked by two cysteines connected by a disulfide bridge. While this domain in other MMPs has been shown to serve a variety of functions through protein–protein interactions, the function of the MMP20 hemopexin‐like domain remains largely unknown. To date, 13 human MMP20 pathogenic variants have been reported in patients with AI (Table S1), including a rare (minor allele frequency of 0.03% in non‐Finnish European population) synonymous mutation (c.103A > C; p.Arg35Arg) (Gasse et al., 2017). Among the other 12 AI‐causing mutations, 5 are nonsense, frameshift, or splice‐site mutations, which would presumably generate a mutant transcript undergoing nonsense‐mediated decay and cause a null MMP20 allele. Two pathogenic missense variants (p.His204Arg and p.His226Gln) in the catalytic domain replace 2 histidines critical for stabilization of the catalytic and structural zinc ions, respectively, which significantly affects the proteolytic activity of MMP20. The other three pathogenic missense variants (p.Tyr108Cys, p.Ala304Thr, and p.Glu352Lys), while located outside of the catalytic domain, all change a highly conserved amino acid and presumably disturb MMP20’s function during enamel formation. It has been demonstrated that Mmp20 is expressed not only in ameloblasts but also odontoblasts during mouse tooth development (Caterina et al., 2000; Simmer et al., 2004). MMP20 was also detected in odontoblasts of adult human teeth (Sulkala, Larmas, Sorsa, Salo, & Tjaderhane, 2002). However, a function for MMP20 in odontoblasts and dentin formation has been doubted as dentin abnormalities have not been reported in patients with MMP20‐associated AI, whereas the enamel malformations are readily detectable clinically and radiographically. Correspondingly, Mmp20 null mice exhibited no apparent dentin malformations except for delayed mineralization of mantle dentin (a 5 ~ 20‐μm‐thick layer of dentin beneath DEJ) (Beniash, Skobe, & Bartlett, 2006) and a tendency to fracture at the dentinoenamel junction (DEJ) (Simmer, Richardson, Hu, Smith, & Hu, 2012). Moreover, it has been shown that Mmp20 has been pseudogenized in the sloth and aardvark, enamel‐less mammals that still make dentin (Meredith, Gatesy, Cheng, & Springer, 2011), suggesting a lack of selection pressure for MMP20 in dentin formation (see discussion session). In this study, we identified 10 families with autosomal recessive hypomaturation or hypoplastic‐hypomaturation AI, all of which carried biallelic MMP20 mutations. Among the identified mutations, six were not previously reported to be disease causing (Table S1). By characterizing the enamel and dentin from extracted third molars of a patient, we identified significant hardness defects and altered microstructure in both enamel and dentin of affected teeth. Correspondingly, we also found that the matrix secretion and mineralization of dentin in Mmp20 null mice were defective or delayed. These findings indicated a necessary role for MMP20 in not only enamel but also in dentin formation.

MATERIALS AND METHODS

Enrollment of human subjects

The study protocol and subject consent forms were reviewed and approved by the Ethics Committee at the University of Istanbul, the Institution Review Boards at the University of Michigan, and National Taiwan University Hospital. Study explanation, pedigree construction, subject enrollment, clinical examinations, and collection of blood or saliva samples were completed under the proper consenting procedure specified in the study protocols and according to the Declaration of Helsinki and US Federal Policy for the Protection of Human Subjects.

C57BL/6 mice

Animal research studies were approved by the Institutional Animal Care and Use Committee at the University of Michigan and The Ohio State University and were in compliance with guiding principles (Institute for Laboratory Animal Research, 2011). Mice genetically ablated for Mmp20 (Mmp20) have been described previously (Caterina et al., 2002). Mmp20 and wild‐type (WT) mice (4–6 mice per genotype per age) were sacrificed at postnatal day (dpn) 14, 30, and 60. C57BL/6 mice were used for in situ hybridization to assay Mmp20 mRNA expression at 8 and 14 dpn.

Whole‐exome sequencing and bioinformatics analysis

Either the nonstimulated saliva sample of 2 ml or a peripheral blood sample of 5 ml was collected from each participant. Each sample was inspected, coded, then a small aliquot was removed for genomic DNA isolation using the Saliva DNA Isolation kit (Norgen Biotek Corp; Ontario, CN). Genomic DNA quality was assessed by 1.5% agarose gel electrophoresis and quantity was determined using QubitTM Fluorometer (ThermoFisher Scientific, Waltham, MA). Samples from the parents and proband of each family were selected for whole‐exome sequencing (WES), while DNA samples from the other family members were used for segregation analyses. DNA samples, following the initial quality control, were submitted to Johns Hopkins Center for Inherited Disease Research (CIDR, Baltimore, MD) for WES. Each DNA sample, at the concentration of 50 ng/µl, volume of 50 µl, and total amount of 2.5 µg, was plated onto a 96 well plate. A manifest file with coded sample information and the plated samples were shipped to the CIDR overnight on dry ice. Each sample was genotyped using an Illumina QC Array. Once sample aliquoting errors were ruled out, and performance potential and genotypes were determined to be appropriate then samples were subjected to WES procedure. Exome capture was completed using the Agilent SureSelect Human All Exon Enrichment System. Paired‐end sequencing was generated using the Illumina HiSeq 2500 (CIDR, Baltimore, MD). Sequencing reads were aligned to the 1000 genomes phase 2 (GRCh37) human genome reference using BWA version 0.7.8 (Li & Durbin, 2010). Duplicate reads were flagged with Picard version 1.109. Local realignment around indels and base call quality score recalibration was performed using the Genome Analysis Toolkit (GATK) (McKenna et al., 2010) version v3.3‐0. GATK's reference confidence model workflow was used to perform joint sample genotyping to generate a multisample VCF file. Variant filtering was done using the Variant Quality Score Recalibration (VQSR) method (DePristo et al., 2011). Multisample VCF files from each family containing variants that were polymorphic among the family members were extracted from the multisample VCF file derived from the specific cohort with similar phenotypes. All variants in individual VCF files were annotated using VarSeq (Golden Helix, Bozeman, MT) against a variety of data sources including gene annotation, function prediction, and frequency information (a cutoff value of 0.01 for the minor allele frequency). Following the comparisons between the affected and unaffected individuals, a list of prioritized variants was then subjected to segregation analysis. Sequence variant designations are based on the gene reference sequence NG_012151.1; mRNA reference sequence NM_004771.3 (A of the ATG translation initiation codon is designated as nucleotide 1) and protein reference sequence NP_004762.2. All designations were checked using LUMC Mutalyzer 2.0.32 released on 9 December 2019 (https://mutalyzer.nl/). MAF, minor allele frequency; gnomAD, Genome Aggregation Database.

Segregation analyses using Sanger sequencing

The prioritized DNA sequence variations and their segregation within each family were confirmed by Sanger sequencing. The PCR primers were designed to bracket the candidate variant and the reactions were conducted following established protocols (Kim, Seymen, et al., 2005). PCR primers and amplification conditions are provided in Table S2.

Nanohardness testing

The two maxillary third molars (#1 and #16) extracted from the proband (III:1) of Family 6 and a control maxillary third molar from an unrelated healthy individual were dehydrated with an acetone series (30%, 50%, 70%, 80%, 90%, and 100%), and embedded in epoxy. The embedded molars were cut sagittally (in a mesial‐distal direction), re‐embedded in Castolite AC in 25 mm SeriForm molds (Struers Inc, Westlake, OH), and successively polished with 400, 800, and 1,200 grit waterproof silicon carbide papers, followed by polishing with 1‐micron diamond paste. Nanohardness testing was performed using a Hysitron 950 Triboindenter using the nanoDMA transducer and Berkovich probe, and the nano‐indentations were analyzed using Triboscan v9 software (University of Michigan Center for Materials Characterization). Indentations were made at 12 equivalent positions relative to the DEJ (or dentin surface) for each molar (A‐E in enamel; F‐L in dentin). Nanohardness was measured in both enamel and dentin at several locations on the molars: on enamel and dentin under mesial and distal cusp tips and above cementoenamel junction (CEJ), and on dentin only at a position 1 mm apical to the CEJ. To make the hardness data comparable from different locations, indents were grouped according to their distance from the DEJ or specified tooth surfaces. For enamel: A, 100 µm from enamel surface; B, midway between enamel surface and DEJ; C, 100 µm above DEJ; D, 50 µm above DEJ; and E, 10 µm above DEJ. For dentin: F, 10 µm below DEJ; G, 30 µm below DEJ; H, 50 µm below DEJ; I, 100 µm below DEJ on dentin; J, 500 µm below DEJ; K, midway between DEJ and pulp chamber; and L 100 µm above pulp chamber. The number of indents at each position for the MMP20 +/+ control was A6, B6, C7, D8, E8, F10, G9, H10, I10, J10, K22, and L22. The combined number of indents at each position for the MMP20 mutant (MMP20) molars was A4, B6, C10, D10, E10, F14, G14, H16, I14, J14, K40, and L39. The indents were converted into nanohardness (GPa) (Cheng et al., 2017). The nanohardness data were analyzed using t test to compare the nanohardness measurements at equivalent positions on MMP20 +/+ and MMP20 molars, and between the two MMP20 molars.

Backscattered scanning electron microscopy

Following nanohardness testing, the polished human molar sagittal sections were examined by backscattered scanning electron microscopy (bSEM), as described previously (Smith et al., 2011) using a Joel JSM‐7800FLV scanning electron microscope (Peabody, Massachusetts) in the backscatter mode at 20 kV at the University of Michigan Electron Microbeam Analysis Lab (Ann Arbor, MI). The samples were acetone‐dehydrated, air‐dried, mounted on metallic stubs using conductive carbon cement, and carbon coated to increase conductivity. The images were collected at outer enamel, middle enamel, inner enamel, as well as in superficial and deeper dentin. Identical beam conditions and brightness/contrast were used for all images. Differences in degree of mineralization (grayscale) were highlighted using ImageJ (v. 1.50i) analyses in which successive grayscale ranges were assigned different colors (0–66 black; 67–85 white; 86–123 blue; 124–148 orange; and 149–255 red).

Microcomputed tomography

Human teeth were scanned in a µCT 50 scanner (Scanco Medical, Bassersdorf, Switzerland) at 70 kVp, 76 µA, 0.5 Al filter, 900 ms integration time, and 10 µm voxel dimension. Mouse hemi‐mandibles were scanned under the same parameters except for 6 µm voxel dimension. DICOM files were created from raw data, exported, and calibrated to five known densities of hydroxyapatite (mg/cm3 HA), as previously described (Shin, Chavez, Ikeda, Foster, & Bartlett, 2018). Reconstructed images were analyzed using AnalyzePro (version 1.0; AnalyzeDirect, Overland Park, KS). For both human teeth and mouse first mandibular molars, enamel was segmented semi‐automatically (with manual corrections where necessary) at 1,600 mg/cm3 HA, and dentin/cementum was segmented at 650 mg/cm3 HA, as previously described (Shin et al., 2018). Average dentin thickness was determined for regions of interest (ROIs) by adapting algorithms defined for cortical bone analysis (Bouxsein et al., 2010). The crown dentin ROI initiated 60 µm coronal to the CEJ and extended 150 µm coronally, while the root dentin ROI initiated 300 µm apical to the CEJ and extended 150 µm apically. Mouse crown dentin thickness was measured in the 150 µm of dentin coronal to the CEJ, and root dentin thickness was measured in the central 150 µm of the mesial root.

Histology

Mouse hemi‐mandibles used for histology were fixed in Bouin's solution for 24 hr, decalcified in acetic acid/formalin/sodium chloride solution, and paraffin embedded for 6‐µm coronal sectioning (Foster, 2012). Deparaffinized tissue sections were stained with hematoxylin and eosin (H&E). Histomorphometry was performed on H&E‐stained coronal sections chosen from the center of the first molar mesial root. Measurements were performed at the crown‐root inflection point at the CEJ and included dentin and predentin thickness, with predentin/dentin ratio calculated from primary measurements. In situ hybridization (ISH) for Mmp20 was visualized with fast red (Advanced Cell Diagnostics, Newark, CA). For statistical analyses, mean ± standard deviation was shown in graphs. Comparisons of WT and Mmp20 mouse tissues were performed using an independent samples t test.

RESULTS

Novel MMP20 mutations causing amelogenesis imperfecta

We identified 10 families with autosomal recessive amelogenesis imperfecta (AI) caused by mutations in MMP20. Families 1 through 5 were from Turkey, Family 6 was from Taiwan, and Families 7–10 were from the USA. Among the 11 MMP20 mutations identified, 6 have never been reported previously, including 2 splice site, 1 frameshift, and 3 missense mutations (Tables S1 and S3). In all cases MMP20 mutations segregated with the enamel phenotype, that is, all recruited members of the 10 AI families with biallelic MMP20 mutations exhibited an obvious AI phenotype, whereas none of the recruited family members with either a wild‐type or a single‐mutant MMP20 allele presented with enamel malformations. All of the MMP20 defects were rare and predicted to be damaging.

Families 1 through 5 from Turkey

In Family 1, the proband and his affected sister inherited a transition defect in the splice acceptor site at the 3′ end of Intron 9 (c.1352‐1G > A) in both MMP20 alleles (Figure 1). This novel mutation is rare, and not listed in any of the five databases screened: the 1000 Genomes (1000G) database (1000 Genomes Project Consortium et al., 2015), Exome Aggregation Consortium (ExAC), Genome Aggregation Database (GnomAD) (Lek et al., 2016), Trans‐Omics for Precision Medicine (TOPMed), and the Grand Opportunity Exome Sequencing Project (GO‐ESP). One possible effect of this change would be to shift the Intron 9 splice‐acceptor junction by a single nucleotide into Exon 10, deleting the G at the start of Exon 10, and shifting the reading frame of the last coding exon (p.Gly451Alafs*25). This shift would replace the MMP20 C‐terminal 33 amino acids (GYIYFFSGPKTYKYDTEKEDVVSVVKSSSWIGC) with 24 extraneous (ATFTSFQ DQKHTSMTQRRKMWLVW) ones, significantly altering the hemopexin, or noncatalytic domain of MMP20. Another novel, homozygous splice‐site mutation was identified at the 3′ end of Intron 6 (c.954‐2A > G) of MMP20 in the proband of Family 2 (Figure 2). This mutation is rare and has not been identified in the databases mentioned above. A transversion mutation (rs140213840) changing the same nucleotide (c.954‐2A > T) was previously reported to cause AI (Gasse et al., 2017; Kim, Simmer, et al., 2005; Prasad et al., 2016; Wright et al., 2011). This splice site mutation was also identified in Families 7, 8, and 10 in this study.
FIGURE 1

Family 1 (Turkey). (a) Pedigree showing an autosomal recessive pattern of inheritance with four persons recruited (asterisks). Two were affected. (b) Both affected individuals (III:1 and III:2) were homozygous for an MMP20 splice junction mutation at the 3′ end of Intron 9 (NG_012151.1: g.52906G > A; NM_004771.3: c.1352‐1G > A)1. Both parents (II:4 and II:5) were heterozygous for this mutation. (c) The proband (III:1) at age 11 showed thin (hypoplastic), brown‐stained hypomineralized enamel that was susceptible to rapid attrition and did not contrast well with dentin on radiographs. (d) The proband's younger sister (III:2) at age 6 was in the mixed dentition stage. The primary teeth showed significant attrition and the newly erupted permanent first molars had a rough, irregular crown form. The thinness of the enamel was apparent on the newly erupted mandibular central incisors

FIGURE 2

Family 2 (Turkey). (a) Pedigree showing an autosomal recessive pattern of inheritance with no reported consanguinity. Three persons were recruited (asterisks); one was affected. (b) The proband (III:1) was homozygous for an MMP20 splice junction mutation at the 3′ end of Intron 6 (NG_012151.1: g.35574A > G; NM_004771.3: c.954‐2A > G. p.?)1. Both parents (II:3 and II:4) were heterozygous for this mutation. (c) The dentition of the proband (III:1; at age 10) showed light brown staining. (d) The panoramic radiograph of the proband showed stainless‐steel crowns covering the four first molars that had undergone significant attrition. Enamel thickness and contrast with dentin was variable

Family 1 (Turkey). (a) Pedigree showing an autosomal recessive pattern of inheritance with four persons recruited (asterisks). Two were affected. (b) Both affected individuals (III:1 and III:2) were homozygous for an MMP20 splice junction mutation at the 3′ end of Intron 9 (NG_012151.1: g.52906G > A; NM_004771.3: c.1352‐1G > A)1. Both parents (II:4 and II:5) were heterozygous for this mutation. (c) The proband (III:1) at age 11 showed thin (hypoplastic), brown‐stained hypomineralized enamel that was susceptible to rapid attrition and did not contrast well with dentin on radiographs. (d) The proband's younger sister (III:2) at age 6 was in the mixed dentition stage. The primary teeth showed significant attrition and the newly erupted permanent first molars had a rough, irregular crown form. The thinness of the enamel was apparent on the newly erupted mandibular central incisors Family 2 (Turkey). (a) Pedigree showing an autosomal recessive pattern of inheritance with no reported consanguinity. Three persons were recruited (asterisks); one was affected. (b) The proband (III:1) was homozygous for an MMP20 splice junction mutation at the 3′ end of Intron 6 (NG_012151.1: g.35574A > G; NM_004771.3: c.954‐2A > G. p.?)1. Both parents (II:3 and II:4) were heterozygous for this mutation. (c) The dentition of the proband (III:1; at age 10) showed light brown staining. (d) The panoramic radiograph of the proband showed stainless‐steel crowns covering the four first molars that had undergone significant attrition. Enamel thickness and contrast with dentin was variable In Family 3, only the proband had AI (Figure S1). WES analyses identified a previously reported biallelic MMP20 mutation (c.910G > A/p.Ala304Thr) in the coding region for the hemopexin domain (Gasse et al., 2017; Lee et al., 2010). The four affected individuals in Families 4 and 5 (Figures S2 and S3) shared a previously reported biallelic MMP20 defect (c.678T > A/p.His226Gln) in Exon 5 (Kim et al., 2017; Ozdemir et al., 2005).

Family 6 from Taiwan

Three members of this Taiwanese family were recruited: two unaffected parents with one affected offspring (Figure 3). The proband (III:1, age 17) harbored novel defects in each of her two MMP20 alleles: c.911C > G/p.Ala304Gly with a SIFT score of 0.002, a PolyPhen‐2 score of 1, and an allele frequency (ExAC) of T = 0.00001 (1/121310), and c.1046C > T/p.Ala349Val with a SIFT score = 0 and a PolyPhen‐2 score = 1. Besides the obvious enamel hypomaturation defects, the proband's dentition showed crowding and an anterior open bite. The maxillary third molars, already showing signs of dental caries, were extracted and later used for nanohardness testing, bSEM, and µCT analyses.
FIGURE 3

Family 6 (Taiwan). (a) Pedigree showing an autosomal recessive pattern of inheritance with no consanguinity. Three individuals were recruited (asterisks); one was affected. (b) The proband (III:1) was heterozygous for two MMP20 missense mutations, with a novel Exon 6 mutation (NG_012151.1: g.23756C > G; NM_004771.3: c.911C > G, p.Ala304Gly)1 from her mother (II:5) and a novel Exon 7 mutation (g.35668C > T; c.1046C > T, p.Ala349Val)1 from her father (II:4). (c) The proband (III:1) presented with an anterior open bite and attrition of her posterior occlusal enamel. (d) The panoramic radiograph showed variable enamel thickness and contrast with dentin among teeth

Family 6 (Taiwan). (a) Pedigree showing an autosomal recessive pattern of inheritance with no consanguinity. Three individuals were recruited (asterisks); one was affected. (b) The proband (III:1) was heterozygous for two MMP20 missense mutations, with a novel Exon 6 mutation (NG_012151.1: g.23756C > G; NM_004771.3: c.911C > G, p.Ala304Gly)1 from her mother (II:5) and a novel Exon 7 mutation (g.35668C > T; c.1046C > T, p.Ala349Val)1 from her father (II:4). (c) The proband (III:1) presented with an anterior open bite and attrition of her posterior occlusal enamel. (d) The panoramic radiograph showed variable enamel thickness and contrast with dentin among teeth

Families 7 through 10 from the USA

Four members from each of Families 7 and 8 were recruited: two unaffected parents with one affected and one unaffected offspring. The proband of Family 7 harbored a novel MMP20 defect in Exon 1 (c.42_49dup/p.Leu17Serfs*4; the duplicated sequence is CATGGCTT) combined with a previously reported splice junction mutation (c. 954‐2A > T) at the 3′ end of Intron 6 (Figure S4a–c). The proband of Family 8 was homozygous for this same splice junction mutation (c. 954‐2A > T) (Figure S4d,e). The proband of Family 9 was a compound heterozygote, with both mutations being reported previously (Gasse et al., 2013, 2017; Kim et al., 2017) (Figure S5). The first MMP20 mutation (rs61730849) was in Exon 3 (c.389C > T/p.Thr130Ile). The second MMP20 mutation (rs569599769) was in Exon 4 (c.566T > C/p.Leu189Pro). The proband of Family 10 also harbored compound MMP20 mutations (Figure S6). The first MMP20 mutation (rs778890652) was in Exon 5 (c.808T > C/p.Tyr270His) and is novel. This defect had a SIFT score of 0 and a PolyPhen‐2 score of 1, and is rare: its GnomAD frequency is 0.00011 (28/246242), and ExAC frequency is 0.00019 (23/121408). The second MMP20 mutation (rs140213840) was at the 3’ end of Intron 6 (c.954‐2A > T), was also found in Families 7 and 8 and was previously reported (Kim, Simmer, et al., 2005; Wright et al., 2011).

Enamel and dentin defects in third molars from human MMP20mut patient

Two extracted maxillary third molars from Family 6 proband along with one from an unrelated healthy individual (control) were subjected to nanohardness testing. During sample preparation, the sectioned teeth were inspected under a dissection microscope (Figure 4). A surprising finding was that the MMP20 molars exhibited two very distinct layers of enamel. The outer enamel layer was of uniform thickness overall, but became abruptly thinner near the fissures, and looked normal except for a slight loss of transparency. The inner enamel, which originated at the DEJ, was thicker than the outer layer, light brown in color, and obviously hypomineralized. The MMP20 dentin looked generally comparable to the control except a layer, yellow to light brown in appearance, right beneath DEJ. Both MMP20 molars showed obvious signs of dental caries: chalky white at the enamel surface, brown to dark brown in the deeper enamel, and in one of the molars, dark brown stain in dentin that spread along the DEJ. A few cracks were evident in the enamel and dentin that did not seem to be the result of processing. Hardness testing was performed staying clear of these areas, under the assumption that exposure to the oral cavity had not affected smooth, intact enamel or the dentin beneath it or in the roots.
FIGURE 4

Nanohardness of Enamel and Dentin. Top: Sagittally cut third molars, one from an unaffected (MMP20 +/+) individual and two from the proband in Family 6 (MMP20), were subjected to nanohardness testing. Indents (blue dots) in enamel (a–e) were made at five positions (a: 100 µm from the enamel surface; b: midway between the DEJ and enamel surface; c: 100 µm from the DEJ; d: 50 µm from DEJ; and e: 10 µm from DEJ), at two locations: under the cusp tip and near the cervical margin. The MMP20 enamel varied in hardness at different locations, but was significantly softer at all locations. The enamel was hardest (Point A, 55% of normal) nearest the enamel surface, and softest (Point B, 13% of normal) half‐way between the DEJ and the enamel surface. Indents in dentin (f‐l) were made at seven positions (Point F, 10 µm from DEJ; g, 30 µm from DEJ; h, 50 µm from DEJ; i, 100 µm from DEJ; j, 500 µm from DEJ; k, midway between DEJ and pulp surface; and l, 100 µm away from the pulp surface)

Nanohardness of Enamel and Dentin. Top: Sagittally cut third molars, one from an unaffected (MMP20 +/+) individual and two from the proband in Family 6 (MMP20), were subjected to nanohardness testing. Indents (blue dots) in enamel (a–e) were made at five positions (a: 100 µm from the enamel surface; b: midway between the DEJ and enamel surface; c: 100 µm from the DEJ; d: 50 µm from DEJ; and e: 10 µm from DEJ), at two locations: under the cusp tip and near the cervical margin. The MMP20 enamel varied in hardness at different locations, but was significantly softer at all locations. The enamel was hardest (Point A, 55% of normal) nearest the enamel surface, and softest (Point B, 13% of normal) half‐way between the DEJ and the enamel surface. Indents in dentin (f‐l) were made at seven positions (Point F, 10 µm from DEJ; g, 30 µm from DEJ; h, 50 µm from DEJ; i, 100 µm from DEJ; j, 500 µm from DEJ; k, midway between DEJ and pulp surface; and l, 100 µm away from the pulp surface) Nanohardness testing revealed that the MMP20 surface enamel, despite its near normal appearance, was only about 55% that of normal. At points midway between the enamel surface and DEJ (in the brownish inner layer), the enamel was very soft. Its hardness value was only 13% of normal and lower than all other measurements, including those for MMP20 dentin. The hardness of enamel nearest the DEJ was 61% and dropped to 48% of normal only 100 µm above the DEJ. Nanohardness testing also revealed differences between the MMP20 +/+ and MMP20 dentin within 500 µm of the dentin surface. The hardness values for MMP20 dentin ranged between 62% and 69% of normal, whereas the hardness values for MMP20 circumpulpal dentin and dentin midway between the pulp surface and the DEJ were normal. Previously, Knoop hardness testing found that the enamel microhardness of Mmp20 −/− mouse incisors was ~63% of normal (Bartlett, Beniash, Lee, & Smith, 2004). We analyzed the human MMP20 +/+ and MMP20 molars with bSEM to observe and highlight changes in mineral density (Figures 5; Figures S7–S9). On the grayscale images, the MMP20 +/+ tooth enamel showed a homogeneous layer of uniformly high mineral density from the DEJ to the surface, while the MMP20 tooth enamel exhibited a lower mineral density in the inner and middle enamel that highlighted the enamel rods, indicating a decrease in mineralization of interrod enamel or along the periphery of the rods. A decrease in enamel mineral density with depth was recently observed in human third molars surgically extracted from a patient with AI caused by a dominant LAMB3 splice junction mutation (Smith et al., 2019). The enamel layer was more highly mineralized than dentin and the MMP20 enamel beneath a relatively hard surface layer was severely hypomineralized. Differences in degree of mineralization were highlighted by ImageJ analyses (where successive grayscale ranges were assigned different colors) that clearly illustrated the reduced mineralization of the middle and inner enamel and supported the nanohardness findings.
FIGURE 5

Backscattered SEM Analysis of human molars. The same sagittally cut third molars from an unaffected (MMP20 +/+) individual, and the proband of Family 6 (MMP20) that were prepared for nanohardness testing were imaged by bSEM (Top) and analyzed using IMAGEJ (Bottom). Mineral in a sample increases the whiteness of the bSEM image. The grayscale images at the top show the enamel layer is more highly mineralized than dentin and that the MMP20 enamel below a relatively hard surface layer is severely hypomineralized. Differences in the degree of mineralization were highlighted by ImageJ analysis where grayscale ranges were assigned different colors: 0–66 black; 67–85 white; 86–123 blue; 124–148 orange; and 149–255 red. The MMP20 +/+ enamel is red throughout, whereas the MMP20 enamel shows large areas of orange sometimes mixed with blue. The MMP20 dentin shows some increase in whiteness relative to the MMP20 +/+ dentin, but the difference in apparent mineral density is not striking

Backscattered SEM Analysis of human molars. The same sagittally cut third molars from an unaffected (MMP20 +/+) individual, and the proband of Family 6 (MMP20) that were prepared for nanohardness testing were imaged by bSEM (Top) and analyzed using IMAGEJ (Bottom). Mineral in a sample increases the whiteness of the bSEM image. The grayscale images at the top show the enamel layer is more highly mineralized than dentin and that the MMP20 enamel below a relatively hard surface layer is severely hypomineralized. Differences in the degree of mineralization were highlighted by ImageJ analysis where grayscale ranges were assigned different colors: 0–66 black; 67–85 white; 86–123 blue; 124–148 orange; and 149–255 red. The MMP20 +/+ enamel is red throughout, whereas the MMP20 enamel shows large areas of orange sometimes mixed with blue. The MMP20 dentin shows some increase in whiteness relative to the MMP20 +/+ dentin, but the difference in apparent mineral density is not striking With regard to dentin, a general pattern of blue with a hint of orange was observed on the pseudocolor images of the control tooth (Figure 5). However, the mutant dentin, while having the similar blue pattern, showed a nonhomogeneous texture and carried a hue of whiteness, suggesting a slight reduction in mineral density. Noticeably, an uneven but apparent layer of white (67–85 grayscale) right underneath DEJ was found in mutant dentin but not the control, indicating a more prominent hypomineralization in the outer layer of primary dentin. The high‐magnification images revealed that the control and mutant dentin had generally comparable structure and level of mineralization (Figure S10). Furthermore, the mutant dentin seemed to have a thinner layer of peritubular dentin compared to the control, which was readily seen when a longitudinal cut of dentinal tubules was made. High‐resolution µCT analysis was employed to further confirm the findings in MMP20 teeth. Heat maps for mineral density showed severely reduced mineral density in the inner and middle enamel layers, while dentin appeared generally comparable between control and mutant teeth (Figure S11a,b). Quantitative analysis of bulk tissue properties revealed on average a more than 10% decrease in mineral density in enamel of MMP20 teeth, while dentin mineral density was decreased to a lesser extent (Figure S11c‐f).

Dentin defects in Mmp20 null mice

To further discern potential important functions of MMP20 in dentin formation, we characterized dentin phenotypes in Mmp20 null (Mmp20) mice (Figure 6; Figures S12–S14). We first reevaluated Mmp20 mRNA expression during mouse tooth development. At 8 dpn, Mmp20 was strongly detected in ameloblasts and odontoblasts of mandibular incisors (Figure S12a). At 14 dpn, Mmp20 expression appeared strong in third molar ameloblasts (secretory stage), but decreased in ameloblasts (maturation stage) of first and second molars. In contrast, odontoblasts consistently showed a strong expression in both crown and root (Figure S12b–e). Microcomputed tomography (MicroCT) analyses of mandibular first molars (Figure 6a–d; Figure S13a–d) revealed a 10%–20% decrease in crown dentin thickness in Mmp20 teeth at both 30 and 60 dpn compared to the WTs (Figure 6e). The mineral density of crown dentin was reduced by 5% in Mmp20 molars at 30 dpn, with no density differences at 60 dpn (Figure 6f). Mmp20 root dentin also showed reduced dentin thickness (30%) and mineral density (5%) compared to that of WTs at 30 dpn. However, no differences were found at 60 dpn (Figure 6g,h). The whole tooth, enamel, and dentin/cementum of Mmp20 teeth all exhibited a decreased tissue volume measured by threshold segmentation of microCT images (Figure S13e‐g). The volume of dental pulp was significantly higher in Mmp20 molars at 30 dpn compared to the WTs but slightly lower in those of 60 dpn (Figure S13h).
FIGURE 6

MicroCT and histological analyses of mouse mandibular first molars. (a‐d) microCT images and heat maps of mineral density of WT (a,b) and Mmp20 −/− (c,d) molars from 30 dpn mice. (M1, mandibular first molar; AB, alveolar bone; EN, enamel; DE, dentin) (e‐h) measurements of thickness and mineral density of crown (e,f) and root (g,h) dentin. Dentin thickness was measured in the crown dentin 150 µm above the cementoenamel junction (CEJ) and in the mesial root dentin 150 µm below CEJ (*p < .05; **p < .01; ***p < .01–0.001; ****p < .0001). (i‐l) Histology of WT (i,j) and Mmp20 −/− (k,l) molars. (PD, predentin; PDL, periodontal ligament). (m‐o) Histomorphometry of dentin structures. Thicknesses of dentin (m) and predentin (n) were measured at the level of CEJ, and the predentin/dentin ratio (o) was calculated from primary measurements

MicroCT and histological analyses of mouse mandibular first molars. (a‐d) microCT images and heat maps of mineral density of WT (a,b) and Mmp20 −/− (c,d) molars from 30 dpn mice. (M1, mandibular first molar; AB, alveolar bone; EN, enamel; DE, dentin) (e‐h) measurements of thickness and mineral density of crown (e,f) and root (g,h) dentin. Dentin thickness was measured in the crown dentin 150 µm above the cementoenamel junction (CEJ) and in the mesial root dentin 150 µm below CEJ (*p < .05; **p < .01; ***p < .01–0.001; ****p < .0001). (i‐l) Histology of WT (i,j) and Mmp20 −/− (k,l) molars. (PD, predentin; PDL, periodontal ligament). (m‐o) Histomorphometry of dentin structures. Thicknesses of dentin (m) and predentin (n) were measured at the level of CEJ, and the predentin/dentin ratio (o) was calculated from primary measurements The dentin formation of Mmp20 teeth was also evaluated by histology using mice of 14, 30, and 60 dpn. While odontoblasts and dentin of Mmp20 molars exhibited a generally normal organization and structure without apparent cell pathology or dysmorphology, the dentin appeared thin compared to that of WTs (Figure 6i,k). Dentin thickness was significantly reduced in Mmp20 molars at all ages, particularly at 30 dpn (Figure 6m). Noticeably, the thickness of predentin in Mmp20 molars was increased at 30 dpn (Figure 6j,l), resulting in a significant increase in predentin/dentin ratio at this age (Figure 6n,o). By 60 dpn, Mmp20 molars showed evidence of reactionary dentin formation, with some pulp horns infilled with new dentin (Figure S14). The predentin thickness and predentin/dentin ratio both became comparable between Mmp20 and WT molars.

DISCUSSION

Active MMP20 can be isolated from developing pig enamel (Yamada et al., 2003) and has been used to study its substrate specificity (Yamakoshi, Hu, Fukae, Yamakoshi, & Simmer, 2006; Yamakoshi, Simmer, Bartlett, Karakida, & Oida, 2013). The protein migrates as a doublet at 46 and 41 kDa on Western blots and casein zymograms and shows greatest activity for digesting amelogenin at pH 7.2 with 10 mM Ca2+ (Fukae et al., 1998). Including the 6 novel pathogenic variants we reported here, there is a total of 18 disease‐causing MMP20 mutations currently identified. These mutations are evenly distributed throughout the 10 coding exons of the gene, excepting Exon 8 and Exon 9. Frameshift, nonsense, missense, and splice‐site mutations have all been reported. This high heterogeneity of disease‐causing mutations in MMP20 demonstrates a loss‐of‐function mechanism of its pathogenesis. Noticeably, 7 pathogenic variants are located about or within the last 5 exons, which encode the hemopexin‐like domain (PEX) of MMP20, suggesting an indispensable role of this protein domain in enamel formation. While PEX has been considered to be a protein–protein interaction module in MMPs, its definite functions are not fully understood. Also, the sequence homology of this domain among different MMPs is considerably low, suggesting it has variable functions in individual MMPs (Alford et al., 2017). It has been demonstrated that PEX determines the substrate specificity of collagenolytic MMPs (Cui, Hu, & Khalil, 2017; Patterson, Atkinson, Knauper, & Murphy, 2001; Singh, Fields, Christov, & Karabencheva‐Christova, 2016). While these enzymes without PEX cannot cleave collagens, they remain proteolytic for other substrates. However, MMP20 has been shown to precisely cleave enamel matrix proteins (EMPs) even without its PEX domain (Ryu et al., 1999). Therefore, it is unlikely that the PEX mutations in MMP20 cause enamel defects by disrupting its catalytic activity and specificity to EMPs. Recently, mice carrying a PEX mutation (p.Ser466Pro) in MT1‐MMP were shown to have profound defects in growth and development due to mutant proteins that were misfolded and retained in the ER (Sakr et al., 2018). Similarly, it is possible that human MMP20 PEX mutations might affect MMP20 secretion and increase ER stress in ameloblasts, which leads to the enamel phenotypes. However, this disease mechanism of “gain‐of‐abnormal function” (neomorphism) is mainly seen in dominant human diseases, since the mutant proteins from a single copy of a defective gene usually have substantial toxicity to cause diseases. In contrast, recessive disorders primarily result from a “loss‐of‐function” (hypomorphism or amorphism) disease mechanism. Recently, more attention has been paid to the nonproteolytic functions of MMPs (García‐Pardo & Opdenakker, 2015). These functions are independent of their catalytic activity and based upon protein–protein interactions with soluble molecules or cell surface receptors, primarily through their PEX domain (Piccard, Van den Steen, & Opdenakker, 2007). For example, several MMPs have been shown to interact with integrins, which activates specific signaling pathways and modulates cell behaviors. MMP1 binds to α2β1 integrin, causing Akt dephosphorylation and neuron cell death (Conant et al., 2004). The PEX domain of MMP9 interacts with α4β1 integrin and affects cell migration and survival (Redondo‐Munoz et al., 2010). These interactions and functions do not require proteolytic activity of MMPs. Accordingly, it is possible that the PEX domain of MMP20 might execute proteolysis‐independent functions that are critical for enamel formation. Particularly, both α6β4 and α4β6 integrins have been demonstrated to play indispensable roles during enamel development, and mutations in genes encoding these integrins were shown to cause amelogenesis imperfecta (C. E. L. Smith et al., 2017). Therefore, it is plausible to speculate that the PEX domain of MMP20 might interact with α6β4 or α4β6 integrin, and this interaction might be essential for enamel formation. Structurally, a PEX domain consists of a four‐bladed β‐propeller structure. Each blade is formed by a sequence repeat starting with an N‐terminal motif of aspartic acid‐alanine (DA) (Piccard, Van den Steen, & Opdenakker, 2007). The two missense mutations identified in Family 6, p.Ala304Gly and p.Ala349Val, substitute for the alanine of this motif in the first and second blades, respectively, which would presumably cause structural alteration of the PEX domain and disturb its interaction with other proteins. In brief, the MMP20 mutations we identified in this study suggest a critical role for its PEX domain in enamel formation, which might be based on unappreciated nonproteolytic functions of MMP20. Further investigations are warranted to demonstrate this hypothesis. The most compelling finding in this study is that loss of function of MMP20 causes not only enamel malformations but also dentin defects. Despite consisting of the same inorganic component of hydroxyapatite as enamel, dentin is formed through a developmental process distinct from that of enamel. During dentinogenesis, a layer of unmineralized collagen‐based matrix, known as predentin, is first deposited by odontoblasts. As various noncollagenous proteins are incorporated, predentin then gradually mineralizes into dentin, which is achieved by continuous deposition of mineral in matrix vesicles and at the mineralization front. Fibrils of type I collagen, with holes and pores, serve as scaffolds that hold about 56% of the mineral. On the other hand, the noncollagenous matrix proteins are believed to modulate the mineralization process. Dentin sialophosphoprotein (DSPP) is the major noncollagenous protein of dentin and is comprised of three major domains, dentin sialoprotein (DSP), dentin glycoprotein (DGP), and dentin phosphoprotein (DPP) (Yamakoshi, Hu, Fukae, Zhang, & Simmer, 2005). After synthesis, DSPP is rapidly cleaved, as intact DSPP has never been isolated. It is believed that proteolytic cleavage of DSPP is essential activation steps and specific proteases might be required. In a porcine animal model, MMP20 and MMP2, extracted from dentin matrix, have been shown to cleave DSPP and generate cleavage products that closely correlate with in vivo products (Yamakoshi, Hu, Iwata, et al., 2006). MMP20 cleaves between DSP and DGP, and releases a series of N‐terminal DSP cleavage products ranging from 25 to 38 kDa. If these DSPP cleavage products are active independent of the parent protein, failure to generate them might explain the hardness defect of dentin in our MMP20 mutation patient. It has been demonstrated that while DPP binds to collagen, DSP is mainly detected in peritubular dentin, a collar of highly calcified matrix that delimits dentinal tubules and is hypermineralized compared to intertubular dentin. Therefore, when MMP20 is mutated, proper DSP cleavage products might not be generated, which disturbs mineralization of peritubular dentin and causes dentin hypomineralization. The reduced thickness of peritubular dentin we observed in the human MMP20 mutant molars further supports this hypothesis, although more detailed quantification is required to make a definitive conclusion. To date, many proteases have been identified in human dentin matrix, including MMPs, cathepsins, and astacins. Although some of them are believed to serve overlapping functions, their differential expression levels during dentinogenesis and enzymatic efficiency on dentin matrix proteins might vary significantly. Hence, the defective function of mutant MMP20 on human dentin formation might not be sufficiently compensated by molecular redundancy from other proteases, such as MMP2, and causes dentin hardness defects. The functional role of MMP20 in dentin formation is also supported by the dentin phenotypes in Mmp20 null mice. The reduced dentin thickness and mineral density, and transiently increased predentin thickness in Mmp20 molars demonstrates a disturbance in dentin matrix secretion and mineralization when MMP20 is ablated. The more evident defects at 30 dpn may result from a relatively high rate of dentin formation at this stage. However, the recovery of some dentin parameters in Mmp20 molars by 60 dpn suggests a potential compensation mechanism by the odontoblasts, which warrants further investigations. It has been well documented that Mmp20, during evolution, is independently pseudogenized in many vertebrates that lose the ability to make teeth, such as birds, turtles, pangolins, baleen, and sperm whales, indicating an important role for MMP20 specifically in tooth formation but not in other tissues or organs (Meredith et al., 2011; Meredith, Zhang, Gilbert, Jarvis, & Springer, 2014). Mmp20 pseudogenization has also been reported for mammals that have teeth without enamel capping, such as sperm whales, sloths, and aardvarks. It was then suggested that Mmp20 is not only tooth specific but also enamel specific which seems to contradict our finding in this study. However, while evidence for Mmp20 pseudogenization in toothless animals is compelling, that in enamel‐less mammals is not so clear. Meredith et al. sequenced Mmp20 in two species of enamel‐less sperm whales, Kogia breviceps and Kogia sima, and identified a premature stop codon in only 1 of 3 individuals of K. breviceps and none of 5 individuals of K. sima (Meredith et al., 2011). While many inactivation mutations have been reported in the enamelin (Enam) genes of Kogia, Mmp20 pseudogenization seems to be a rare finding in these sperm whales. For sloths and aardvarks, it was reported that they could form teeth comprised of dentin even if Mmp20 is inactivated in their genome. However, it has been documented that the dentin structure of sloths and aardvarks is different from that of other mammalian species (Kalthoff, 2011; Santana et al., 2013). Therefore, there appears to be selection pressure for maintaining Mmp20 in most mammals, not only for enamel formation but also dentin development.

CONFLICT OF INTEREST

None declared. Supplementary Material Click here for additional data file.
  58 in total

1.  MMP-20 mutation in autosomal recessive pigmented hypomaturation amelogenesis imperfecta.

Authors:  J-W Kim; J P Simmer; T C Hart; P S Hart; M D Ramaswami; J D Bartlett; J C-C Hu
Journal:  J Med Genet       Date:  2005-03       Impact factor: 6.318

2.  Processing of ameloblastin by MMP-20.

Authors:  T Iwata; Y Yamakoshi; J C-C Hu; I Ishikawa; J D Bartlett; P H Krebsbach; J P Simmer
Journal:  J Dent Res       Date:  2007-02       Impact factor: 6.116

3.  ENAM mutations in autosomal-dominant amelogenesis imperfecta.

Authors:  J-W Kim; F Seymen; B P-J Lin; B Kiziltan; K Gencay; J P Simmer; J C-C Hu
Journal:  J Dent Res       Date:  2005-03       Impact factor: 6.116

4.  Dentin glycoprotein: the protein in the middle of the dentin sialophosphoprotein chimera.

Authors:  Yasuo Yamakoshi; Jan C-C Hu; Makoto Fukae; Hengmin Zhang; James P Simmer
Journal:  J Biol Chem       Date:  2005-02-23       Impact factor: 5.157

5.  Homozygous and compound heterozygous MMP20 mutations in amelogenesis imperfecta.

Authors:  B Gasse; E Karayigit; E Mathieu; S Jung; A Garret; M Huckert; S Morkmued; C Schneider; L Vidal; J Hemmerlé; J-Y Sire; A Bloch-Zupan
Journal:  J Dent Res       Date:  2013-04-26       Impact factor: 6.116

6.  Effect of kallikrein 4 loss on enamel mineralization: comparison with mice lacking matrix metalloproteinase 20.

Authors:  Charles E Smith; Amelia S Richardson; Yuanyuan Hu; John D Bartlett; Jan C-C Hu; James P Simmer
Journal:  J Biol Chem       Date:  2011-03-23       Impact factor: 5.157

7.  Decreased mineral content in MMP-20 null mouse enamel is prominent during the maturation stage.

Authors:  J D Bartlett; E Beniash; D H Lee; C E Smith
Journal:  J Dent Res       Date:  2004-12       Impact factor: 6.116

8.  Matrix metalloproteinase 1 interacts with neuronal integrins and stimulates dephosphorylation of Akt.

Authors:  Katherine Conant; Coryse St Hillaire; Hideaki Nagase; Rob Visse; Devin Gary; Norman Haughey; Carol Anderson; Jadwiga Turchan; Avindra Nath
Journal:  J Biol Chem       Date:  2003-12-15       Impact factor: 5.157

9.  Novel KLK4 and MMP20 mutations discovered by whole-exome sequencing.

Authors:  S-K Wang; Y Hu; J P Simmer; F Seymen; N M R P Estrella; S Pal; B M Reid; M Yildirim; M Bayram; J D Bartlett; J C-C Hu
Journal:  J Dent Res       Date:  2013-01-25       Impact factor: 6.116

10.  MMP20 Overexpression Disrupts Molar Ameloblast Polarity and Migration.

Authors:  M Shin; M B Chavez; A Ikeda; B L Foster; J D Bartlett
Journal:  J Dent Res       Date:  2018-02-26       Impact factor: 6.116

View more
  2 in total

1.  Loss of BMP2 and BMP4 Signaling in the Dental Epithelium Causes Defective Enamel Maturation and Aberrant Development of Ameloblasts.

Authors:  Claes-Göran Reibring; Maha El Shahawy; Kristina Hallberg; Brian D Harfe; Anders Linde; Amel Gritli-Linde
Journal:  Int J Mol Sci       Date:  2022-05-29       Impact factor: 6.208

2.  Dental malformations associated with biallelic MMP20 mutations.

Authors:  Shih-Kai Wang; Hong Zhang; Michael B Chavez; Yuanyuan Hu; Figen Seymen; Mine Koruyucu; Yelda Kasimoglu; Connor D Colvin; Tamara N Kolli; Michelle H Tan; Yin-Lin Wang; Pei-Ying Lu; Jung-Wook Kim; Brian L Foster; John D Bartlett; James P Simmer; Jan C-C Hu
Journal:  Mol Genet Genomic Med       Date:  2020-06-03       Impact factor: 2.183

  2 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.