Literature DB >> 31490924

Epidemiology of capybara-associated Brazilian spotted fever.

Hermes R Luz1,2, Francisco B Costa1,3, Hector R Benatti1, Vanessa N Ramos1,4, Maria Carolina de A Serpa1, Thiago F Martins1, Igor C L Acosta1, Diego G Ramirez1,5, Sebastián Muñoz-Leal1, Alejandro Ramirez-Hernandez1, Lina C Binder1, Marcio Port Carvalho6, Vlamir Rocha7, Thiago C Dias7,8, Camila L Simeoni7, José Brites-Neto9, Jardel Brasil9, Ana Maria Nievas10, Patricia Ferreira Monticelli10, Maria Estela G Moro11, Beatriz Lopes12, Daniel M Aguiar13, Richard C Pacheco13, Celso Eduardo Souza14, Ubiratan Piovezan15,16, Raquel Juliano15, Katia Maria P M B Ferraz12, Matias P J Szabó17, Marcelo B Labruna1.   

Abstract

BACKGROUND: Brazilian spotted fever (BSF), caused by the bacterium Rickettsia rickettsii, has been associated with the transmission by the tick Amblyomma sculptum, and one of its main hosts, the capybara (Hydrochoerus hydrochaeris).
METHODS: During 2015-2019, we captured capybaras and ticks in seven highly anthropic areas of São Paulo state (three endemic and four nonendemic for BSF) and in two natural areas of the Pantanal biome, all with established populations of capybaras.
RESULTS: The BSF-endemic areas were characterized by much higher tick burdens on both capybaras and in the environment, when compared to the BSF-nonendemic areas. Only two tick species (A. sculptum and Amblyomma dubitatum) were found in the anthropic areas; however, with a great predominance of A. sculptum (≈90% of all ticks) in the endemic areas, in contrast to a slight predominance of A. dubitatum (≈60%) in the nonendemic areas. Tick species richness was higher in the natural areas, where six species were found, albeit with a predominance of A. sculptum (≈95% of all ticks) and environmental tick burdens much lower than in the anthropic areas. The BSF-endemic areas were characterized by overgrowth populations of A. sculptum that were sustained chiefly by capybaras, and decreased populations of A. dubitatum. In contrast, the BSF-nonendemic areas with landscape similar to the endemic areas differed by having lower tick burdens and a slight predominance of A. dubitatum over A.sculptum, both sustained chiefly by capybaras. While multiple medium- to large-sized mammals have been incriminated as important hosts for A. sculptum in the natural areas, the capybara was the only important host for this tick in the anthropic areas.
CONCLUSIONS: The uneven distribution of R. rickettsii infection among A. sculptum populations in highly anthropic areas of São Paulo state could be related to the tick population size and its proportion to sympatric A. dubitatum populations.

Entities:  

Mesh:

Year:  2019        PMID: 31490924      PMCID: PMC6750615          DOI: 10.1371/journal.pntd.0007734

Source DB:  PubMed          Journal:  PLoS Negl Trop Dis        ISSN: 1935-2727


Introduction

Brazilian spotted fever (BSF), caused by the bacterium Rickettsia rickettsii, is the deadliest tick-borne disease of the New World. The disease is endemic in many parts of southeastern Brazil, especially in the state of São Paulo, where 978 laboratory-confirmed cases were recorded from 2001 to 2018, of which 489 (50%) had a fatal outcome (official data from the São Paulo State Health Secretary). In North America, where the R. rickettsii-caused disease is known as Rocky Mountain spotted fever (RMSF), multiple strains of R. rickettsii (including less virulent ones) are known to occur. In contrast, a highly virulent strain prevails in Central and South America, which has been linked to the higher fatality rates of BSF, when compared to RMSF [1]. In addition, the greatest fatality of BSF is also evidenced by its neglected status in Brazil, such as the unavailability in the country of parenteral doxycycline, considered the first-choice medication to treat severe BSF or RMSF presenting vomiting or altered mental status [2, 3]. During this century, several studies have elucidated key factors in the epidemiology of BSF in southeastern Brazil, where R. rickettsii is transmitted to humans mainly by the tick Amblyomma sculptum. Besides being a competent vector, A. sculptum larvae, nymphs and adults are partially refractory to R. rickettsii infection, and less than half of the infected females transmit R. rickettsii to their offspring (transovarial transmission) [4-6]. This fact, associated to the higher mortality and lower reproductive performance of infected ticks, when compared to uninfected mates (5, 6), causes infection of A. sculptum by R. rickettsii in BSF-endemic areas to be very low, usually <1% [7-10]. Within this scenario, mathematical models have indicated that an A. sculptum population is not able to sustain a R. rickettsii infection for successive tick generations without the creation of new cohorts of infected ticks via horizontal transmission on vertebrate rickettsemic hosts (amplifying hosts) [11, 12]. In this case, the capybara (Hydrochoerus hydrochaeris), the largest living rodent in the world, has been pointed out as the major amplifying host of R. rickettsii for A. sculptum in most of the BSF-endemic areas of southeastern Brazil [11, 13, 14]. However, it is important to note that the tick Amblyomma dubitatum has also been frequently found infesting capybaras in southeastern Brazil, albeit with no direct role on BSF-epidemiology [7–10, 14, 15]. During the last four decades, the state of São Paulo has undergone extensive anthropogenic modifications in its landscape due to a rapid expansion of agricultural crops (especially sugar cane), deforestation, and creation of artificial water bodies [16, 17]. Such modifications have favored capybara reproduction primarily by higher food availability by agriculture (e.g., sugar cane, corn fields) and because of the local extinction of natural predators (e.g., the jaguar Panthera onca), in human-modified landscapes, leading to an increment on the extension and density of its populations [17-19]. Because capybara is considered to be the main host for A. sculptum in such landscapes [10, 15, 20], and at the same time an efficient R. rickettsii amplifying host [13], the increase of BSF incidence in the state of São Paulo during the last three decades has been associated to the afore mentioned anthropogenic modifications [11, 14, 21]. While the expansion of capybaras and their ticks have been well recognized in the state of São Paulo during the last decades, many of these human-modified landscapes have remained free of R. rickettsii circulation, despite of the established presence of capybaras and A. sculptum [22-24]. Since the reasons determining the establishment of R. rickettsii in a capybara-sustained A. sculptum population are not well understood, the present study aimed to characterize and to quantify in time and space the tick fauna in capybaras and in the habitats where these rodents occur among different human-modified landscapes in the state of São Paulo, either endemic or nonendemic for BSF. Differences in the tick fauna composition could be one of the possible multiple reasons driving the uneven distribution of R. rickettsii among different A. sculptum populations. In order to confirm the endemic or nonendemic status of each area, we determined the serological profile of the capybaras against a battery of rickettsial antigens, including R. rickettsii. For comparison purposes, we performed the same capybara and tick evaluations in pristine areas of the Pantanal biome of Brazil, where capybaras live in natural habitats in which landscape has suffered only minimal anthropogenic alterations and from where BSF has never been reported. Our results might provide some clues for a better understanding on the main epidemiological characteristics of the BSF-endemic areas associated to capybaras.

Methods

Ethical statements

This study has been approved by the Institutional Animal Care and Use Committee (IACUC) of the Faculty of Veterinary Medicine of the University of São Paulo (approval number 5948070314), in accordance with the regulations/guidelines of the Brazilian National Council of Animal Experimentation (CONCEA). Field capture of capybaras and collections of ticks were authorized by the Brazilian Ministry of the Environment (permit SISBIO Nos. 43259–6) and by the São Paulo Forestry Institute (Cotec permit 260108–000.409/2015).

Study areas

All study areas were inhabited by capybaras, and were classified into the following three epidemiological categories: (i) BSF-endemic areas–highly anthropic areas (human-modified landscape) in the state of São Paulo, where human cases of BSF have been recently confirmed and the transmissions have been epidemiologically associated with A. sculptum. Three BSF-endemic areas were sampled: Area 1 in the municipality of Piracicaba, Area 2 in the municipality of Americana, Area 3 in the municipality of Araras, all located in transition areas of the biomes Savannah and Atlantic Forest; (ii) BSF-nonendemic areas–highly anthropic areas (human-modified landscape) in the state of São Paulo, however, with no history of BSF. Four BSF-nonendemic areas were sampled: Areas 4 and 5 in the municipality of Pirassununga, located in a transition area of the biomes Savannah and Atlantic Forest, Area 6 in the municipality of Ribeirão Preto, located in the Savannah biome, and Area 7 in São Paulo municipality, in the Atlantic Forest biome; and (iii) natural areas–low anthropic areas (natural landscape) in the Pantanal biome, with no history of BSF. Two natural areas were sampled: Area 8 in Poconé municipality, state of Mato Grosso, and Area 9 in Corumbá municipality, state of Mato Grosso do Sul. We sampled capybaras and ticks in 3 BSF-endemic areas, 4 BSF-nonendemic areas, and 2 natural areas (S1 Table, Fig 1 and S1 Text).
Fig 1

Areas where capybaras and ticks were sampled in the state of São Paulo (SP) (highly anthropic, low diversity areas), and in the states of Mato Grosso (MT) and Mato Grosso do Sul (MS) (low anthropic, high diversity areas).

Map source was obtained from the “Instituto Brasileiro de Geografia e Estatística”(IBGE) website (www.ibge.gov.br) and the final figure was constructed with the use of CorelDraw Graphics Suite 2017.

Areas where capybaras and ticks were sampled in the state of São Paulo (SP) (highly anthropic, low diversity areas), and in the states of Mato Grosso (MT) and Mato Grosso do Sul (MS) (low anthropic, high diversity areas).

Map source was obtained from the “Instituto Brasileiro de Geografia e Estatística”(IBGE) website (www.ibge.gov.br) and the final figure was constructed with the use of CorelDraw Graphics Suite 2017.

Capybara sampling

During 2015–2018, we performed capture of capybaras in all study areas by using 16 to 20 m2–corrals baited with sugar cane and green corn. Once closed in the corral, every animal was physically restrained by a net catcher and anaesthetized with an intramuscular injection of a combination of ketamine (10 mg/kg) and xylazine (0.2 mg/kg). Under anesthesia, animals were weighed in an electronic balance (Pesola model PCS0300, Hatton Rock, UK) and identified with a subcutaneous microchip (Alflex model P/N 860005–001, Capalaba, Australia). In Mato Grosso do Sul, corrals were not effective, thus capybaras were captured by anesthetic darting via a CO2-injection rifle (Dan-Inject model JM Standard, Denmark) by injecting the same chemicals above. Capybaras were sexed and aged as follows: young (<10 Kg), juvenile (10–35 Kg), and adult (>35 Kg), following Vargas et al. [25]. From each capybara, we collected blood samples through the femoral artery or cranial vena cava, and the serum was separated by centrifugation and stored frozen at -20°C until serological analysis (described below). Because many capybaras were heavily infested by ticks, we standardized a 3-min random collection of ticks from the entire body of every capybara. During the 3-min period, any tick on sight was collected, regardless of the size or part of capybara body. These ticks were brought to the laboratory, where they were identified to species following current literature [20, 26, 27]. After recovering from anesthesia, capybaras were released at the same capture site.

Serological analysis

Capybara sera were tested by immunofluorescence assay (IFA) as described elsewhere [22] using rickettsial crude antigens derived from Vero cells (provided by the Instituto Adolfo Lutz, São Paulo, Brazil) infected with each of the following five Rickettsia species known to infect ticks in Brazil: R. rickettsii strain Taiaçu [28], Rickettsia parkeri strain At24 [29], Rickettsia amblyommatis strain Ac37 [30], Rickettsia rhipicephali strain HJ5 [31], and Rickettsia bellii strain Mogi [28]. In addition, a sixth rickettsial antigen consisted of C6/36 cells (provided by the Instituto Adolfo Lutz, São Paulo, Brazil) infected with Rickettsia felis strain Pedreira, was also implemented [32]. In each slide, a serum previously shown to be non-reactive (negative control) and a known reactive serum (positive control) from a previous study [13] were included. Slides were incubated with fluorescein isothiocyanate-labeled sheep anti-capybara IgG (produced by the Centro de Controle de Zoonoses, São Paulo City). For each sample, the endpoint titer reacting with each of the six Rickettsia antigens was determined. Sera showing an antibody titer to a Rickettsia species at least fourfold higher than the titers observed for the other Rickettsia species were supposed to be homologous to the first Rickettsia species or to a very closely related genotype, as previously determined for several animal species [33-35], including capybaras [22].

Collection of host-questing ticks

Host questing ticks were collected in each of the nine study areas (Fig 1, S1 Table) during four consecutive years. Our schedule for collection of free-living ticks was based on the seasonal dynamics of A. sculptum, which is known to complete one generation per year, with larvae peaking during autumn, nymphs during spring, and adults during summer [36-38]. Therefore, between May 2015 and January 2019, ticks were collected in each area during the larval peak (May-June), nymphal peak (August-September) and adult peak (January-February) of every year. In each area at each time point, a 1 m2 white flannel was dragged over 800 m of animal trails. With this procedure, every dragging event on a given area represented the number of ticks for an 800 m2-sampled area. Collected nymphs and adults were immediately put in plastic vials containing 70% ethanol, except for a few adult ticks that were placed in dry plastic vials and taken alive to the laboratory, where they were kept frozen at -80°C until molecular analysis for Rickettsia (described below). Every time a larval cluster was captured by dragging, the cluster was immediately picked up with a 5 cm-large transparent plastic adhesive tape, which was then stuck on a white paper that was put within a sealed plastic bag and taken to the laboratory. Adult and nymphal ticks were counted individually and identified to species according to [20, 26, 27]. Larvae were counted as number of clusters, since it was assumed that each larval cluster represented the offspring of one engorged female [38, 39]. Larval taxonomic identification consisted of comparing side-by-side individuals of a larval cluster with laboratory-reared larvae of A. sculptum and A. dubitatum, following established criteria [40, 41]. Host-questing ticks were also collected by dry ice traps following Szabó et al. [39]; however, this method was used only at one time point (August 2015) in each area, and had to be discontinued due to logistic difficulties. In each area, 20 to 40 dry ice traps were set at 10 m intervals along the same trails that were sampled by dragging. Collected ticks were immediately placed in 70% ethanol, and taken to the laboratory for taxonomic identification as described above.

Rickettsial detection in ticks

Frozen unfed adult ticks, previously collected by dragging in each area, were thawed and individually submitted to DNA extraction by the guanidine isothiocyanate-phenol technique [42]. Extracted DNA samples were firstly tested by a conventional PCR protocol targeting the tick mitochondrial 16S rRNA gene, as previously described [43], in order to certify successful DNA extraction. Then, viable DNA samples (those positive by the tick 16S rRNA PCR assay) were tested by a Taqman real-time PCR assay targeting the rickettsial gltA gene, as described [5]. The sensitivity of this PCR assay was determined to be 1 DNA copy of R. rickettsii [44]. Positive samples by this Taqman real-time PCR were tested by two protocols of conventional PCR, one targeting a 401-bp fragment of the rickettsial gltA gene [44], and one heminested PCR assay targeting the ompA gene; this latter protocol consisted of a first reaction targeting a 631-bp fragment, and a second targeting a 532-bp fragment, as described [45]. PCR products were DNA-sequenced and the resultant sequences were submitted to BLASTn analyses (www.ncbi.nlm.nih.gov/blast) in order to confirm the identity of the Rickettsia species.

Data analyses

The proportions of seroreactive capybaras for R. rickettsii were compared between the nine sampled areas by the Chi-square test. Endpoint titers for the six Rickettsia species were compared between BSF-endemic and BSF-nonendemic areas by the Mann-Whitney test. For the ticks collected on capybaras, we calculated the prevalence (No. infested hosts / No. examined capybaras x 100), and the mean abundance of tick infestation (total number of collected ticks / number of examined capybaras) according to [46] in each of the 9 study areas. Density of host-questing ticks was calculated for the total dragged area (TDA). For this purpose, TDA = number of dragging events performed in one area during the four years of study x 800m2 (considering that each dragging event encompassed an 800m2 area in each of the study areas). Then, the tick density (TD), represented by number of host-questing ticks per 1,000 m2, was calculated by: TD = total number of collected ticks / TDA x 1,000 m2. These calculations were applied to the two most abundant tick species, A. sculptum and A. dubitatum. TD was calculated separately for larvae, nymphs, and adult ticks for the whole study period, as well as for the period of larval peak (all collections during autumn), nymphal peak (all collections during winter), and adult peak (all collections during summer). For statistical analyses, we pooled the tick data for each of the three epidemiological categories: (i) BSF-endemic areas, (ii) BSF-nonendemic areas, and (iii) natural areas. The Chi-square test was used to compare the differences between the proportions of ticks on capybaras or host-questing ticks between the three epidemiological categories (BSF-endemic, BSF-nonendemic, natural areas). The Lilliefors test implemented in the PAST 3.19 program was used to analyze the normality of the data in order to choose the appropriate statistical test for each situation. Values of mean abundance of tick infestation were analyzed using the Kruskal-Wallis non-parametric test. For all tests, the level of significance was 5%. Analyses were performed by using PAST Version 3.19 and BioEstat 5.0.

Results

Captured capybaras

A total of 347 capybaras were captured during the 2015–2018 period. The number of captured capybaras per each of the nine areas varied from 14 to 73 (mean: 38.6). Since we sampled during four consecutive years, some individuals were captured twice among different years; recaptured capybaras represented 0 to 50% of the total number of captures in each area (Table 1). Removing recaptured animals, the total number of different individuals sampled in this study was 287; however, we considered all recaptures as different units for our analyses of serology and tick infestations (described below), since recaptures occurred in years different from the first capture. The 347 captured capybaras were represented by 94 (27%) males and 253 (73%) females. They were aged as 27 (7.8%) young, 70 (20.2%) juvenile, and 250 (72%) adults (Table 1).
Table 1

Capybaras captured in nine areas during 2015–2018.

AreasCaptured capybarasGenderAge
Total No. capturesNo. different individualsNo. recaptures (%)MalesFemalesYoungJuvenileAdult
BSF-endemic areas
1-Piracicaba654817 (26)95631052
2-Americana23203 (13)12110716
3-Araras41365 (12)7348726
BSF-nonendemic areas
4-Pirassununga-A26224 (15)10161421
5-Pirassununga-B73685 (7)19548956
6-Ribeirão Preto483711 (23)163242420
7-São Paulo14140 (0)4102111
Natural areas
8-Poconé261313 (50)9170620
9-Corumbá31292 (6)8231228
TOTAL34728760 (17)94 (27%)253 (73%)27 (7.8%)70 (20.2%)250 (72.0%)

Serology of capybaras

Among the 347 captured capybaras, sera were collected from 337, which were tested by IFA against six Rickettsia species (Table 2). Considering the three epidemiological categories, the proportions of seropositive capybaras for R. rickettsii in the 3 BSF-endemic areas (88 to 98%) were significantly higher (P<0.05) than the proportions in the 4 BSF-nonendemic areas (14 to 38%) and in the natural area of Corumbá (47%); the proportions for R. rickettsii in the later 5 areas were statistically similar (P>0.05). While the proportion of seropositive capybaras in the natural area of Poconé (100%) was similar (P>0.05) to the BSF-endemic areas, the endpoint titers to R. rickettsii were quite different, with much higher values for the BSF-endemic areas (S2 Table). In fact, 56 capybaras of the 3 BSF-endemic areas had endpoint titers for R. rickettsii at least fourfold higher than the titers for the remaining five Rickettsia species, indicating that these capybaras were likely infected by R. rickettsii (Table 2). Using these same criteria, no capybara from either BSF-nonendemic or natural areas were considered to have been infected by R. rickettsii, whereas 12, 36, and 11 capybaras from BSF-endemic, BSF-nonendemic, and natural areas, respectively, were probably infected by R. bellii; and two, one and nine capybaras from BSF-endemic, BSF-nonendemic, and natural areas, respectively, were probably infected by R. amblyommatis. In addition, five capybaras from the natural area of Poconé were likely infected by R. parkeri (Table 2). While the endpoint titers of the capybaras from the BSF-endemic areas were significantly higher for R. rickettsii than for the remaining five Rickettsia species, in the BSF-nonendemic areas the endpoint titers were significantly higher for R. bellii (Fig 2).
Table 2

Results of immunofluorescence assay for six Rickettsia species in capybaras from 9 localities, being 3 Brazilian spotted fever (BSF)-endemic areas, 4 BSF-nonendemic areas, and 2 natural areas.

AreasNo. capybaras testedNo. seroreactive capybaras to each of the Rickettsia species(% seroreactivity for the area)No. capybaras with determined homologous reaction(PAIHR in parentheses) a
Rickettsia rickettsii bRickettsia parkeriRickettsia amblyommatisRickettsia rhipicephaliRickettsia belliiRickettsia felis
BSF-endemic areas
1-Piracicaba6463 (98) a62 (97)56 (87)55 (86)54 (84)27 (42)35 (R. rickettsii),4 (R. bellii), 2 (R. amblyommatis)
2-Americana2322 (97) a21 (91)15 (65)14 (61)20 (87)11 (48)8 (R. rickettsii), 1 (R. bellii)
3-Araras3329 (88) a25 (76)18 (55)19 (58)24 (73)9 (27)13 (R. rickettsii), 7 (R. bellii)
BSF-nonendemic areas
4-Pirassununga-A2610 (38) b8 (31)9 (35)10 (38)14 (54)6 (23)9 (R. bellii)
5-Pirassununga-B7326 (36) b14 (19)11 (15)13 (18)32 (44)10 (14)11 (R. bellii)
6-Ribeirão Preto4814 (29) b9 (19)13 (27)9 (19)25 (52)4 (8)10 (R. bellii), 1 (R. amblyommatis)
7-São Paulo142 (14) b1 (7)2 (14)4 (26)7 (50)0 (0)6 (R. bellii)
Natural areas
8-Poconé2626 (100) a26 (100)24 (92)23 (88)25 (96)20 (77)7 (R. amblyommatis), 5 (R. parkeri), 1 (R. bellii)
9-Corumbá3014 (47) b11 (37)11 (37)7 (23)17 (57)0 (0)10 (R. bellii), 2 (R. amblyommatis)

homologous reaction was determined when an endpoint titer to a Rickettsia species was at least 4-fold higher than those observed for the other Rickettsia species. In this case, the Rickettsia species involved in the highest endpoint titer was considered the possible antigen involved in a homologous reaction (PAIHR).

different letters in this column mean significantly different (P<0.05) proportions of seroreactive cabybaras for R. rickettsii.

Fig 2

Boxplot representing the serological endpoint titers for six Rickettsia species of capybaras from Brazilian spotted fever (BSF)-endemic areas and BSF-nonendemic areas.

Different lower case letters mean statistically different (P<0.05) endpoint titers between Rickettsia species in endemic or nonendemic areas.

Boxplot representing the serological endpoint titers for six Rickettsia species of capybaras from Brazilian spotted fever (BSF)-endemic areas and BSF-nonendemic areas.

Different lower case letters mean statistically different (P<0.05) endpoint titers between Rickettsia species in endemic or nonendemic areas. homologous reaction was determined when an endpoint titer to a Rickettsia species was at least 4-fold higher than those observed for the other Rickettsia species. In this case, the Rickettsia species involved in the highest endpoint titer was considered the possible antigen involved in a homologous reaction (PAIHR). different letters in this column mean significantly different (P<0.05) proportions of seroreactive cabybaras for R. rickettsii.

Ticks on capybaras

Capybaras in the seven anthropic areas of the state of São Paulo (BSF-endemic and BSF-nonendemic areas) were infested by two tick species, A. sculptum and A. dubitatum. Among the two natural areas in the Pantanal biome, A. sculptum was the only species infesting capybaras in the Corumbá area, while A. sculptum, A. dubitatum and Amblyomma triste were found on capybaras in the Poconé area. Tick prevalence on capybaras was 100% in all seven anthropic areas, and 95% in natural areas, where only three capybaras did not have any tick. For data comparison, we excluded the 27 young capybaras (Table 1) because they were usually infested by low number of ticks (mean abundance: 15.3 ticks/capybara), when compared to the overall mean abundance of 31.8 ticks/capybara among adults and juveniles. The overall mean abundance of ticks was significantly higher (P<0.05) in the BSF-endemic areas (40.9 ticks/capybara) than in the BSF-nonendemic areas (33.7 ticks/capybara), which was also significantly higher (P<0.05) than the mean abundance in the natural areas (7.7 ticks/capybara) (Table 3 and Fig 3). Amblyomma sculptum was the dominant tick species in the BSF-endemic areas, where they represented 85% (4,091/4,821) of all ticks collected from capybaras (Table 3) and had the highest mean abundance values (Fig 4). In contrast, A. dubitatum was the dominant species in the BSF-nonendemic areas, where they encompassed 69% (3390/4914) of all ticks collected on capybaras (Table 3) and had the highest mean abundance values (Fig 4). Mean abundance values of either A. sculptum or A. dubitatum were significantly different (P<0.05) between BSF-endemic and BSF-nonendemic areas (Fig 5). In the natural areas, A. sculptum was the dominant tick species (88%; 380/429); however, with a mean abundance of only 6.8 A. sculptum ticks/capybara, contrasting to the mean abundance of 34.7 and 10.2 A. sculptum ticks/capybara in the BSF-endemic and BSF-nonendemic areas, respectively.
Table 3

Ticks collected on capybaras in 9 localities, being 3 Brazilian spotted fever (BSF)-endemic areas, 4 BSF-nonendemic areas, and 2 natural areas during 2015–2018.

AreasNPMAaNo. ticks according to species and stage
Amblyomma sculptumAmblyomma dubitatumAmblyomma tristeAmblyomma sp.Total
nymphsfemalesmalesnymphsfemalesmalesfemalesmaleslarvae
BSF-endemic areas
1-Piracicaba6210039.79876654911917632172,459
2-Americana2310044.1325216250137602611,015
3-Araras3310040.870526518711458181,347
Total11810040.9 a2,0171,14692844219476184,821
BSF-nonendemic areas
4-Pirassununga-A2510033.775147106382704319842
5-Pirassununga-B6510030.11971451877203693381,956
6-Ribeirão Preto4410037.64101108567123913541,654
7-São Paulo1210038.53153198103122462
Total14610033.7 b7134073811,971781638234,914
Natural areas
8-Poconé269210.953721093171829283
9-Corumbá30974.9882830146
Total56957.7 c1411001393171829429
Total (9 areas)3209931.82,8711,6531,4482,416992732294110,164

N: Number of examined capybaras; P: prevalence = No. infested capybaras / No. examined capybaras x 100; MA: mean abundance of tick infestation = total No. collected ticks / No. examined capybaras.

different letters in this column mean significantly different (P<0.05) MA values between the three epidemiological categories.

Fig 3

Boxplot representing the mean abundance of total tick infestations of capybaras from Brazilian spotted fever (BSF)-endemic areas, BSF-nonendemic areas, and natural areas.

Fig 4

Dotplot representing the number of Amblyomma sculptum and Amblyomma dubitatum ticks per capybara among 3 Brazilian spotted fever (BSF)-endemic areas, and 4 BSF-nonendemic areas.

Fig 5

Boxplot representing the mean abundance of Amblyomma sculptum and Amblyomma dubitatum infestations of capybaras from Brazilian spotted fever (BSF)-endemic areas and BSF-nonendemic areas.

Different lower case letters mean statistically different (P<0.05) mean abundance values of either A. sculptum or A. dubitatum between endemic and nonendemic areas.

Boxplot representing the mean abundance of Amblyomma sculptum and Amblyomma dubitatum infestations of capybaras from Brazilian spotted fever (BSF)-endemic areas and BSF-nonendemic areas.

Different lower case letters mean statistically different (P<0.05) mean abundance values of either A. sculptum or A. dubitatum between endemic and nonendemic areas. N: Number of examined capybaras; P: prevalence = No. infested capybaras / No. examined capybaras x 100; MA: mean abundance of tick infestation = total No. collected ticks / No. examined capybaras. different letters in this column mean significantly different (P<0.05) MA values between the three epidemiological categories.

Host-questing ticks

Host questing ticks were collected along four consecutive years, during the activity peaks of larvae (autumn), nymphs (winter) and adults (summer) of A. sculptum in each year. In the anthropic area of São Paulo (area no. 7), dragging was performed only at two instances during the first year (2015); thereafter, this area had to be discontinued from the study due to a highly fatal outbreak of fascioliasis that decimated the capybara population of the area [47], what certainly impacted the environmental tick burdens in the subsequent years. In the remaining six anthropic areas of the state of São Paulo (areas no 1 to 6), dragging was not possible only during the adult tick season of the 2016 summer, due to personal problems beyond our control. In the two natural areas (Poconé and Corumbá), dragging was not possible at two occasions in each area due to logistic problems related to road conditions and access to both areas. Overall, dragging was performed at 11 occasions in each of the three BSF-endemic areas, at 11 occasions in two BSF-nonendemic areas (Pirassununga A and Pirassununga B), at 20 occasions in the BSF-nonendemic area of Ribeirão Preto, at 19 occasions in the natural area of Poconé, and at 16 occasions in the natural area of Corumbá. A total of 21,670 ticks were collected by dragging in all areas during the study. In the anthropic areas, only two tick species were identified, A. sculptum and A. dubitatum. In the natural areas, the following six tick species were collected: A. sculptum, A. dubitatum, Amblyomma parvum, A. triste, Ambyomma ovale, and Ornithodoros rostratus (Table 4). In the BSF-endemic areas, the proportions of A. sculptum and A. dubitatum were 92% (10,425/11,305) and 8% (880/11,305), respectively. In contrast, the proportions of A. sculptum and A. dubitatum in the BSF-nonendemic areas were 43% (3,688/8,633) and 57% (4,945/8,633), respectively. These proportions were significantly different (P<0.05) between the two epidemiological categories. In the natural areas, A. sculptum represented 98% (1,694/1,732) of all collected ticks, a proportion significantly different (P<0.05) from the two categories of anthropic areas.
Table 4

Host-questing ticks collected by dragging during 2015–2019 in 9 localities, being 3 Brazilian spotted fever (BSF)-endemic areas, 4 BSF-nonendemic areas, and 2 natural areas.

AreasNo. ticks according to species and stageTotal
Amblyomma sculptumAmblyomma dubitatumAmblyomma parvumAmblyomma tristeAmblyomma ovaleOrnithodoros rostratus
Larval clustersnymphsadultsLarval clustersnymphsadultsnymphsadultsadultsadultsnymphs
BSF-endemic areas
1-Piracicaba1311,64688710196492,919
2-Americana1192,7811,46411288274,690
3-Araras1172,5767049261293,696
Total3677,0033,0553074510511,305
BSF-nonendemic areas
4-Pirassununga-A48461132612762211,199
5-Pirassununga-B561,143118811,4641513,013
6-Ribeirão Preto1591,2183421612,1433514,374
7-São Paulo56152147
Total2632,8275983033,8987448,633
Natural areas
8-Poconé486181392122821
9-Corumbá6567215215214911
Total1131,290291215212341,732
Total (9 areas)74311,1203,9443334,645849152123421,670
Tick density (TD) values, represented by the number of host-questing ticks per 1,000 m2, were calculated for the two most abundant tick species, A. sculptum and A. dubitatum, in all areas. Grouping all dragging occasions during the four years, TD of A. sculptum larvae, nymphs and adults were higher in BSF-endemic areas than in BSF-nonendemic and natural areas, with some significant (P<0.05) differences (Table 5 and Fig 6). Comparisons of TD values of A. sculptum with those of A. dubitatum revealed significantly higher values (P<0.05) for larvae, nymphs and adults of the former species in the BSF-endemic areas. On the other hand, A. sculptum and A. dubitatum had similar (P>0.05) larval, nymphal and adult TD among the BSF-nonendemic areas (S2 Table). Because only two A. dubitatum nymphs were collected by dragging in the natural areas (Table 4), TD values were not statistically compared with A. sculptum in these areas.
Table 5

Density of host-questing ticks in 9 localities [3 Brazilian spotted fever (BSF)-endemic areas, 4 BSF-nonendemic areas, and 2 natural areas] during 2015–2019.

In each area, dragging was performed up to three times a year, each at autumn, winter and summer seasons.

AreasTotal area dragged (m2)Tick density (per 1,000 m2) a
Amblyomma sculptumAmblyomma dubitatum
AdultsnymphsLarvaeAdultsNymphsLarvae
BSF-endemic areas
1-Piracicaba8,800100.8187.114.95.622.31.1
2-Americana8,800166.4316.013.53.132.71.3
3-Araras8,80080.0292.713.33.329.71.0
Total26,400115.7 A,a265.3 A,a13.9 A,a4.0 A,b28.2 A,b1.1 A,b
BSF-nonendemic areas
4-Pirassununga-A8,80015.052.45.525.131.46.9
5-Pirassununga-B8,80013.4129.96.417.2166.49.2
6-Ribeirão Preto16,00021.476.19.921.9133.910.1
7-São Paulo1,6003.83.10.013.19.40.0
Total35,20017.0 B,a80.3 A,a7.5 A,a21.1 B,a110.4 B,a8.6 B,a
Natural areas
8-Poconé15,2009.140.73.200.10
9-Corumbá12,80011.952.55.1
Total28,00010.4 B46.1 A4.0 B00.10

different capital letters in each column mean significantly different (P<0.05) tick density values between the three epidemiological categories (BSF-endemic areas, BSF-nonendemic areas, Natural area); different lowercase letters in each line mean significantly different (P<0.05) tick density values of adults or nymphs or larvae between A. sculptum and A. dubitatum.

Fig 6

Density of host-questing larvae, nymphs and adult ticks (Amblyomma sculptum and Amblyomma dubitatum) collected during all seasons of the study period (total) or during the larval (autumn), nymphal (winter) or adult (summer) seasons during 2015–2019 in Brazilian spotted fever (BSF)-endemic areas, BSF-nonendemic areas, and natural areas.

Density of host-questing ticks in 9 localities [3 Brazilian spotted fever (BSF)-endemic areas, 4 BSF-nonendemic areas, and 2 natural areas] during 2015–2019.

In each area, dragging was performed up to three times a year, each at autumn, winter and summer seasons. different capital letters in each column mean significantly different (P<0.05) tick density values between the three epidemiological categories (BSF-endemic areas, BSF-nonendemic areas, Natural area); different lowercase letters in each line mean significantly different (P<0.05) tick density values of adults or nymphs or larvae between A. sculptum and A. dubitatum. Grouping the dragging occasions that were performed during only the autumn season (larval peak) of the four years, larval TD of A. sculptum in the BSF-endemic areas (31.8 larval clusters/1,000 m2) was ≈2 times higher (P<0.05) than in the BSF-nonendemic areas (15.1 larval clusters/1,000 m2), and ≈3 times higher (P<0.05) than in the natural areas (9.1 larval clusters/1,000 m2). On the other hand, larval TD of A. dubitatum in the BSF-endemic areas (2.7 larval clusters/1,000 m2) was about ≈4 times lower (P<0.05) than in the BSF-nonendemic areas (13.8 larval clusters/1,000 m2) (Table 6 and Fig 6).
Table 6

Density of host-questing ticks in 9 localities [3 Brazilian spotted fever (BSF)-endemic areas, 4 BSF-nonendemic areas, and 2 natural areas] for ticks collected only during autumn (May or June) of the years 2015–2018.

AreasTotal area dragged (m2)Tick density per 1,000 m2
Amblyomma sculptumAmblyomma dubitatum
AdultsnymphsLarvaeAdultsNymphsLarvae
BSF-endemic areas
1-Piracicaba3,20010.95.935.90.34.12.8
2-Americana3,200015.629.701.33.1
3-Araras3,2000.35.629.700.62.2
Total9,6003.89.131.8 A,a0.12.02.7 A,b
BSF-nonendemic areas
4-Pirassununga-A3,20003.110.94.76.312.2
5-Pirassununga-B3,20005.611.9018.815.9
6-Ribeirão Preto4,8001.33.122.51.315.815.6
7-São Paulo8005.03.8011.313.80
Total12,0000.83.815.1 B,a2.513.913.8 B,a
Natural areas
8-Poconé4,0001.32.83.0000
9-Corumbá1,60011.917.524.4
Total5,6004.37.09.1 C000

different capital letters in each column mean significantly different (P<0.05) tick density values of larvae between the three epidemiological categories (BSF-endemic areas, BSF-nonendemic areas, Natural area); different lowercase letters in each line mean significantly different (P<0.05) tick density values of larvae between A. sculptum and A. dubitatum.

different capital letters in each column mean significantly different (P<0.05) tick density values of larvae between the three epidemiological categories (BSF-endemic areas, BSF-nonendemic areas, Natural area); different lowercase letters in each line mean significantly different (P<0.05) tick density values of larvae between A. sculptum and A. dubitatum. During the winter season (nymphal peak) of the four years, nymphal TD of A. sculptum in the BSF-endemic areas (703.9 nymphs/1,000 m2) was ≈3.5 times higher (P<0.05) than in the BSF-nonendemic areas (199.6 nymphs/1,000 m2), and ≈9 times higher (P<0.05) than in the natural areas (86.7 nymphs/1,000 m2). On the other hand, nymphal TD of A. dubitatum in the BSF-endemic areas (72.1 nymphs/1,000 m2) was about ≈3.5 times lower (P<0.05) than in the BSF-nonendemic areas (262.3 nymphs/1,000 m2) (Table 7 and Fig 6).
Table 7

Density of host-questing ticks in 9 localities [3 Brazilian spotted fever (BSF)-endemic areas, 4 BSF-nonendemic areas, and 2 natural areas] for ticks collected only during winter (August or September) of the years 2015–2018.

AreasTotal area dragged (m2)Tick density per 1,000 m2
Amblyomma sculptumAmblyomma dubitatum
AdultsNymphsLarvaeAdultsNymphsLarvae
BSF-endemic areas
1-Piracicaba3,20085.3480.94.45.052.50.3
2-Americana3,200130.3847.27.20.382.80.3
3-Araras3,20026.3783.46.60.080.90.6
Total9,60080.6703.9 A,a6.01.872.1 A,b0.4
BSF-nonendemic areas
4-Pirassununga-A3,2003.8137.24.124.157.23.8
5-Pirassununga-B3,20011.9338.85.616.3422.55.0
6-Ribeirão Preto6,4005.3185.85.613.1316.912.5
7-São Paulo8002.52.50.015.05.00.0
Total13,6006.3199.6 B,a4.916.5262.3 B,a7.9
Natural areas
8-Poconé6,4005.886.45.600.30
9-Corumbá6,4003.087.01.4
Total12,8004.486.7 C3.500.30

different capital letters in each column mean significantly different (P<0.05) tick density values of nymphs between the three epidemiological categories (BSF-endemic areas, BSF-nonendemic areas, Natural area); different lowercase letters in each line mean significantly different (P<0.05) tick density values of nymphs between A. sculptum and A. dubitatum.

different capital letters in each column mean significantly different (P<0.05) tick density values of nymphs between the three epidemiological categories (BSF-endemic areas, BSF-nonendemic areas, Natural area); different lowercase letters in each line mean significantly different (P<0.05) tick density values of nymphs between A. sculptum and A. dubitatum. During the summer season (adult peak) of the four years, adult TD of A. sculptum in the BSF-endemic areas (311.8 adults/1,000 m2) was ≈6 times higher (P<0.05) than in the BSF-nonendemic areas (52.3 adults/1,000 m2), and ≈14 times higher (P<0.05) than in the natural areas (22 adults/1,000 m2). On the other hand, adult TD of A. dubitatum in the BSF-endemic areas (12.1 adults/1,000 m2) was about ≈4 times lower (P<0.05) than in the BSF-nonendemic areas (50.9 adults/1,000 m2) (Table 8 and Fig 6).
Table 8

Density of host-questing ticks in 9 localities [3 Brazilian spotted fever (BSF)-endemic areas, 4 BSF-nonendemic areas, and 2 natural areas] for ticks collected only during summer (January or February) of the years 2015–2019.

AreasTotal area dragged (m2)Tick density per 1,000 m2
Amblyomma sculptumAmblyomma dubitatum
AdultsNymphsLarvaeAdultsNymphsLarvae
BSF-endemic areas
1-Piracicaba2,400241.336.70.813.36.30
2-Americana2,400436.38.30.410.87.94.6
3-Araras2,400257.921.30.412.10.00
Total7,200311.8 A,a22.10.612.1A,b4.71.5
BSF-nonendemic areas
4-Pirassununga-A2,40050.05.0053.830.44.2
5-Pirassununga-B2,40033.317.1041.321.75.8
6-Ribeirão Preto4,80062.92.93.154.48.11.3
7-São PauloNot done
Total9,60052.3 B,a7.01.650.9 B,a17.13.1
Natural areas
8-Poconé4,80020.211.30000
9-Corumbá4,80023.818.13.5
Total9,60022.0 C14.71.8000

different capital letters in each column mean significantly different (P<0.05) tick density values of adults between the three epidemiological categories (BSF-endemic areas, BSF-nonendemic areas, Natural area); different lowercase letters in each line mean significantly different (P<0.05) tick density values of adults between A. sculptum and A. dubitatum.

different capital letters in each column mean significantly different (P<0.05) tick density values of adults between the three epidemiological categories (BSF-endemic areas, BSF-nonendemic areas, Natural area); different lowercase letters in each line mean significantly different (P<0.05) tick density values of adults between A. sculptum and A. dubitatum. During autumn, winter and summer, TD values of larvae, nymphs and adults, respectively, were always higher (P<0.05) for A sculptum than for A. dubitatum in the BSF-endemic areas, but at the same time similar (P>0.05) between the two tick species in the BSF-nonendemic areas (Tables 6–8). A total of 8,790 ticks were collected by 220 dry ice traps during August 2015 in all areas of the study (S3 Table). In the BSF-endemic areas, the mean number of A. sculptum ticks per trap was 35.4, ≈3.5 times higher than the mean number of A. dubitatum ticks per trap (9.4). In the BSF-nonendemic areas, the mean numbers of A. sculptum and A. dubitatum per trap were similar, 25.2 and 23.8, respectively. In the natural areas, we collected on average 6.3 A. sculptum/trap and 0.3 A. dubitatum/trap, in addition to two other species, A. parvum (0.1 ticks/trap) and O. rostratus (0.2 ticks/trap). A total of 216 host-questing adults of A. sculptum [24 from each of 8 sampled areas (ticks from the BSF-nonendemic area of São Paulo were not included)] were tested individually for the presence of rickettsial DNA, but none of them contained rickettsia. On the other hand, rickettsial DNA was successfully amplified in 4 (29%) out of 14 A. parvum ticks from Corumbá, and in 2 (17%) out of 12 A. triste from Poconé. The rickettsial DNA amplified from all four A. parvum ticks was identified as ‘Candidatus Rickettsia andeanae’; i.e., their gltA and ompA partial sequences were 100% identical to the corresponding sequences of this agent in GenBank (KF030931 and KF030932, respectively). The gltA and ompA partial sequences generated from the two A. triste ticks were 100% identical to the corresponding sequences of R. parkeri strain Portsmouth (CP003341). Tick mitochondrial 16S rRNA gene-DNA was successfully amplified from all Rickettsia-negative samples, validating our PCR-negative results.

Discussion

A four-year field evaluation demonstrated marked differences of capybara and environmental tick burdens between the three epidemiological classifications of the sampled areas, namely BSF-endemic, BSF-nonendemic, and natural areas. Among the nine sampled areas, only three were classified as BSF-endemic, based primarily on recent records of human cases of the disease (S1 Table). In order to certify on the presence/absence of R. rickettsii circulation between capybaras and ticks in all nine study areas, we performed serological analyses of capybaras against antigens of the most frequent Rickettsia species that have been reported in Brazil. While cross-reactive antibodies between Rickettsia species are often observed, testing a vertebrate serum against the possible Rickettsia species known to occur in a given area is ideal because often homologous antibody titers are higher than heterologous antibody titers. In some cases, the differences in titers may be great enough (≥ fourfold higher) to differentiate among the rickettsial species potentially stimulating the immune response [33, 48]. Based on these criteria, the BSF endemic status of areas no. 1 to 3 (Piracicaba, Americana, and Araras) was corroborated by endpoint titers at least fourfold higher for R. rickettsii than for other Rickettsia species in many of the tested capybaras. In fact, we have just reported a successful isolation of R. rickettsii from A. sculptum ticks that were parasitizing one of the capybaras that were captured in the BSF-endemic area of Piracicaba, corroborating local circulation of R. rickettsii between ticks and capybaras [10]. As expected, we had no serological evidence of R. rickettsii infection in the four BSF-nonendemic areas of São Paulo state. Actually, what we observed in these areas was serological evidence of other Rickettsia species, especially R. bellii. This result should be related to the predominance of A. dubitatum ticks in these areas, since it has been reported that most of the A. dubitatum populations are infected by R. bellii (usually at high infection rates) in multiple areas in the state of São Paulo, including some of the present study [40, 44, 49, 50]. Similarly to the BSF-nonendemic areas, we did not find serological evidence of R. rickettsii circulation in the two natural areas; however, it was interesting to note that 100% of the capybaras from Poconé were seroreactive to both R. rickettsii and R. parkeri, with endpoint titers generally higher for the later. Our findings of R. parkeri-infected A. triste ticks in Poconé supports the serological evidence that some of the capybaras from this area have been infected by R. parkeri, since A. triste ticks were found infesting capybaras in that area. Finally, the few serological evidence of capybara exposure to R. amblyommatis could be related to the recent reports of R. amblyommatis infecting A. sculptum ticks [38, 51], including the Poconé area [52], where we found seven capybaras with endpoint titers fourfold higher for R. amblyommatis. Our tick surveys clearly demonstrated that the BSF-endemic areas were characterized by tick burdens much higher than in the BSF-nonendemic areas, with A. sculptum encompassing the vast majority of the ticks on either capybaras or in the environment. In contrast, there was a predominance of A. dubitatum over A. sculptum in the BSF-nonendemic areas. Considering that both BSF-endemic and BSF-nonendemic areas had similar landscapes, one of the reasons driving the two distinct tick scenarios could be the size of the capybara population of each area. This hypothesis relies on a recent study performed within another highly anthropic area of the state of São Paulo, which in 2006 was not endemic for BSF, had 78 capybaras, and dry ice traps captured a mean of 0.7 A. sculptum/trap and 3.3 A. dubitatum/trap; in 2012, the same area had become endemic for BSF, had 230 capybaras (≈3 times higher than in 2006), and dry ice traps captured a mean of 33 A. sculptum/trap (≈47 times higher than in 2006) and 2.1 A. dubitatum/trap (≈0.3 times lower than in 2006) [53]. The authors concluded that the emergence of BSF in the area in 2012 was a consequence of the increase of the local capybara population, which in turn, provided the increment of the A. sculptum population. Unfortunately, the numbers of capybaras among the BSF-endemic and BSF-nonendemic areas were not available for comparisons during the present study. Indeed, further studies should be done in order to verify capybara demographic differences among the areas here prospected. Moreover, these studies should also focus on the reproduction rates of capybara groups, since recent mathematical models have proposed that the establishment of R. rickettsii in a capybara-sustained A. sculptum population is dependent on a high reproduction rate of this host species [11, 54]. The predominance of A. dubitatum over A. sculptum could also have direct implications on the absence of R. rickettsii in BSF-non endemic areas, especially because populations of A. dubitatum have been found naturally infected by R. bellii throughout the state of São Paulo, usually at high infection rates [40, 44, 49, 50]. One study showed that R. bellii-infected A. dubitatum ticks were partially refractory to R. rickettsii, and were not competent to pass R. rickettsii transovarially [55]. Thus, as long as A. dubitatum prevails in one area, R. rickettsii might not be able to establish an infection in either A. dubitatum or A. sculptum. In the case of A. sculptum, our results and the study of [53] showed that R. rickettsii was established only when there was an overgrowth population of A. sculptum, possibly because the proportion of R. rickettsii-infected A. sculptum ticks under natural conditions is always very low (<1%) [7-10]. Such assumption might allow us to speculate that any intervention resulting in a drastic reduction of the A. sculptum population would eliminate the R. rickettsii infection from the tick population. Different from the highly anthropic areas of the state of São Paulo, as much as six tick species were collected in the natural areas of the Pantanal biome. Such species richness was somewhat expected in pristine areas of this biome, where several species of medium- to large-sized mammals act as major hosts for ticks, including A. sculptum [20, 56–60]. While A. sculptum was the dominant tick species in the natural areas, tick burdens were much lower than in the anthropic areas. Such findings highlight the ecological disequilibrium of the anthropic areas, where much higher tick burdens were associated to a single major host species, the capybara. Other factors that could be contributing for the BSF endemic or nonendemic status in A. sculptum-capybara associated areas in southeastern Brazil are inherent to the A. sculptum populations, namely their susceptibilities to R. rickettsii infection. This hypothesis relies on a recent study that compared the susceptibility of R. rickettsii infection among six populations of A. sculptum [61]. The authors showed that there were significant differences among the susceptibilities of the six tick populations, and suggested that it could be another factor driving the uneven distribution of R. rickettsii among the wide distribution of A. sculptum in southeastern Brazil. However, the mechanisms driving these different susceptibilities are yet to be determined. The relatively low number of sampled areas (nine) distributed among three contiguous biomes could be considered a main drawback of this study. Indeed, higher number of areas per epidemiological category would imply greater robustness to our results. However, the high similarity of our observations by epidemiological category supports our results. Actually, sampling of areas within three different biomes was chosen for their strong relation with spotted fever core features; capybaras and A. sculptum ticks. In fact, the endemic and non-endemic areas in São Paulo State were intensely anthropized green areas. Although they might have originally been rainforests or savannahs, their natural phytophysiognomies vanished and now share common environmental features characterized by a water source and low grassy areas with relatively few trees, all adequate for capybaras. Similar natural areas maintaining capybara populations had to be found for the control groups as well. Such pristine areas are non-existent in São Paulo State, and the Pantanal biome was the one that provided the most similar features, for example abundant water source and widespread capybara populations. More importantly, all the nine sampled areas are around the center of the wide range of A. sculptum [20] and away from the geographic boundaries of this tick species, precluding negative effects of extreme weather on our results for ticks.

Conclusions

The BSF-endemic areas of the state of São Paulo were characterized by overgrowth populations of A. sculptum that were sustained chiefly by capybaras, and decreased populations of A. dubitatum. In contrast, the BSF-nonendemic areas with landscape similar to the endemic areas differed by having lower tick burdens and a slight predominance of A. dubitatum over A.sculptum, both sustained chiefly by capybaras. Higher species richness of ticks (six species) was found in the natural areas of Pantanal, although environmental tick burdens were lower than in the anthropic areas of São Paulo. While multiple medium- to large-sized mammals have been pointed out as important hosts for A. sculptum in the Pantanal, the capybara was the only important host for this tick species in the anthropic areas of the present study. The uneven distribution of the presence of R. rickettsii infection among A. sculptum populations in highly anthropic areas of the state of São Paulo could be related to the tick population size and its proportion in relation to sympatric A. dubitatum populations.

General overview of the nine areas (1 to 9) where capybaras and host-questing ticks were sampled in this study.

Satellite images were obtained from Google Earth Pro version 7.3, and the final figure was constructed with the use of Microsoft Power Point 2010, version 14.0.7232.5000. (PDF) Click here for additional data file.

Areas where capybaras and ticks were sampled in the present study.

(PDF) Click here for additional data file.

Antibody endpoint titers determined by immunofluorescence assays (IFA) against antigens of six Rickettsia species in sera of capybaras captured in 9 localities, being 3 Brazilian spotted fever (BSF)-endemic areas, 4 BSF-nonendemic areas, and 2 natural areas of Brazil, during 2015–2018.

(PDF) Click here for additional data file.

Host-questing ticks collected by dry-ice traps in 9 localities [3 Brazilian spotted fever (BSF)-endemic areas, 4 BSF-nonendemic areas, and 2 natural areas] during 2015–2019.

(PDF) Click here for additional data file.
  51 in total

1.  Isolation of Rickettsia rickettsii and Rickettsia bellii in cell culture from the tick Amblyomma aureolatum in Brazil.

Authors:  Adriano Pinter; Marcelo B Labruna
Journal:  Ann N Y Acad Sci       Date:  2006-10       Impact factor: 5.691

2.  Isolation of Rickettsia felis in the mosquito cell line C6/36.

Authors:  Maurício C Horta; Marcelo B Labruna; Edison L Durigon; Teresinha T S Schumaker
Journal:  Appl Environ Microbiol       Date:  2006-02       Impact factor: 4.792

3.  Nymphs of the genus Amblyomma (Acari: Ixodidae) of Brazil: descriptions, redescriptions, and identification key.

Authors:  Thiago F Martins; Valeria C Onofrio; Darci M Barros-Battesti; Marcelo B Labruna
Journal:  Ticks Tick Borne Dis       Date:  2010-04-20       Impact factor: 3.744

4.  Rickettsia parkeri infecting free-living Amblyomma triste ticks in the Brazilian Pantanal.

Authors:  Andréia L T Melo; Alvair S Alves; Fernanda A Nieri-Bastos; Thiago F Martins; Rute Witter; Thábata A Pacheco; Herbert S Soares; Arlei Marcili; Cristiane S Chitarra; Valéria Dutra; Luciano Nakazato; Richard C Pacheco; Marcelo B Labruna; Daniel M Aguiar
Journal:  Ticks Tick Borne Dis       Date:  2015-01-20       Impact factor: 3.744

5.  Rickettsia spp. among wild mammals and their respective ectoparasites in Pantanal wetland, Brazil.

Authors:  Keyla Carstens Marques de Sousa; Heitor Miraglia Herrera; Fabiana Lopes Rocha; Francisco Borges Costa; Thiago Fernandes Martins; Marcelo Bahia Labruna; Rosangela Zacarias Machado; Marcos Rogério André
Journal:  Ticks Tick Borne Dis       Date:  2017-10-27       Impact factor: 3.744

6.  Rickettsia infection in five areas of the state of São Paulo, Brazil.

Authors:  Maurício C Horta; Marcelo B Labruna; Adriano Pinter; Pedro M Linardi; Teresinha T S Schumaker
Journal:  Mem Inst Oswaldo Cruz       Date:  2007-11       Impact factor: 2.743

7.  Prevalence of antibodies to spotted fever group rickettsiae in humans and domestic animals in a Brazilian spotted fever-endemic area in the state of São Paulo, Brazil: serologic evidence for infection by Rickettsia rickettsii and another spotted fever group Rickettsia.

Authors:  Maurício C Horta; Marcelo B Labruna; Luis A Sangioni; Manoella C B Vianna; Solange M Gennari; Márcio A M Galvão; Claudio L Mafra; Odilon Vidotto; Teresinha T S Schumaker; David H Walker
Journal:  Am J Trop Med Hyg       Date:  2004-07       Impact factor: 2.345

8.  Mitochondrial 16S rDNA sequences and phylogenetic relationships of species of Rhipicephalus and other tick genera among Metastriata (Acari: Ixodidae).

Authors:  A J Mangold; M D Bargues; S Mas-Coma
Journal:  Parasitol Res       Date:  1998-06       Impact factor: 2.289

9.  Transmission dynamics and control of Rickettsia rickettsii in populations of Hydrochoerus hydrochaeris and Amblyomma sculptum.

Authors:  Gina Polo; Carlos Mera Acosta; Marcelo B Labruna; Fernando Ferreira
Journal:  PLoS Negl Trop Dis       Date:  2017-06-05

10.  Rickettsia amblyommii infecting Amblyomma sculptum in endemic spotted fever area from southeastern Brazil.

Authors:  Emília de Carvalho Nunes; Vinicius Figueiredo Vizzoni; Daniel Leal Navarro; Felipe Campos de Melo Iani; Liliane Silva Durães; Erik Daemon; Carlos Augusto Gomes Soares; Gilberto Salles Gazeta
Journal:  Mem Inst Oswaldo Cruz       Date:  2015-12-11       Impact factor: 2.743

View more
  4 in total

1.  New records of soft ticks (Acari: Argasidae) in the Caatinga biome of Brazil, with a phylogenetic analysis of argasids using the nuclear Histone 3 (H3) gene.

Authors:  Bruno M Teixeira; Sebastián Muñoz-Leal; Marcelo B Labruna; Felipe R Jorge; Lorena M B de Oliveira; Meylling M L Magalhães; Bárbara Weck; Glauber M B de Oliveira; Maria Carolina A Serpa; Francisco B P Moura; Romilson S Lopes Júnior; Jessica M L Dos Santos
Journal:  Exp Appl Acarol       Date:  2022-03-19       Impact factor: 2.132

2.  Molecular Detection of Rickettsia parkeri Strain Atlantic Rainforest in Ticks Parasitizing Small Mammals in Northeastern Brazil.

Authors:  Josiane M Rocha; Philipe B de Oliveira; Sócrates F da Costa-Neto; Maria H Ogrzewalska; Thiago F Martins; João L H Faccini; Martin R D V Alvarez; Hermes R Luz; George R Albuquerque
Journal:  Acta Parasitol       Date:  2022-09-20       Impact factor: 1.534

3.  Tick-borne pathogens in neotropical animals in Trinidad, West Indies.

Authors:  Candice Sant; Devon Seunarine; Nadine Holder; Krystal Maharaj; Melanie Vaughan; Shimon Harrus; Ricardo Gutierrez; Yaarit Nachum-Biala; Gad Baneth; Roxanne Charles; Patricia Pow-Brown; Rod Suepaul; Karla Georges
Journal:  Parasit Vectors       Date:  2022-02-19       Impact factor: 3.876

Review 4.  Recent Advances in the Immunologic Method Applied to Tick-Borne Diseases in Brazil.

Authors:  Mônica E T Alcon-Chino; Salvatore G De-Simone
Journal:  Pathogens       Date:  2022-08-02
  4 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.