| Literature DB >> 31636331 |
Kh Shamsur Rahman1, Bernhard Kaltenboeck2.
Abstract
Cross-reactivity of classical chlamydial antigens compromises Chlamydia (C.) pneumoniae serology. By testing with 185 human antisera, we expanded 18 previously discovered C. pneumoniae-specific B-cell epitopes to 48 peptide antigens from 12 C. pneumoniae immunodominant proteins. For specific detection of antibodies against C. pneumoniae, we developed novel ELISAs with strongly reactive individual peptide antigens and mixtures of these peptides. By comparison to a composite reference standard (CRS) for anti-C. pneumoniae antibody status of human sera, the top-performing CpnMixF12 peptide assay showed 91% sensitivity at 95% specificity, significantly higher than 4 commercial anti-C. pneumoniae IgG ELISAs (36-12% sensitivity at 95% specificity). Human C. pneumoniae (Cpn) and C. trachomatis (Ctr) seroreactivity was 54% biased towards co-positivity in commercial Cpn and Ctr ELISAs, but unbiased in Cpn and Ctr peptide antibody assays, suggesting severe cross-reactivity of commercial ELISAs. Using hyperimmune mouse sera against each of 11 Chlamydia spp., we confirm that commercial Cpn and Ctr ELISA antigens are cross-reactive among all Chlamydia spp., but Cpn and Ctr peptide antigens react only with antisera against the cognate chlamydial species. With simultaneously high specificity and sensitivity, and convenient use for non-specialized laboratories, these ELISAs have the potential to improve serodiagnosis of C. pneumoniae infection.Entities:
Mesh:
Substances:
Year: 2019 PMID: 31636331 PMCID: PMC6803651 DOI: 10.1038/s41598-019-51501-5
Source DB: PubMed Journal: Sci Rep ISSN: 2045-2322 Impact factor: 4.379
Chlamydia pneumoniae-specific peptide antigens.
| Proteina | Peptide # b | Peptide (Position, AA#)c | Peptide sequenced | Human serum reactivitye | Mouse serum reactivity (RLU)f | Human host-dependentg | Sequence conservation (%, identity)h | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| RLU | Rank # | Cpn | Ctr | Cps | Cpn | Ctr | Chl | |||||
| IncA/IncCT119 | 1 | 331–370 | QKAESEFIACVRDRTFGRRETPPPTTPVVEGDESQEEDEG | 7,062 | 1 | 132,193 | 0 | 0 | No | 83–100 | ≤40 | ≤40 |
| 2 | 331–345 | QKAESEFIACVRDRT | 4,356 | 3 | 6,372 | 0 | 0 | No | 80–100 | ≤40 | ≤40 | |
| 3 | 336–350 | EFIACVRDRTFGRRE | 2,565 | 4 | 26,483 | 0 | 0 | No | 93–100 | ≤40 | ≤40 | |
| 4 | 344–363 | RTFGRRETPPPTTPVVEGDE | 1,441 | 11 | 49,698 | 0 | 0 | No | 86–100 | ≤40 | ≤40 | |
| 5 | 361–375 | GDESQEEDEGGTPPV | 623 | 30 | 11,520 | 0 | 0 | No | 93–100 | ≤40 | ≤40 | |
| Pmp6G/I | 6 | 222–237 | TATDKGGGIYSKEKDS | 5,172 | 2 | 0 | 0 | 4 | Yes | 94–100 | 44 | 44–50 |
| 7 | 947–962 | AGTTLETTTTNNTDGS | 1,649 | 8 | 0 | 0 | 0 | Yes | 100 | ≤40 | ≤40 | |
| 8 | 181–196 | AKTTTAALLDQNTSTK | 1,640 | 9 | 0 | 0 | 0 | Yes | 100 | ≤40 | 40–47 | |
| 9 | 164–179 | NTSEKDGAAVSAYSID | 1,402 | 12 | 0 | 0 | 0 | Yes | 100 | ≤40 | 40–56 | |
| 10 | 1223–38 | HGQVSYGRNHHNMTTK | 1,366 | 13 | 0 | 0 | 0 | Yes | 100 | ≤40 | 40–50 | |
| 11 | 899–914 | QDASIPANTTTILNQK | 895 | 18 | 0 | 0 | 0 | Yes | 100 | ≤40 | 40–44 | |
| 12 | 872–887 | ASVPVVPVAPANPNTG | 813 | 21 | 0 | 0 | 0 | Yes | 100 | ≤40 | ≤40 | |
| 13 | 697–712 | DIATKSLTLTENESLS | 776 | 27 | 0 | 0 | 0 | Yes | 100 | ≤40 | ≤40 | |
| 14 | 1032–47 | NLDDFNPIPSSMAAPD | 529 | 36 | 0 | 0 | 0 | Yes | 100 | ≤40 | ≤40 | |
| 15 | 714–729 | INNTAKRSGGGIYAPK | 526 | 37 | 0 | 0 | 0 | Yes | 100 | ≤40 | ≤40 | |
| Pmp21D | 16 | 1119–34 | SQVDSSAPLPTENKEE | 1,841 | 5 | 0 | 0 | 0 | Yes | 100 | ≤40 | ≤40 |
| 17 | 140–155 | DTSNAVSEKISSDTKE | 1,540 | 10 | 0 | 0 | 0 | Yes | 100 | ≤40 | ≤40 | |
| 18 | 640–655 | TAPVESDASSTNKDEK | 1,356 | 14 | 0 | 0 | 0 | Yes | 100 | ≤40 | ≤40 | |
| 19 | 191–206 | EDLEISENISARDPLQ | 1,202 | 15 | 0 | 0 | 0 | Yes | 100 | ≤40 | ≤40 | |
| 20 | 147–186 | EKISSDTKENRKDLETEDPSKKSGLKEVSSDLPKSPETAV | 988 | 17 | 62,389 | 4 | 0 | No | 100 | ≤40 | ≤40 | |
| 21 | 1131–70 | NKEETLVSAGVQINMSSPTPNKDKAVDTPVLADIISITVD | 561 | 32 | 53,127 | 0 | 0 | No | 100 | ≤40 | ≤40 | |
| 22 | 654–693 | EKSLNACSHGDHYPPKTVEEEVPPSLLEEHPVVSSTDIRG | 542 | 33 | 63,913 | 0 | 0 | No | 100 | ≤40 | ≤40 | |
| 23 | 717–732 | LGGGEESSTVGDLAIV | 375 | 42 | 0 | 0 | 0 | Yes | 100 | ≤40 | ≤40 | |
| 24 | 1121–36 | VDSSAPLPTENKEETL | 306 | 44 | 0 | 0 | 0 | Yes | 100 | ≤40 | ≤40 | |
| 25 | 521–536 | RSNPKLEQKDSGENIN | 298 | 45 | 0 | 0 | 0 | Yes | 100 | ≤40 | ≤40 | |
| OmpA/MOMP | 26 | 242–257 | VAFPLPTDAGVATATG | 1,061 | 16 | 7,549 | 0 | 0 | No | 100 | ≤40 | 40–63 |
| 27 | 158–173 | FGVKGTTVNANELPNV | 804 | 23 | 6,013 | 0 | 0 | No | 88–100 | ≤40 | 40–63 | |
| 28 | 309–324 | AVLNLTAWNPSLLGNA | 292 | 46 | 51,609 | 826 | 836 | No | 94–100 | ≤40 | 40–81 | |
| 29 | 089–104 | PTGSAAANYTTAVDRP | 77 | 47 | 48,711 | 0 | 0 | No | 94–100 | ≤40 | 40–75 | |
| YopC/GspD | 30 | 077–092 | HTKKTTPGSIPSKVFS | 826 | 20 | 0 | 0 | 0 | Yes | 100 | ≤40 | ≤40 |
| 31 | 104–119 | KTSGSAFPAKPTTLKE | 391 | 40 | 47 | 0 | 0 | Yes | 100 | ≤40 | ≤40 | |
| 32 | 196–211 | TEKDVQPKTQATPHAS | 381 | 41 | 0 | 0 | 0 | Yes | 94–100 | ≤40 | ≤40 | |
| CT618/IncCT618 | 33 | 201–216 | PETISDPENRNKPSAE | 811 | 22 | 76,037 | 0 | 0 | No | 100 | ≤40 | ≤40 |
| Pmp11G/I | 34 | 487–502 | GLKQPVSLTAKGASNK | 795 | 25 | 0 | 0 | 0 | Yes | 100 | ≤40 | 40–44 |
| 35 | 720–735 | GRAKFSESAIEKFPRE | 778 | 26 | 0 | 0 | 0 | Yes | 100 | ≤40 | ≤40 | |
| 36 | 888–903 | LLRGSNNYVYNSNCEL | 771 | 28 | 0 | 0 | 0 | Yes | 100 | ≤40 | 40–44 | |
| 37 | 334–349 | FVRNTLTTTGSTDTPK | 446 | 39 | 0 | 0 | 0 | Yes | 100 | ≤40 | ≤40 | |
| CT529/IncCT529 | 38 | 236–275 | RAKESLYNERCALENQQSQLSGDVILSAERALRKEHVATL | 1,816 | 6 | 5,741 | 0 | 0 | No | 100 | ≤40 | ≤40 |
| 39 | 139–254 | KERKTPGEYSKMLLTR | 1,773 | 7 | 6 | 0 | 0 | Yes | 94–100 | ≤40 | ≤40 | |
| Pmp2G/I | 40 | 064–079 | VVIENVPKTGETQSTS | 833 | 19 | 15 | 0 | 0 | Yes | 100 | ≤40 | ≤40 |
| 41 | 024–039 | AATTEELSASNSFDGT | 447 | 38 | 0 | 0 | 0 | Yes | 100 | ≤40 | 40–69 | |
| YwbM/CPn0677 | 42 | 265–280 | DPGESIQNFLETRVSD | 801 | 24 | 0 | 0 | 0 | Yes | 100 | ≤40 | ≤40 |
| 43 | 209–244 | TSSTGPVPQAVTVAKD | 673 | 29 | 21 | 0 | 0 | Yes | 100 | ≤40 | ≤40 | |
| 44 | 233–248 | AIKNLENPKPGNDPDG | 535 | 35 | 0 | 0 | 0 | Yes | 94–100 | ≤40 | ≤40 | |
| CrpA/CT442 | 45 | 173–188 | TTPVLNDGRGTPVLSP | 581 | 31 | 72 | 0 | 0 | Yes | 71–100 | ≤40 | ≤40 |
| 46 | 181–196 | RGTPVLSPLVSKIARV | 29 | 48 | 0 | 0 | 0 | Yes | 94–100 | ≤40 | ≤40 | |
| PdhC | 47 | 91–106 | PKTEPSNLEASPKGSS | 541 | 34 | 95 | 0 | 0 | Yes | 100 | ≤40 | ≤40 |
| 48 | 105–120 | SSEEVSPATTPQAASA | 346 | 43 | 105 | 0 | 0 | Yes | 100 | ≤40 | ≤40 | |
aFrom 12 immunodominant proteins of C. pneumoniae strain CWL029, a set of 48 C. pneumoniae-specific peptide antigens with highest reactivity is shown.
bThese 48C. pneumoniae-specific peptide antigens are numbered (#1 to #48) for ease in peptide antigen preparation and reporting composition of Cpn peptide antigen mixes.
cThe amino acid (AA) positions of the peptide sequence in each full-length protein of C. pneumoniae strain CWL029 is shown.
dOnly the actual chlamydial sequence of peptide antigens is shown, without N-terminal biotin and serine-glycine-serine-glycine (SGSG) spacer that is attached to each peptide.
eAverage peptide antigen reactivity in relative light units (RLU) in chemiluminescent ELISA by use of 4 sub-pooled human sera of 185 blood donors is shown.
fPeptide antigen reactivity with hyperimmune mouse sera pooled from 16–50 mice is shown. Cpn indicates C. pneumoniae-specific pooled sera that were raised in mice by 3 × intranasal inoculation of live C. pneumoniae CWL029 bacteria as previously described[41,45]. Ctr indicates C. trachomatis D/UW-3/CX; and Cps, C. psittaci 02DC15.
g‘No’ indicates that the peptide antigen is recognized by both human and mouse pooled sera. Yes, indicates that the antigen is recognized by human sera, but not or only minimally recognized by mouse antisera.
hCpn indicates range of sequence conservation within 6 strains of C. pneumoniae (CWL029, TW-183, AR39, J138, B21, and LPCoLN). Ctr indicates sequence conservation between C. pneumoniae CWL029 and C. trachomatis D/UW-3/CX, and Chl for sequence conservation between C. pneumoniae CWL029 and each of the remaining 9 Chlamydia spp. Sequence identities of 45%, 60%, 75%, and 90% translate into peptide cross-reactivity probabilities of 0.02, 0.12, 0.46, and 0.84, respectively[41]. Sequences with identities below 40% typically cannot be aligned correctly and the probability of peptide cross-reactivity is less than 1%[41].
Figure 1Anti-C. pneumoniae IgG antibodies detected by 29 assays. To identify sets of anti-C. pneumoniae antibody-positive and -negative sera, a panel of 185 blood donor sera was analyzed with 13 mixed and 12 individual Cpn peptide antigen assays, and 4 commercial C. pneumoniae ELISAs (details shown in Fig. S4). Analyses in the first three columns (C1-C3) are input for the preliminary composite reference standard 1 (CRS1) in C4. For each serum, the sum of the squared OD values of the individual assays in each category was determined. Grey indicates antibody positivity among the 95 highest reactive sera in combined scoring of the assay categories. Cutoff-independently, the 95 top-ranked reactive sera were specified as positive for anti-C. pneumoniae antibodies, matching the mean 51.4% anti-C. pneumoniae IgG antibody prevalence in the study population determined by 4 commercial ELISAs. Using a 80.5% specificity cutoff based on CRS1, quantitative reactivity scores for assay categories C5-C7 were determined. These scores were derived from the sum of quartile positive reactivities of all component assays of each category (Fig. S4). The total score of all 29 individual assays for each serum, shown in the right bar graph, was derived from the sum of all individual assay scores. For assay performance evaluation, CRS2, CRS3, and CRS4 (C8-C10) were derived. For CRS2, 154 sera with the highest combined score in the 29 assays were considered antibody-positive (red & grey), and 31 sera with the lowest scores were considered antibody-negative (green). CRS3 was derived from CRS2 after exclusion of 59 borderline -positive sera (grey). CRS4 was constructed as peptide assay-based standard from the combined scores of 13 mixed and 12 individual peptide assays (without the 4 commercial ELISAs). The 95 sera with the highest score were considered antibody-positive (red), 40 sera with the lowest scores were considered antibody-negative (green), and 50 weakly-positive sera were excluded.
Assay sensitivities for detection of human anti-C. pneumoniae IgGa.
| Assay type | Rank# | Antigen | Average sensitivityb, % | ||
|---|---|---|---|---|---|
| CRS2 (154 Pos vs 31 Neg)c | CRS3 (95 Pos vs 31 Neg)d | ||||
| Cpn mixed peptides | Single Mix | 1 | Cpn Mix F12 | 74 | 97 |
| 2 | Cpn Mix K24 | 73 | 91 | ||
| 3 | Cpn Mix J20 | 72 | 90 | ||
| 4 | Cpn Mix M48 | 69 | 88 | ||
| 5 | Cpn Mix G12 | 68 | 88 | ||
| 6 | Cpn Mix A5 | 63 | 85 | ||
| 7 | Cpn Mix D12 | 60 | 80 | ||
| Combinede | — | A5 + D12 (Average OD) | 71 | 93 | |
| Cpn individual peptides | Single peptide | 1 | Cpn_IncA_331–370 | 55 | 74 |
| 2 | Cpn_OmpA_158–173 | 37 | 45 | ||
| 3 | Cpn_Pmp21D_1131–170 | 33 | 39 | ||
| 4 | Cpn_CT618_201–216 | 31 | 38 | ||
| 5 | Cpn_Pmp6G/I_181–196 | 34 | 36 | ||
| 6 | Cpn_OmpA_089–104 | 29 | 33 | ||
| 7 | Cpn_YopC_077–092 | 23 | 28 | ||
| 8 | Cpn_Pmp21D_0147–86 | 21 | 25 | ||
| Combinedf | 1 | Avg OD of 6 Pept (#1–6) | 72 | 85 | |
| 2 | Avg OD of 8 Pept (#1–8) | 70 | 84 | ||
| 3 | Avg OD of 4 Pept (#1–4) | 64 | 80 | ||
| Cpn ELISAs | Medac | 1 | Proprietary | 67 | 84 |
| Serion | 2 | Cpn OMC | 68 | 82 | |
| Savyon | 3 | Cpn EB | 66 | 81 | |
| Euroimmun | 4 | Cpn lysates | 56 | 74 | |
aAssay sensitivities for each test were determined from receiver operating characteristic (ROC) curves. The binomial anti-C. pneumoniae IgG antibody status was used as X categorical variable known a priori, and serum reactivities were used as Y continuous predictor variable (Figs 1, S4).
bThe average assay sensitivity (%) was calculated from the mean of 5 different sensitivities obtained at 98%, 95%, 90%, 85% and 80% specificities.
cComposite reference standard 2 (CRS2) for binomial anti-C. pneumoniae antibody status was derived from the total reactivity score of 29 individual tests (C. pneumoniae-specific 13 peptide mixes, 12 single peptide antigens, and 4 commercially available C. pneumoniae antibody ELISAs; Figs 1, S4). Of all 185 human sera, 154 sera with the highest combined score were considered positive, and 31 sera with the lowest score were considered negative for anti-C. pneumoniae IgG antibodies (Figs 1, S4).
dCRS3 was derived after exclusion of 59 weakly positive sera (borderline sera shown with grey-bar in Figs 1, S4) out of the 185 sera. A total of 95 sera with the highest combined score was considered positive, a total of 31 sera with the lowest score were considered negative (126 sera in total; Figs 1, S4).
eThis new combined test was derived by averaging two OD values of 2 separate tests with Cpn peptide mixes (Cpn Mix A5 and D12; Fig. S2, Table S3).
fCombined tests for single peptide assays are derived by averaging OD values of 4, 6, or 8 separate tests with single Cpn peptides.
Figure 2Distribution of anti-C. pneumoniae and anti-C. trachomatis antibodies in 185 human sera. To evaluate bias in distribution of anti-C. trachomatis antibodies among anti-C. pneumoniae antibody-positive and -negative sera, the 185 blood donor sera were binomially separated by antibody status (Pos or Neg) in Cpn- and Ctr Mix peptide assays and commercial ELISAs. To derive this antibody status (C1-C4), the consensus of 4–6 component assay results for each of the 4 assay categories was used (details in Fig. S5). For this consensus, any serum that was positive in any component assay of a category was considered antibody-positive (black), and antibody-negative if all component assays were negative (white). Column C1 indicates the consensus of 6 mixed peptide anti-C. pneumoniae antibody assays (Fig. S5). C2 shows the consensus antibody status of the four commercial anti-Cpn IgG ELISAs, with manufacturer defined cutoffs. The consensus antibody status of Ctr mixed peptide assays at previously described cutoffs[47] is shown in C3, and in C4 the Ctr commercial ELISAs with manufacturer defined cutoffs. In C5, red or green indicates double positive or double-negative sera, respectively, for anti-C. pneumoniae antibodies in Cpn mixed peptide assays as well as Cpn cELISAs. Single-positive sera in the Cpn mixed peptide assays are shown by pink, and single-positive sera in cELISAs by yellow (C5). The final column (C6) indicates CRS2 status as shown in Figs 1 and S4.
Distribution bias of C. pneumoniae and C. trachomatis seroreactivity in 185 human sera.
| Comparison between assay typesa | Cpn antibody status | Ctr antibody status | Ctr antibody distribution | |||||
|---|---|---|---|---|---|---|---|---|
| Cpn | Ctr | Pos (n) | Neg (n) | Frequencyb (% Ctr Pos) | Δ Frequencyc (Pos-Neg) | Biasd (Δ Freq/Pos) | ||
| Pept Mix | Pept Mix | Pos = 126 | 79 | 47 | 62.7 | −10.2 | −0.16 | 0.187 |
| Neg = 59 | 43 | 16 | 72.9 | |||||
| cELISAs | cELISAs | Pos = 139 | 59 | 80 | 42.4 | +22.9 | +0.54 | 0.005 |
| Neg = 46 | 9 | 37 | 19.6 | |||||
aConsensus antibody status of Cpn and Ctr Pept Mix assays or cELISAs was used (Figs 2, S5).
bDistribution of anti-C. trachomatis antibodies among anti-C. pneumoniae antibody-positive and -negative sera.
cDifference in distribution frequency of anti-C. trachomatis antibodies among anti-C. pneumoniae antibody-positive and -negative sera.
dBias towards Ctr-positivity among Cpn-positive sera (excess Ctr positives in Cpn-positive over Cpn-negative sera).
eSignificance of deviation from random distribution of anti-C. pneumoniae and anti-C. trachomatis antibodies is determined by two-tailed Fisher Exact test.
Figure 3Reactivities of C. pneumoniae and C. trachomatis commercial ELISA antigens with anti-Chlamydia species-specific mouse sera. The anti-human IgG conjugates of the ELISA kits were substituted by an anti-mouse IgG conjugate. Reactivities of C. pneumoniae and C. trachomatis commercial ELISA antigens with homologous antisera that are consistent with expected reactivities are shown by green bars, and cross-reactivities with non-homologous antisera are shown by blue or red bars. Assay backgrounds determined with naïve sera are shown by black bars. Mice were immunized against each of 11 Chlamydia spp.[41,45], and used as individual or pools of individual sera against a single Chlamydia spp. Cab indicates a serum pool raised against C. abortus; Cps, C. psittaci; Cca, C. caviae; Cfe, C. felis; Cav, C. avium; Cga, C. gallinacea; Cpe, C. pecorum; Cpn, C. pneumoniae; Cmu, C. muridarum; Csu, C. suis; and Ctr, C. trachomatis.
Sensitivity of anti-C. pneumoniae IgG detection in comparison to peptide composite reference standard CRS4a.
| Assay type | Rank # | Antigen | Average sensitivityb | AUCc |
|---|---|---|---|---|
| Cpn pooled peptide assays | 1 | Cpn Mix F12 | 93 | 0.976 |
| 2 | Cpn Mix K24 | 91 | 0.943 | |
| 3 | Cpn Mix J20 | 88 | 0.939 | |
| 4 | Cpn Mix M48 | 87 | 0.916 | |
| 5 | Cpn Mix G12 | 86 | 0.943 | |
| Cpn individual peptide assays | 1 | Average OD of Pept #1–8d | 82 | 0.937 |
| 2 | Average OD of Pept #1–6 | 81 | 0.936 | |
| 3 | Average OD of Pept #1–4 | 79 | 0.927 | |
| Cpn ELISAs (commercial) | 1 | Medac (Proprietary antigen) | 56 | 0.832 |
| 2 | Serion (Cpn OMC) | 54 | 0.811 | |
| 3 | Savyon (Cpn EB) | 37 | 0.768 | |
| 4 | Euroimmun (Cpn lysate) | 35 | 0.761 |
aCRS4 was the categorical reference in these ROC curve analyses (Figs 1, S4). CRS4 was derived from the 13 mixed and 12 individual peptide assays (without the 4 Cpn commercial ELISAs). A total of 95 sera with the highest combined score in these 25 peptide assays was considered positive, the 40 sera with the lowest score were considered negative (135 sera in total), and the remaining 50 weakly positive borderline sera were excluded in these analyses.
bThe average assay sensitivity was calculated from the mean of 5 sensitivities obtained for 98%, 95%, 90%, 85% and 80% specificities (Table S8).
cAUC, area under the ROC curve.
dDerived by averaging seven OD values of 8 separate single peptide assays (8 top-ranked Cpn peptides; Table 2).
Demographics of C. pneumoniae and C. trachomatis sero-reactivitya.
| Cohort (n) | Ethnicity (n) | Anti- | Anti- | ||||||
|---|---|---|---|---|---|---|---|---|---|
| Cpn Mix Pept | Cpn cELISAs | Ctr Mix Pept | Ctr cELISAs | ||||||
| Female (n = 95) | African American (n = 39) | 65.8 | 78.9 | 81.6 | 63.2 | ||||
| Caucasian (n = 20) | 60.0 | 90.0 | 70.0 | 15.0 | |||||
| Other (n = 37) | 81.1 | 73.0 | 70.3 | 27.0 | |||||
| Male (n = 90) | African American (n = 39) | 74.4 | 79.5 | 67.7 | 48.7 | ||||
| Caucasian (n = 15) | 46.7 | 40.0 | 33.3 | 13.3 | |||||
| Other (n = 36) | 63.9 | 75.0 | 55.6 | 27.8 | |||||
aThe consensus antibody status for each assay was calculated by considering a serum as antibody-positive if one component assay of a consensus was positive (47; Figs 2, S5).
bBold numbers indicate cohort average.