Literature DB >> 32161447

Pleiotropic Anticancer Properties of Scorpion Venom Peptides: Rhopalurus princeps Venom as an Anticancer Agent.

Arthur G Mikaelian1, Eric Traboulay1, Xiaofei Michael Zhang1, Emma Yeritsyan2, Peter L Pedersen3, Young Hee Ko3, Khalid Z Matalka4.   

Abstract

To date, the success of conventional chemotherapy, radiotherapy, and targeted biological therapies in cancer treatment is not satisfactory. The main reasons for such outcomes rely on low target selectivity, primarily in chemo- and radiotherapy, ineffectiveness to metastatic disease, drug resistance, and severe side effects. Although immune checkpoint inhibitors may offer better clinical promise, success is still limited. Since cancer is a complex systemic disease, the need for new therapeutic modalities that can target or block several steps of cancer cell characteristics, modulate or repolarize immune cells, and are less toxic to healthy tissues is essential. Of these promising therapeutic modalities are pleiotropic natural products in which scorpion venom (SV) is an excellent example. SV consists of complex bioactive peptides that are disulfide-rich of different peptides' length, potent, stable, and exerts various multi-pharmacological actions. SV peptides also contain ion channel inhibitors. These ion channels are dysregulated and overexpressed in cancer cells, and play essential roles in cancer development and invasion, as well as depolarizing immune cells. Furthermore, SV has been found to induce cancer cell apoptosis, and inhibit cancer cells proliferation, invasion, metastasis, and angiogenesis. In the current review, we are presenting data that show the pleiotropic effect of SV against different types of human cancer as well as revealing one potential anticancer agent, Rhopalurus princeps venom. Furthermore, we are addressing what is needed to be done to translate these potential cancer therapeutics to the clinic.
© 2020 Mikaelian et al.

Entities:  

Keywords:  angiogenesis; apoptosis; cell arrest; cytotoxicity; immunomodulation; ion channels; metastasis; polarization

Mesh:

Substances:

Year:  2020        PMID: 32161447      PMCID: PMC7051175          DOI: 10.2147/DDDT.S231008

Source DB:  PubMed          Journal:  Drug Des Devel Ther        ISSN: 1177-8881            Impact factor:   4.162


Introduction

Cancer is a devastating term that people afraid to hear; besides, it is the second leading cause of death worldwide. The incidence of cancer cases worldwide is on the rise, where 17 million new cases of cancer were diagnosed in 2018, and 9.6 million people died because of cancer in the same year. Furthermore, cancer incidence is projected to increase by 62% in 2040.1 Thus, the future burden will increase yearly as the numbers, and the projections are apparent. Cancer development is a multistep process and it starts with an initiation step involving DNA mutation. Such mutation could either be inherited or acquired following chronic inflammation, exposure to chemicals or viruses yielding to molecular events that lead to cellular transformation. This transformation gains the abnormal cell(s) specific characteristics. Of these characteristics: 1) evading immunosurveillance and programmed cell death; 2) becoming dysregulated regarding specific genes, proteins and ion channel expression, and go through uncontrolled cell proliferation; 3) stimulating and sustaining new blood vessels, angiogenesis, for their growth; and 4) ability to invade tissues and metastasize to other locations in the body.2–4 In addition, the immune cells that are recruited to tumor site become depolarized and lose their normal function and may become enhancers for tumor growth.3 All in all, these changes yield to the development of a heterogeneous tumor microenvironment. To date, the success of conventional chemotherapy, radiotherapy, and targeted biological therapies in cancer treatment is not satisfactory. The main reasons for such outcomes rely on low target selectivity, primarily in chemo- and radiotherapy, ineffectiveness to metastatic disease, drug resistance, and severe side effects. In contrast, immune checkpoint inhibitors are now showing better promising results.5 However, success in cancer therapy is still limited. Since cancer is a complex systemic disease, the need for new therapeutic modalities that can target or block several steps of cancer cell characteristics, modulate or repolarize immune cells, and are less toxic to healthy tissues is essential.3,5 Of these promising therapeutic modalities are pleiotropic natural products in which they are multi-targeting and have fewer side effects.6 An excellent example of a pleiotropic natural product is the scorpion venom (SV). SV consists of complex bioactive peptides that are disulfide-rich of different peptides’ length, potent, stable, and exerts various multi-pharmacological actions (Figure 1). Research studies have demonstrated that SV peptides block/modulate ion channels. These ion channels are dysregulated and overexpressed in cancer cells and play essential roles in cancer development and invasion, as well as depolarizing immune cells. Furthermore, SV has pleiotropic anticancer activities such as inducing apoptosis, and inhibiting cancer cells proliferation, invasion, metastasis, along with angiogenesis. Besides, substantial evidence exists that SV is an immunomodulator. In the current review, we are presenting data that show the pleiotropic effect of SV against different types of human cancer as well as revealing one potential anticancer agent, Rhopalurus princeps venom. Furthermore, we are addressing what is needed to be done to translate these potential cancer therapeutics to the clinic.
Figure 1

The multi-pharmacological actions of scorpion venom bioactive peptides on cancer cells.

The multi-pharmacological actions of scorpion venom bioactive peptides on cancer cells.

Ion Channels and Cancer Cells

It has been proven that tumor cells use ion channels to support their proliferation, adhesion and invasion processes.4 These processes occur by ion channels interplay with changes in cell morphology and volume. In particular, this has been shown to be the mechanism of glioma cell growth and invasion mainly via the electrochemical efflux of Cl− and K+ as KCl and water, which is mediated by an increase in intracellular Ca+2 ions, leading to cell shrinkage that enables the cell to invade the brain tissue.7,8 Furthermore, expression of ion channels has been demonstrated to be altered, dysregulated, or overexpressed in several types of cancers. For instance, chloride channels have been found to be dysregulated in multiple cancer types; either downregulated such as human colorectal cancer9 or altered as in glioma10 to regulate glioblastoma cell invasiveness.11 On the other hand, potassium channels such as voltage-gated potassium channels (Kv) and calcium-activated potassium channels (KCa) and their subtypes have been overexpressed or dysregulated in multiple cancers including glioblastoma,12,13 breast, colon, prostate cancer14 and lymphoma.15 Similarly, voltage-gated sodium channels (VGSCs; Nav1.5, Nav1.6, Nav1.7) have been found to be overexpressed in astrocytoma, breast, colon, cervical, prostate and non-small cell lung cancers.16–20 Lastly, calcium channels as voltage-gated Ca+2 channels or transient receptor potential (TRPC) ion channels are overexpressed in breast, liver, stomach, ovarian and glioma tumors.21,22 Furthermore, when these Ca+2 channels were silenced, tumor proliferation is reduced.22,23 SV is a complex mixture of substances, among which are inorganic salts, free amino acids, heterocyclic components, peptides, and proteins. The most distinctive component of SV is peptides that modify, modulate or block ion channels, specifically modify the gating mechanism of Na+-channels, block K+-channel and Cl− or modulate the function of calcium channel.24 Thus, this opens the implication of using SV peptides in cancer therapy and development research to evaluate their potential in the clinical setting.

Anticancer Effects of SV and Their Peptides

Proliferation Inhibition and Inducing Apoptosis

Several species-specific SV have been tested in preventing or blocking the proliferation of several types of human cancer cell lines (Table 1). This anti-proliferative mechanism of action of SV or their purified peptides can be summarized into inducing apoptosis, cell arrest at Go/G1 phase, and inhibition of DNA synthesis.
Table 1

In vitro Anticancer Effects of SV or Peptides on Human Cancer Cells

SpeciesVenom/PeptideActionTargetRef.
Androctonus crassicaudaWhole venomInhibits proliferation of human neuroblastoma (SH-SY5Y) and human breast (MCF-7) cancer cell linesInduces apoptosis through increasing nitric oxide production, caspase-3 activity and depolarizing mitochondrial membrane and arrests S phase35
Androctonus crassicaudaNon-disulphide-bridged peptides (NDBP), AcrAP1 and AcrAP2, and their high cationic analogues (HC-AcrAP) (0.001-100 µM)HC-AcrAP analogues inhibit the proliferation of human lung adenocarcinoma (H460), breast carcinoma (MB435s) breast tumorigenic (MCF-7) and prostate carcinoma (PC-3) cell lines (IC50 2-3.6 µM)Probably inducing cell lysis68
Androctonus bicolor Androctonus crassicaudaWhole venom(500-1000 µg/ml)Inhibits proliferation of human breast (MDA-MB-231), and colorectal (HCT-8) cancer cellsInduces apoptosis more than necrotic death, and arrests cells at G0/G1 phase, upregulate p53, downregulate Bcl-xL29-31
Androctonus crassicauda, Androctonus bicolorWhole venom(20-100 µg/ml)Inhibits cell motility, and prevents colony mitosis of human breast, (MDA-MB-231), and colorectal (HCT-8 and HCT116) cancer cellsTwo mechanisms proposed are i) a decrease in the expression of MMPs, and ii) a reduction in the phosphorylation levels of FAK, which is involved in cell migration and invasion.31
Androctonus mauritanicusGonearrestide peptide (18 aa, 2192 Da)2-200 µMInhibits the proliferation of human colon cancer cell line HCT116 in dose-dependentArrests cancer cell cycle in G1 phase via modulating cell cycle checkpoint proteins (down-regulate CDK4, and upregulate cyclin D3, p21, p27)36
Buthus martensii KarschBmK 70-80kDaSVCIII (1-50 µg/ml)Inhibits proliferation of human acute monocytic leukemia cell line (THP-1) and the human T lymphoma (Jurkat cell line) and induces cell cycle arrest at G1 phaseInhibits NF-κB activation through inhibition of IκBα phosphorylation, degradation and p65 nuclear translocation44
BmK 50-60 aa 65 kDa (10-200 µg/ml)Inhibits proliferation of DU145 human prostate cancer cell lineEnhances expression of apoptotic gene, Bax, reduces anti-apoptotic, Bcl-2, expression, and arrests cancer cells at G1/S28
BmK AGAP 71.42KDa with 66 aa (5-60 µM) (IC50 = 40µM for MCF-7 and 50µM for MDA-MB-231 cells)Inhibits proliferation, stemness, sphere formation, colony formation epithelial-mesenchymal transition, migration and invasion of human breast MCF-7 and MDA-MB-231 cellsReduces gene and protein expression of Oct4, SOX2, Nanog, N-cadherin, Snail and PTX3, and increased the expression of E-cadherin47
Buthus tumulusIberiotoxin (IbTX) (34 aa, 36.07 kDa)Inhibits growth and proliferation of human cervical cancer (HeLa) and human ovarian cancer (A2780) cell linesBlocks calcium-activated potassium channels KCNMA1 (KCa1.1, BK) *Found to be expressed in cervical cancer-hormone dependent42-43
Centruroides margartatusMargatoxin (MgTX, 39 aa, 41.92 kDa)Inhibits proliferation of human lung adenocarcinoma cells and decreases tumor volume in vivo following intra-tumoral injectionBlocks Kv1.3, and increases expression level of p21Waf1/Cip1 and decreases the expression level of Cdk4 and cyclin D3.61
Heterometrus bengalensisBengalin 72kDaIC50 3.7 and 4.1 µg/mlInhibits proliferation of human leukemic cells (U937) and K562 chronic myelogenous leukemia (K562) and has no effect on normal human lymphocytesIncreases expression of Bax/Bcl-2 ratio, caspase 3 and 9, reduces mitochondrial membrane potential, heat shock proteins 70 and 9032
Leiurus quinquestriatusChlorotoxin (ClTx) (36 aa, MW 4.02 KDa)Inhibits migration and invasion of human glioma (D54-MG and CCF-STTG-1) cellsBinds to matrix metalloproteinase-2 (MMP-2) and modulates the surface expression of an active MMP-2 and increase the uptake of Cl-channel receptors (CIC-3)7, 53
Leiurus quinquestriatusWhole venom (20-100 µg/ml)Inhibits cell motility, and prevents colony mitosis of human breast, (MDA-MB-231) and colorectal (HCT-8 and HCT116) cancer cellsTwo mechanisms proposed are i) a decrease in the expression of MMPs, and ii) a reduction in the phosphorylation levels of FAK, which is involved in cell migration and invasion31
Odontobuthus doriaeWhole venom (20-100 µg/ml)Inhibits proliferation and inhibits DNA synthesis in human breast cancer cell line, MCF-7Depolarizes mitochondria, activates Caspase-3, and depletes antioxidant activities26
Inhibits proliferation and inhibits DNA synthesis in human neuroblastoma cells, SH-SY5Y27
Rhopalurus junceusWhole venom (100-1000 µg/ml)Inhibits proliferation on a panel of human cancer cell lines (HeLa, SiHa, Hep-2, NCI-H292, A549, MDA-MB-231, MDA-MB-468, HT-29), but has no effect on hematologic malignant cell lines (U937, K562, Raji) or normal cells (MRC-5, MDCK, Vero)Increased expression of P53, Bax, Caspase 3, 8, & 9 and reduced Bcl-2 in HeLa (apoptosis > necrosis) whereas reduced expression p53, did not affect Bax but reduced Bcl-2 in A549 (necrosis>apoptosis) reflecting concentration used >IC50 or <IC50.25
Tityus discrepansNeopladine peptides 1 (29.918kDa) and 2 (30.388 kDa)Both peptides induce apoptosis in human breast carcinoma SKBR3 cellsBind to SKBR3 cell surface and induce FasL and BcL-2 expression33
Tityus serrulatusTsAp-1 and TsAp-2 (17 aa) High Cationic TsAP-1 and TsAP-2High cationic analogue of TsAP-1 and 2 induce high anti-proliferative activity against several human cell lines: squamous carcinoma (H157), lung adenocarcinoma (H838), prostate adenocarcinoma (PC-3); breast carcinoma (MCF-7), glioblastoma (U251-MG)67
In vitro Anticancer Effects of SV or Peptides on Human Cancer Cells Several studies have shown that the whole SV from Androctonus crassicauda, Androctonus bicolor, Leiurus quinquestriatus, Odontobuthus doriae, and Rhopalurus junceus species reduced proliferation of human brain, breast, colorectal, lungs, cervix, and larynx cancer cell lines (Table 1). However, Rhopalurus junceus whole SV was tested against hematopoietic tumor and lymphoma cell lines and showed no activity.25 Regardless of the latter, the reduction of proliferation in the above cancer cell lines was due primarily due to inducing apoptosis specifically by increasing the expression of apoptotic gene bax, and bax/bcl (anti-apoptotic gene) ratio, reducing bcl gene expression, increasing caspase enzymes 3, 8, 9 activities, and inducing Fas-L expression.26–33 Furthermore, SV from either Androctonus bicolor or Androctonus crassicauda has shown to arrest cancer cells in S phase, Go/G1 phase or downregulating cyclin genes expression.29,34,35 Following the improvement of proteomic approaches to study peptides and their anticancer activities, a high throughput platform has been utilized to identify a panel of novel potential anticancer peptides in scorpion venoms and to predict their putative functions and targeted signaling pathways. Li et al36 have demonstrated a panel of potential anticancer peptides from Androctonus mauritanicus and Androctonus australis venoms and from these, Gonearrestide, a peptide from Androctonus mauritanicus, has been found to exhibit the best anti-proliferative activity on human colon cancer cell line HCT116 by modulating cell cycle checkpoint proteins (Table 1). Similarly, in vivo administration of SV from Androctonus amoreuxi reduced Ehrlich ascites carcinoma and solid Ehrlich tumor size, and increased survival of mice-bearing intraperitoneal Ehrlich carcinoma37 as well as topical administration of Leiurus quinquestriatus SV reduced skin carcinogenesis incidence in mice.38 Iberiotoxin (IbTX) is a toxin isolated from Buthus tumulus scorpion and has been found to inhibit calcium-activated potassium channels (KCNMA1). These potassium ion channels were found to be over-expressed in different cancer types such as glioma,39 as well as hormone-influenced like breast, prostate, ovarian and cervix cancer.40–42 It has been shown that iberiotoxin decreases HeLa cell proliferation and human ovarian cancer (A2780) cell lines (Table 1).42,43 Several types of peptides from Buthus martensii Karsch (BmK) have been tested in vitro and in vivo models. In one study, a peptide initially identified as 70–80 kDa fraction, termed by fractionation SVCIII, has shown anti-proliferative effect on human acute monocytic leukemia cell line (THP-1) and the human T lymphoma (Jurkat cell line), but not on normal human peripheral blood lymphocytes, and also induced cell cycle arrest at G1 phase by inhibiting the expression of cyclin D protein.44 The latter was associated with anti–inflammatory activities of the peptide in inhibiting NF-κB activation through inhibition of IκBα phosphorylation, degradation, and p65 nuclear translocation. The SVCIII fraction probably contains the BmK analgesic peptide, BmK AGAP. AGAP, which belongs to a group of long-chain scorpion peptides and has a molecular mass of 7142 Da with 66 amino acid residues, binds to VGSC and has been purified and tested mainly for its pain management.39,45,46 A very recent study by Kampo et al47 demonstrated in detail AGAP mechanism of action against two human breast cancer cell lines (Tables 1 and 2). BmK AGAP at concentrations of 5–60 µM inhibited proliferation, sphere formation, colony formation, stemness, and epithelial-mesenchymal transition (EMT) of human breast MCF-7 and MDA-MB-231 cell lines. These phenomena were related to: a) reduction in expression of specific genes and proteins related to cancer cells proliferation (PTX3), stemness (PTX3, Oct4, SOX2, Nanog), EMT (PTX3, N-cadherin, Snail) and b) increase in the expression of E-cadherin (EMT) as well. Furthermore, one of the VGSC subunits, Nav 1.5, which is overexpressed in breast cancer and associated with tumor progression,48 has been shown to mediate BmK AGAP regulatory action on PTX3 expression/activation and thus reducing the activation of NF-κB and tumor necrosis factor (TNF)-α.47 Following intraperitoneal administration of 0.5 or 1 mg/kg of rBmK AGAP into mice bearing subcutaneous xenograft of a human breast MCF-7 or MDA-MB-231 cell lines, tumor growth (volume and weight) was significantly reduced at both doses in comparison to PBS-treated mice (Table 2). These changes were accompanied with a decrease in PTX3, N-cadherin, Snail-1, Oct4, Sox2, β-catenin, pGSK3-β, Nav 1.5, and p65/NF-κB expression and an increase in E-cadherin and GSK3-β in the excised tumors from mice treated with rBmK AGAP.47 In the same study, the authors proved that PTX3 is highly expressed in breast cancer and its expression is associated with cancer stemness and EMT, and BmK AGAP downregulate PTX3 expression via inhibiting or binding to Nav1.5. This inhibition or binding resulted in a downstream reduction of NF-κB and -Wnt/beta-catenin signaling pathway and inflammatory cytokines production. These results demonstrate the potential of Bmk AGAP in treating inflammation-induced cancers.
Table 2

In vivo Anticancer Effects of SV or Peptides on Human Cancer Cells

SpeciesVenom/PeptideActionTargetRef.
Androctonus amoreuxiWhole venomi.p. 0.22 mg/kg/day for 13 days (20% LD dose)Reduced Ehrlich ascites carcinoma and solid Ehrlich tumor size, and increased survival of mice-bearing intraperitoneal tumorDownregulates expression of Ki-67 and VEGF and increased expression of caspase-337
Androctonus mauritanicusGonearrestide peptide (18 aa, 2192 Da) 50 and 100 µM peritumoral injection for 2 weeksReduced tumor growth of human colon cancer cell line HCT116 in dose-dependentModulates cell cycle checkpoint proteins (down-regulate CDK4, and upregulate cyclin D3, p21, p27)36
Buthus martensiiBmK AGAP 71.42KDa with 66 aa (0.5 and 1 mg/kg) injected i.p. for 20 days at 48 h intervalsReduced tumor growth of MDA-MB231 cells in miceReduces gene and protein expression in ex vivo tumors of Oct4, SOX2, Nanog, N-cadherin, Snail and PTX3, and increased the expression of E-cadherin47
Leiurus quinquestriatusWhole venom 17.5, 35, 52.5 µg topical twice a week for 16 weeksDecreased skin carcinogenesis incidence in miceDownregulates expression of Ki-67, NF-kB, Cox-2, Bcl-2, VEGF and proinflammatory cytokines (TNF-α and IL-6)38
Leiurus quinquestriatusTAM-601 (synthetic ClTx) at 10 µgTAM-601 at 2, 10, or 100 mg/kg (i.v.), 3x/week for 2 weeksBlocks angiogenesis in chick chorioallantoic membrane growing human tumorsReduces microvessel count in mice using Matrigel plug assayInhibits VEGF, PDF, TNF-α action on vascularization and blocks MMP-2 activity54
In vivo Anticancer Effects of SV or Peptides on Human Cancer Cells

Angiogenesis Inhibition

Angiogenesis, formation of new blood vessels, is a characteristic of solid cancer cells. Cancer cells overexpress growth factors, vascular endothelial growth factor (VEGF), and fibroblast growth factor (FGF), that drive the formation of new blood vessels. SV and their peptides have shown to inhibit the expression of VEGF. For instance, intraperitoneal administration of SV from Androctonus amoreuxi has resulted in downregulating the expression of VEGF in the tumor tissue and this was accompanied with a downregulation of the proliferative marker Ki-67 and reduction in the solid tumor size.37 Also, topical administration of Leiurus quinquestriatus SV reduced skin carcinogenesis incidence in mice, which was associated with regulating several protein expressions; one of them was VEGF. Chlorotoxin (ClTx), which was originally isolated from Leiurus quinquestriatus, is a 36 amino acid in length and has been found to bind glioma cells but not healthy glial brain cells and inhibits Cl− fluxes across glioma membranes.49–51 Similarly, the synthetic peptide of CITx, TM601, was found to be selective to glioma cells but not to non-transformed neurons, astrocytes, or fibroblasts.52 Although TM601 binds to glioma cells, it is non-toxic to cancer cells. However, it has been shown to block angiogenesis in vitro and in vivo.8,53 TM601 treatment of human tumors (SK-Mel melanoma, PC-3 prostate, and U87-MG glioblastoma) grown on the chick chorioallantoic membrane decreased tumor vascularization in chick.54 In addition, TM601 has shown to reduce microvessel count in mice using the Matrigel plug assay. These results were related to inhibition of the VEGF and platelet-derived growth factor.

Invasion and Metastasis Inhibition

SV isolated from either Androctonus crassicauda, Androctonus bicolor, or Leiurus quinquestriatus has been found to interrupt metastasis of breast and colorectal cancer cell lines.31 The authors proposed that SV might decrease the expression of matrix metalloproteinases (MMPs), and/or reduce the phosphorylation levels of FAK, a marker involved in cell migration and invasion.31 In addition, CITx, has been found to inhibit migration and invasion of human glioma (D54-MG and CCF-STTG-1) cells.7,53 Furthermore, glioma cell invasion in the brain was found to require secretion and flux of Cl− ions through their membrane,51 and the activation of MMPs that are highly expressed on glioma and not on normal brain cells.55 Deshane et al53 studied this phenomenon in more details, and their study revealed that ClTx selectively binds to MMP-2, but not to other MMP isoforms, and this binding forms a ClTx-MMP2 complex. This complex reduces the activity of MMP-2, followed by complex internalization inside the glioma cells along with Cl− ion channels, into caveolar rafts, which depletes the available membrane-associated Cl− channels and reduces the expression of MMP-2 on these cells, thereby decreasing invasion process of glioma inside the brain.51 In other in vitro studies, it has been shown that ClTx reduced the migration ability of glioma cells through tight extracellular spaces in the brain tissue by MMP2 inhibition. Blocking MMP2 and reducing Cl− channel expression prevented glioma cells from shrinking (prevented Cl and other ions efflux) and releasing MMP2 to the extracellular matrix.56 Clinically and following local delivery of 131I-TM601 to the resection cavity in patients with recurrent glioblastoma, gamma camera and Single Photon Emission Computed Tomography (SPECT) scans have shown that the peptide is retained at the tumor cavity site for up to 8 days after drug administration.57,58 Like ClTx, BmK peptides have also exhibited an effect on cell migration and metastasis. BmK peptide is a chlorotoxin-like peptide (BmKCTx) and shares amino acid sequence homology of ClTx. BmKCTx, as a Cl−channel blocker, was found to bind to human glioma (SHG SHG-44) cells and inhibit their proliferation at an effective concentration 29 times less than on normal astrocytes,59 and inhibits the invasion and migration of rat glioma (C6) cells by antagonizing MMP −2.59,60 Also as mentioned earlier, the BmK AGAP, which binds to the subunit of VGSC (Nav 1.5), not only inhibited in vitro and in vivo proliferation, stemness, sphere formation, colony formation, epithelial-mesenchymal transition (EMT), but also migration and invasion of human breast MCF-7 and MDA-MB-231 cells.47

SV Peptides, Ion Channels and Immunomodulation

We have presented studies that show the immunomodulatory effect of SV on proinflammatory markers such as NFκB, TNF-α and IL-6.30,38,44,47,54 It has been documented that blocking specific ion channels results in regulating inflammation. In general, charged ions move across hydrophobic membranes via ion channels. However, in immune cells, Ca++, as a divalent cation, has essential second messenger roles in regulating intracellular signaling pathways and lymphocytes activation, whereas monovalent cations (Na+, K+) mainly regulate the negative membrane potential (Vm), which indirectly controls the influx of calcium and immune cell signaling/activation. Therefore, regulating or blocking ion channels would affect signal transduction in immune cells and thus modulate their functions. VGSCs (mentioned above) are generally responsible for the rising phase of the action potential in most electrically excitable cells and thus crucial in generating impulses and propagation. However, VGSCs have been found to be expressed in non-excitable cells, such as immune cells, and cancer cells.48 VGSCs comprise a multi-gene family of at least nine different functional members (NaV1.1–1.9) coding for the pore-forming α-subunits. There are also four auxiliary β-subunits, of which one or two at a time can associate with an α-subunit and modulate channel expression and activity in the plasma membrane. For instance, BmK AGAP, which binds to Nav 1.5, downregulate PTX3 expression, which resulted in a downstream reduction of NF-κB and Wnt/beta-catenin signaling pathway and inflammatory cytokines production.47 Similarly, BmK fraction of 70–80 KDa was found to inhibit NF-κB activation through inhibition of IκBα phosphorylation, degradation, and p65 nuclear translocation.44 Margatoxin (MgTx) isolated from Centruroides margartatus blocks Kv1.3.61 Kv1.3 has an essential role in Th17 activation, proliferation, and cytokine production, and blocking Kv1.3, attenuates experimental autoimmune encephalomyelitis, autoimmune diabetes and in Kv1.3 -/- mice become resistant to autoimmune diabetes and rheumatoid arthritis.62 Therefore, SV peptides play a significant immunomodulatory action on immune cells and cytokine expression that repolarize inflammation-induce cancer processes. Such immunomodulatory action is an essential pathway to regulate cancer development and growth.

Polarization of SV Venom

In late 2008, Dr. Mikaelian filed a patent on polarizing diluted SV solution that makes the venom more stable, results-consistent, and have more efficacy in regards improving immune response, treating and preventing cancer as well as relieving pain and reducing the adverse events of chemotherapy and radiation.63 The polarization step involves placing the SV solution in an electromagnetic chamber of the MRT-06 polarization machine for 5 hrs, where a monopole field is created by an AC power source. In the patent, the author showed the significance of the polarized Rhopalurus junceus, a species of Buthidae, venom on reducing cancer cell proliferation, tumor size in vivo in a dose-dependent manner, as well as pain.

Rhopalurus princeps (Rp) Venom

Anticancer Effects of Rp Venom

Following the patent, several studies have been performed on a different species of Buthidae family, Rhopalurus princeps (Rp) venom and have been tested in vitro on different human cancer cell lines as well as on normal cells (unpublished data). For instance, Rp venom has been tested on the human prostate cancer cell line, BxPC3, and found that polarized Rp venom significantly inhibited BxPC3 proliferation in a concentration- (≥500 µg/mL) and time-dependent (≥48 hr) manner. In other cell lines, polarized Rp SV has eradicated in vitro human ovarian (OVCAR3 and IGR-OV1) and bladder (SCaBER) cell lines in a concentration-dependent manner (Figure 2). On the other hand, high concentrations of the Rp venom did not exhibit cytotoxicity on dermal fibroblasts or normal ARPE-19 cell line.
Figure 2

Survival curves of three human cancer cell lines; bladder squamous cell carcinoma cell line (SCaBER, obtained from ATCC), and two ovarian cancer cell lines, OVCAR-3 and IGR-OV1 (obtained from NCI), following a 24 hr incubation with increasing volumes of polarized Rhopalurus princeps venom (Rp). Cell were plated on 24-well plates (5.0 × 104 cells/well) in a volume of 500 ul medium per well and incubated for 24-hr. Then, the cells were treated with the indicated volumes of the polarized Rp for an additional day. Cell viability was determined by the MTT colorimetric assay. These set of experiments were repeated twice.

Survival curves of three human cancer cell lines; bladder squamous cell carcinoma cell line (SCaBER, obtained from ATCC), and two ovarian cancer cell lines, OVCAR-3 and IGR-OV1 (obtained from NCI), following a 24 hr incubation with increasing volumes of polarized Rhopalurus princeps venom (Rp). Cell were plated on 24-well plates (5.0 × 104 cells/well) in a volume of 500 ul medium per well and incubated for 24-hr. Then, the cells were treated with the indicated volumes of the polarized Rp for an additional day. Cell viability was determined by the MTT colorimetric assay. These set of experiments were repeated twice. In apoptosis assay, Rp venom induced apoptosis in the BxPC3 cell line at very low concentrations (Figure 3A). Furthermore, the polarization of Rp venom significantly enhanced the incidence of apoptosis in BxPC3 (Figure 3B and C). However, adding AuNP, a delivery agent, to nonpolarized Rp venom increased the apoptotic activity but did not significantly change the percent apoptosis to the polarized venom (Figure 3B and C), indicating that polarization of SV has a similar impact to AuNP on Rp venom-inducing apoptosis. These results suggest that anticancer activity of Rp venom is mainly by inducing apoptosis rather than inhibiting metabolic pathways of cancer cells64 and secondly polarization of Rp venom induces higher apoptotic effects on cancer cells.
Figure 3

Percent induced apoptosis in human prostate cancer cell line, BxPC3 (obtained from ATCC), following a 24-hr incubation with (A) increasing concentrations of Rhopalurus princeps venom (Rp); (B) with a single concentration (2.8 µg/mL) of Rp venom, polarized Rp, Rp+AuNP, Rp+AuNP polarized; and (C) with two different Rp concentrations that are: Rp venom, polarized Rp or Rp+AuNP polarized. Venom was conjugated with 50-nm AuNP (Cytodiagnostics, Burlington, Ontario, Canada) and then polarized. Apoptosis was measured using the EMD Millipore ApopTag plus peroxide in situ Apoptosis detection kit (Danvers, Mass.). These set of experiments were repeated twice.

Percent induced apoptosis in human prostate cancer cell line, BxPC3 (obtained from ATCC), following a 24-hr incubation with (A) increasing concentrations of Rhopalurus princeps venom (Rp); (B) with a single concentration (2.8 µg/mL) of Rp venom, polarized Rp, Rp+AuNP, Rp+AuNP polarized; and (C) with two different Rp concentrations that are: Rp venom, polarized Rp or Rp+AuNP polarized. Venom was conjugated with 50-nm AuNP (Cytodiagnostics, Burlington, Ontario, Canada) and then polarized. Apoptosis was measured using the EMD Millipore ApopTag plus peroxide in situ Apoptosis detection kit (Danvers, Mass.). These set of experiments were repeated twice.

Structural Analysis of Rp Venom and in silico Studies

Several studies have been performed to characterize Rp venom. Mass Spectrometry Analysis (MALDI-TOF) revealed 176 molecular mass fragments ranging from ~500–32,000 Da (Table 3). Following BLAST analysis, one of the peptides in Rp venom, termed (Rp-ClTx), resembles in sequence and amino acid length the chlorotoxin peptide from Leiurus quinquestriatus hebraeus – the Death Stalker scorpion (Lqq-CITx) and others (Table 4).65–67 Rp-ClTx shares the highest sequence identity (97%) with Lqq-CITx. The in silico study revealed that Rp-CITX has 4-stranded antiparallel beta-sheets (residues 22–24; 34–36; 59–62; and 71–74) with four disulfide bridges, C1(2)-C4(19), C2(5)-C6(28), C3(16)-C7(33), and C4(20)-C8(35), and are cross-linking the alpha-helix to the beta-sheets.68 The fourth disulfide bridge (C1(2)-C4(19) links the small N-terminal beta-strand to the rest of the molecule (Figure 4).
Table 3

MALDI-TOF Analysis of Rhopalurus princeps Venom

Mass Range (m/z)Number of FragmentsDaltons
480–500030494.5–4247.6
600–25,00075819.3–17,596.8
800–60,000711979.1–31,840.8
Table 4

Sequence Similarities of Rp-ClTx with Other Chlorotoxin-Like Peptides

Name*Size
Bs14CGPCFTKDPETEKKCAECCGGIGRCFGPQCLCNRGY36
Lqq-CITX**CMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR36
Rp-CITX**CMPCFTTDHQMARKCDDCCGGLGRGKCYGPQCLCR36
AmmP2CGPCFTTDPYTESKCATCCGGRGKCVGPQCLCNRI35
BmKCL1CGPCFTTDANMARKCRECCGGIGKCFGPQCLCNRI35
CITx-bCGFCFTTDHQTEQKCAECCGGIGKCYGPQCLCRG-34
CITx-cCGFCFTTDRQMEQKCAECCGGIGKCYGPQCLCRG34
CITx-dCGPCFTTDHQTEQKCAECCGGIGKCYGPQCLC---32
Put-1EKDCIAPGAPCFGTDKPCCNPRAWCSSYANKCL34

Notes: *The bold C (Cys amino acids) residues are present in 8 locations of all tested chlorotoxin-like peptides, except for Put-1, which form the 4-disulfide bridges. **The highlighted red amino acid sequence shows the similarity of Rp-ClTX to Lqq-ClTX, which accounts for 97%.

Figure 4

Three dimensional structures of chloride, calcium, potassium and sodium ion channel inhibitors present in Rhopalurus princeps venom (Rp) showing the α-helix, β-sheets and the disulphide bridges in each inhibitor.

MALDI-TOF Analysis of Rhopalurus princeps Venom Sequence Similarities of Rp-ClTx with Other Chlorotoxin-Like Peptides Notes: *The bold C (Cys amino acids) residues are present in 8 locations of all tested chlorotoxin-like peptides, except for Put-1, which form the 4-disulfide bridges. **The highlighted red amino acid sequence shows the similarity of Rp-ClTX to Lqq-ClTX, which accounts for 97%. Three dimensional structures of chloride, calcium, potassium and sodium ion channel inhibitors present in Rhopalurus princeps venom (Rp) showing the α-helix, β-sheets and the disulphide bridges in each inhibitor. Furthermore, other ion channel peptides inhibitors have been found in the Rp venom. The calcium voltage-gated peptide inhibitor consists of 34 amino acids, including six cysteines and three disulfide bonds.69 This inhibitor belongs to the inhibitory cysteine knot structural family that includes a compact disulfide-bonded core from which four loops emerge. The disulfide bonds are as follows: C1(5)-C4(20), C2(12)-C5(26), C3(19)-C6(33). This peptide contains a 2-stranded antiparallel beta-sheets (residues 26–27 and 32–33) as the only secondary structures. Similarly, the potassium channel peptide inhibitor has 31 amino acids in including six cysteines and three disulfide bonds (Figure 4). The structure consists of a double-stranded antiparallel β-sheet (sequences 19–23 and 26–30) and a single helix (sequences 4–15) covering one face of the α-sheet.68 The cysteine side chains connecting the β-sheet and the helix form the core of the molecule. The disulfide bonds are as follows: C1(3)-C4(22), C2(8)-C5(27), C3(12)-C6(29) (Figure 4). Finally, sodium channel peptide inhibitor is also present in Rp venom and consists of 76 amino acids in including twelve cysteines and six disulfide bonds.70 The six disulfide bonds are as follows: C1(4)-C4(19), C2(11)-C5(24), C3(18)-C6(34), C7(41)-C10(56), C8(48)-C11(61), C9(55)-C12(72). This peptide inhibitor contains 4-stranded antiparallel beta-sheets (residues 22–24; 34–36; 59–62; and 71–74) as the only secondary structures.

Concluding Remarks

In the present review, we show the pleiotropic effect of SV and their peptides in a) inhibiting the proliferative characteristics of cancer cells by mainly inducing apoptosis without affecting healthy cells such as lymphocytes proliferative capabilities, b) interrupting the invasion and metastatic capabilities of cancer cells, c) inhibiting angiogenesis and d) modulating the immune cell function by lowering the inflammatory cascade that occurs in some cancer types. Thus, these encouraging results signify the potential of SV peptides in targeting multiple events in cancer cells development and metastasis. However, it has to be addressed that the concentrations used to show an inhibitory effect for some whole SV were high (IC50 > 500 µg/mL), whereas the IC50 concentrations significantly became low when specific peptides isolated, or recombinant type were used. Interestingly, some recombinant peptides became more anti-proliferatively potent when more cationic amino acids were introduced in the peptide (Table 1).71–73 The latter phenomenon could be initiated by increasing the electrostatic interaction between cationic peptides and the negative membrane charges of tumor cells. The high negative charge of tumor cells is mainly due to the presence of phosphatidylserine, a negatively charged amino acid, on the outer surface of the plasma membrane of tumor cells. Similarly, the polarization of Rp venom showed better anticancer potential in increasing the apoptosis in cancer cells. A recent review by Marshall & Djamgoz5 pointed out several novel immunotherapy co-targets in pre-clinical development, and one of these targets is ion channels. Since ion channels dysregulation are a factor in cancer development, targeting them would be a unique tool multi-faceted advantages for T cell-based immunotherapy.5 Therefore, we believe that the immunomodulatory effects of SV and their specific peptides would benefit the immune-oncology research programs mainly with the checkpoint inhibitors such as PD-1 and CTLA-4 blockade in reducing tumor microenvironment immunosuppression, immune-checkpoint resistance and enhancing cancer patient response. Before clinical efficacy is established, non-clinical safety is an evident marker of the success of any pharmaceutical agent in translation medicine. Synthetic ClTx peptide (tozuleristide, or BLZ-100) has shown to be safe and has not exhibit any adverse events in rats and non-human primates following a single intravenous dose of 28 mg/kg and 20 mg/kg, respectively.74 Furthermore, in Phase 1 clinical trial, no adverse event was observed following an intravenous dose of up to 30 mg.75 These targeted and promising results of SV open the venue for full non-clinical safety profiles to be performed before clinical translation into cancer therapy.
  73 in total

1.  Scorpion toxins targeted against the sarcoplasmic reticulum Ca(2+)-release channel of skeletal and cardiac muscle.

Authors:  H H Valdivia; M S Kirby; W J Lederer; R Coronado
Journal:  Proc Natl Acad Sci U S A       Date:  1992-12-15       Impact factor: 11.205

Review 2.  Low-voltage-activated T-type Ca2+ channel inhibitors as new tools in the treatment of glioblastoma: the role of endostatin.

Authors:  Yuan Zhang; Hua Wang; Zhiyuan Qian; Bo Feng; Xianyang Zhao; Xinghong Jiang; Jin Tao
Journal:  Pflugers Arch       Date:  2014-01-10       Impact factor: 3.657

3.  KCNMA1 gene amplification promotes tumor cell proliferation in human prostate cancer.

Authors:  M Bloch; J Ousingsawat; R Simon; P Schraml; T C Gasser; M J Mihatsch; K Kunzelmann; L Bubendorf
Journal:  Oncogene       Date:  2006-12-04       Impact factor: 9.867

4.  Therapeutic potential of chlorotoxin-like neurotoxin from the Chinese scorpion for human gliomas.

Authors:  Yue-Jun Fu; Li-Tian Yin; Ai-Hua Liang; Chao-Feng Zhang; Wei Wang; Bao-Feng Chai; Jian-Yi Yang; Xiao-Jun Fan
Journal:  Neurosci Lett       Date:  2006-12-12       Impact factor: 3.046

5.  Phase 1 Safety, Pharmacokinetics, and Fluorescence Imaging Study of Tozuleristide (BLZ-100) in Adults With Newly Diagnosed or Recurrent Gliomas.

Authors:  Chirag G Patil; David G Walker; Dennis M Miller; Pramod Butte; Beth Morrison; David S Kittle; Stacey J Hansen; Kaitlin L Nufer; Kelly A Byrnes-Blake; Miko Yamada; Lynlee L Lin; Kim Pham; Jeff Perry; Julia Parrish-Novak; Laura Ishak; Tarl Prow; Keith Black; Adam N Mamelak
Journal:  Neurosurgery       Date:  2019-10-01       Impact factor: 4.654

Review 6.  Cl- and K+ channels and their role in primary brain tumour biology.

Authors:  Kathryn L Turner; Harald Sontheimer
Journal:  Philos Trans R Soc Lond B Biol Sci       Date:  2014-02-03       Impact factor: 6.237

7.  Structure-Activity Relationship of Chlorotoxin-Like Peptides.

Authors:  Syed Abid Ali; Mehtab Alam; Atiya Abbasi; Eivind A B Undheim; Bryan Grieg Fry; Hubert Kalbacher; Wolfgang Voelter
Journal:  Toxins (Basel)       Date:  2016-02-02       Impact factor: 4.546

Review 8.  Molecular subgroups of medulloblastoma.

Authors:  Paul A Northcott; Adrian M Dubuc; Stefan Pfister; Michael D Taylor
Journal:  Expert Rev Neurother       Date:  2012-07       Impact factor: 4.618

9.  Investigation of in vivo potential of scorpion venom against skin tumorigenesis in mice via targeting markers associated with cancer development.

Authors:  Abdulrahman K Al Asmari; Abdul Quaiyoom Khan
Journal:  Drug Des Devel Ther       Date:  2016-10-18       Impact factor: 4.162

10.  Scorpion Venom Analgesic Peptide, BmK AGAP Inhibits Stemness, and Epithelial-Mesenchymal Transition by Down-Regulating PTX3 in Breast Cancer.

Authors:  Sylvanus Kampo; Bulbul Ahmmed; Tingting Zhou; Lawrence Owusu; Thomas Winsum Anabah; Natacha Raissa Doudou; Eugene Dogkotenge Kuugbee; Yong Cui; Zhili Lu; Qiu Yan; Qing-Ping Wen
Journal:  Front Oncol       Date:  2019-01-25       Impact factor: 6.244

View more
  5 in total

1.  Serine O-acetyltransferase derived NV14 peptide reduces cytotoxicity in H2O2 induced MDCK cells and inhibits MCF-7 cell proliferation through caspase gene expression.

Authors:  Manikandan Velayutham; B Haridevamuthu; P Snega Priya; Munuswamy Ramanujam Ganesh; Annie Juliet; Jesu Arockiaraj
Journal:  Mol Biol Rep       Date:  2022-08-08       Impact factor: 2.742

2.  Astragalus-Scorpion Drug Pair Inhibits the Development of Prostate Cancer by Regulating GDPD4-2/PI3K/AKT/mTOR Pathway and Autophagy.

Authors:  Xujun You; Yongrong Wu; Qixin Li; Wen Sheng; Qing Zhou; Wei Fu
Journal:  Front Pharmacol       Date:  2022-06-29       Impact factor: 5.988

3.  In vitro anticancer activity of hydrogen sulfide and nitric oxide alongside nickel nanoparticle and novel mutations in their genes in CRC patients.

Authors:  Zjwan Housein; Tayeb Sabir Kareem; Abbas Salihi
Journal:  Sci Rep       Date:  2021-01-28       Impact factor: 4.379

4.  Pioneering Study on Rhopalurus crassicauda Scorpion Venom: Isolation and Characterization of the Major Toxin and Hyaluronidase.

Authors:  Caio B Abreu; Karla C F Bordon; Felipe A Cerni; Isadora S Oliveira; Carla Balenzuela; Gabriel M Alexandre-Silva; Karina F Zoccal; Mouzarllem B Reis; Gisele A Wiezel; Steve Peigneur; Ernesto L Pinheiro-Júnior; Jan Tytgat; Tiago M Cunha; Loic Quinton; Lúcia H Faccioli; Eliane C Arantes; Umberto Zottich; Manuela B Pucca
Journal:  Front Immunol       Date:  2020-08-20       Impact factor: 7.561

5.  Scorpion and Frog Organ Lysates are Potential Source of Antitumour Activity.

Authors:  Morhanavallee Soopramanien; Naveed Ahmed Khan; Sumayah Abdelnasir Osman Abdalla; K Sagathevan; Ruqaiyyah Siddiqui
Journal:  Asian Pac J Cancer Prev       Date:  2020-10-01
  5 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.