Literature DB >> 29684409

Effects of hypervariable regions in spike protein on pathogenicity, tropism, and serotypes of infectious bronchitis virus.

Dan Shan1, Shouguo Fang2, Zongxi Han1, Hui Ai1, Wenjun Zhao1, Yuqiu Chen1, Lei Jiang1, Shengwang Liu3.   

Abstract

To study the roles of hypervariable regions (HVRs) in receptor-binding subunit S1 of the spike protein, we manipulated the genome of the IBV Beaudette strain using a reverse genetics system to construct seven recombinant strains by separately or simultaneously replacing the three HVRs of the Beaudette strain with the corresponding fragments from a QX-like nephropathogenic isolate ck/CH/LDL/091022 from China. We characterized the growth properties of these recombinant IBVs in Vero cells and embryonated eggs, and their pathogenicity, tropism, and serotypes in specific pathogen-free (SPF) chickens. All seven recombinant IBVs proliferated in Vero cells, but the heterogenous HVRs could reduce their capacity for adsorption during in vitro infection. The recombinant IBVs did not significantly increase the pathogenicity compared with the Beaudette strain in SPF chickens, and they still shared the same serotype as the Beaudette strain, but the antigenic relatedness values between the recombinant strain and Beaudette strain generally decreased with the increase in the number of the HVRs exchanged. The results of this study demonstrate the functions of HVRs and they may help to develop a vaccine candidate, as well as providing insights into the prevention and control of IBV.
Copyright © 2018 Elsevier B.V. All rights reserved.

Entities:  

Keywords:  Hypervariable region; Infectious bronchitis virus; Infectious clone; Recombinant IBV; Reverse genetic vaccine

Mesh:

Substances:

Year:  2018        PMID: 29684409      PMCID: PMC7114591          DOI: 10.1016/j.virusres.2018.04.013

Source DB:  PubMed          Journal:  Virus Res        ISSN: 0168-1702            Impact factor:   3.303


Introduction

IBV primarily replicates in the epithelial surface of the respiratory tract, although some strains are nephropathogenic (Cavanagh, 2003). IBV infections reduce egg production, quality, and hatchability, as well as increasing the feed conversion ratio and carcass condemnation in slaughterhouses. Thus, infectious bronchitis causes severe economic losses in the poultry industry worldwide. The enveloped IBV belongs to the genus Coronavirus, family Coronaviridae, order Nidovirales (Cavanagh, 2003). The main structural protein is the spike (S) glycoprotein, which comprises a divergent S1 subunit and conserved S2 subunit (de Groot et al., 1987; Shil et al., 2011). The S1 subunit contains the receptor-binding domain (Wickramasinghe et al., 2011), and it carries virus-neutralizing and serotype-specific determinants. The S1 domain exhibits high sequence diversity, where 20%–25% (even up to 50%) of the amino acids differ within the S1 subunit among IBV serotypes. After comparing the S1 subunit from a number of distinct IBV isolates, a previous study defined particularly variable segments at the amino terminus of the S1 subunit as hypervariable regions (HVRs) (Kusters et al., 1989). The HVRs possibly account for the antigenicity and serotypic variation, and evidence indicates that five neutralizing peptides mainly mapped onto the S1 subunit are co-located within the HVRs (Cavanagh et al., 1992, 1988; Moore et al., 1997; Niesters et al., 1987). In addition, the HVRs are possibly associated with receptor binding. It has been reported that the critical amino acids for attachment of the M41 spike overlap with a HVR in the S1 subunit (Promkuntod et al., 2014). Thus, the HVRs may affect the tropism, serotype, and pathogenicity of IBV, and it is important to elucidate their biological functions. Previous studies applied forward genetics methods to determine the roles of the HVRs by characterizing their phylogenetically closely related isolates with mutations in other parts of the IBV genome, but it is difficult to establish a precise model for further analysis based on these studies. Thus, in this study, we manipulated the IBV Beaudette genome by reverse genetics to exchange the HVRs in the Beaudette strain with those in ck/CH/LDL/091022 in order to precisely determine their biological functions. We also explored the possibility of developing a reverse genetic vaccine candidate cultured in Vero cells to provide protection from the prevalent field strains. The results of this study contribute to our understanding of the prevention and control of IBV.

Materials and methods

Cells and viruses

Vero cells were maintained in Dulbecco’s modified Eagle’s medium (Gibco, Grand Island, NY, USA) supplemented with 10% fetal bovine serum (Sigma-Aldrich, Saint Louis, MO, USA), penicillin (100 units/ml), and streptomycin (100 μg/ml) at 37°C with 5% carbon dioxide. The ck/CH/LDL/091022 strain was isolated from H120-vaccinated chickens with renal lesions in 2009 (Liu et al., 2013). The Beaudette strain was routinely propagated in Vero cells (Liu et al., 1995, 1998; Tay et al., 2012) and the 50% tissue culture infection dose (TCID50) of the viral stock was calculated using 96-well plates with 10-fold serial dilutions. The 50% egg infection dose (EID50) of the viral stock was determined by inoculating 10-fold dilutions into groups of 9-day-old embryonated chicken eggs.

Recovery of infectious recombinant IBVs

Five fragments spanning the entire IBV genome were obtained by RT-PCR from Vero cells infected with the IBV Beaudette strain, as described previously (Fang et al., 2007). The three HVRs in the isolate ck/CH/LDL/091022 were identified based on alignments of the amino acid sequences, as described previously (Zhang et al., 2015). The sequences of the IBV cDNA covering the three HVRs in the S gene were replaced separately or simultaneously with those from ck/CH/LDL/091022, and subsequently ligated into the full-length IBV cDNA (Fig. 1 a and Table 1 ). Full-length transcripts generated in vitro were introduced into Vero cells by electroporation. IBV N gene transcripts were also generated to enhance the efficiency of viral recovery. Total RNA was prepared from the electroporated Vero cells or infected allantoic liquid. Viral RNA replication was investigated based on RT-PCR of negative-strand genomic RNA (Tan et al., 2006). The S gene in the recovered IBV clones (third passage in Vero cells and embryonated eggs) was amplified by RT-PCR and subsequently confirmed by DNA sequencing analysis. The gene was characterized during the third passage of viruses in specific pathogen-free (SPF) embryonated eggs or Vero cells. The seven rescued recombinant IBVs were designated as rHVR I, rHVR II, rHVR III, rHVR I/II, rHVR I/III, rHVR II/III, and rHVR I/II/III.
Fig. 1

Recovery of the recombinant IBVs from cells.

(a) Diagram showing the organization of the genomes in the recombinant IBVs. The genome structure of the IBV Beaudette strain is shown in the white rectangle. Regions coding for the hypervariable regions (HVRs) in the IBV strain ck/CH/LDL/091022 are shown in the black rectangle. (b) Immunofluorescent staining of Vero cells infected with the recombinant IBVs. The cells were infected with the recombinant IBVs and the two parental strains. At 24 h post-infection, the cells were fixed and stained with the monoclonal antibody against IBV N protein. (c) Detection of the viral RNA in Vero cells by RT-PCR. Total RNA was extracted from Vero cells electroporated with full-length transcripts at 48 h post-electroporation. RT-PCR was used to amplify the regions corresponding to the 5′-terminal 415 bp and 1010 bp of subgenomic mRNA 4 and 3, respectively.

Table 1

Summary of mutations in HVRs introduced into the Beaudette strain.

NameAmino acid sequences in the S1 subunit of spike proteina
HVR I (positions 50–86)HVR II (positions 104–138)HVR III (positions 272–291)
BeaudetteVNISSEFNNAGSSSGCTVGIIHGGRVVNASSIAMTAPFSDTTVFVTHCYKHGGCPITGMLQQNFIRVSAMKNFIFHNETGANPNPSGVQNIQ
ck/CH/LDL/091022VNSTNYTSNAGSASECTVGVIKDVYNQSAASIAMTAPFSEITVFVTHCYSSGTGSCPITGMIARDHIRISAMKNFTFTNVSTAQPNSGGVSTFH
rHVR IVNSTNYTSNAGSASECTVGVIKDVYNQSAASIAMTAPFSDTTVFVTHCYKHGGCPITGMLQQNFIRVSAMKNFIFHNETGANPNPSGVQNIQ
rHVR IIVNISSEFNNAGSSSGCTVGIIHGGRVVNASSIAMTAPFSEITVFVTHCYSSGTGSCPITGMIARDHIRISAMKNFIFHNETGANPNPSGVQNIQ
rHVR IIIVNISSEFNNAGSSSGCTVGIIHGGRVVNASSIAMTAPFSDTTVFVTHCYKHGGCPITGMLQQNFIRVSAMKNFTFTNVSTAQPNSGGVSTFH
rHVR I/IIVNSTNYTSNAGSASECTVGVIKDVYNQSAASIAMTAPFSEITVFVTHCYSSGTGSCPITGMIARDHIRISAMKNFIFHNETGANPNPSGVQNIQ
rHVR I/IIIVNSTNYTSNAGSASECTVGVIKDVYNQSAASIAMTAPFSDTTVFVTHCYKHGGCPITGMLQQNFIRVSAMKNFTFTNVSTAQPNSGGVSTFH
rHVR II/IIIVNISSEFNNAGSSSGCTVGIIHGGRVVNASSIAMTAPFSEITVFVTHCYSSGTGSCPITGMIARDHIRISAMKNFTFTNVSTAQPNSGGVSTFH
rHVR I/II/IIIVNSTNYTSNAGSASECTVGVIKDVYNQSAASIAMTAPFSEITVFVTHCYSSGTGSCPITGMIARDHIRISAMKNFTFTNVSTAQPNSGGVSTFH

Substitutions of amino acids in HVRs are shown in bold for the ck/CH/LDL/091022 strain compared with those in the Beaudette strain.

Recovery of the recombinant IBVs from cells. (a) Diagram showing the organization of the genomes in the recombinant IBVs. The genome structure of the IBV Beaudette strain is shown in the white rectangle. Regions coding for the hypervariable regions (HVRs) in the IBV strain ck/CH/LDL/091022 are shown in the black rectangle. (b) Immunofluorescent staining of Vero cells infected with the recombinant IBVs. The cells were infected with the recombinant IBVs and the two parental strains. At 24 h post-infection, the cells were fixed and stained with the monoclonal antibody against IBV N protein. (c) Detection of the viral RNA in Vero cells by RT-PCR. Total RNA was extracted from Vero cells electroporated with full-length transcripts at 48 h post-electroporation. RT-PCR was used to amplify the regions corresponding to the 5′-terminal 415 bp and 1010 bp of subgenomic mRNA 4 and 3, respectively. Summary of mutations in HVRs introduced into the Beaudette strain. Substitutions of amino acids in HVRs are shown in bold for the ck/CH/LDL/091022 strain compared with those in the Beaudette strain.

Growth kinetics of the recombinant IBVs

To determine the growth kinetics of the rescued recombinant IBVs, a dose of 100 × EID50 was inoculated into the allantoic cavities of 9-day-old embryonated eggs, and the allantoic fluid was harvested from three eggs in each group at 12, 24, 36, 48, and 60 h post-inoculation, where the fluids from three eggs were pooled for EID50 determination with three replicates. Vero cells were infected with Beaudette and recombinant IBVs, and three wells were harvested at 4, 8, 12, 16, 24, and 36 h post-infection. Viral stocks were prepared by freezing/thawing the cells three times to determine the TCID50 with three replicates for each time.

Immunofluorescent (IF) staining

IBV infected cells cultured in six-well plates were washed with phosphate-buffered saline (PBS), fixed with 4% paraformaldehyde for 15 min, and permeabilized with 0.2% Triton X-100 for 10 min. IF staining was performed with a monoclonal antibody 6D10 against IBV N protein (Han et al., 2013) and subsequently with FITC-conjugated anti-mouse IgG (Sigma-Aldrich). Cells were examined by fluorescence microscopy.

Pathogenicity test

All of the animal experimental procedures were approved by the Ethical and Animal Welfare Committee of Heilongjiang Province, China (License no. SQ20160408). We randomly assigned 150 7-day-old SPF layer chickens to 10 groups, i.e., the seven recombinant strains, Beaudette, ck/CH/LDL/091022, and PBS groups. There were 15 SPF chickens in each group. The challenge strain (105 × EID50 per bird) was applied via the intranasal and ocular routes. The clinical signs were monitored in 10 randomly selected challenged birds from each group, and the morbidity and mortality rates were recorded daily. We evaluated the challenged chickens blindly for respiratory rales at 5 days after challenge. Signs were scored as 0 = absent, 1 = mild, 2 = moderate, or 3 = severe. At 5 days after IBV challenge, the other five birds in each group were killed humanely using carbon dioxide over inhalation, followed by exsanguination. The cranial third of the trachea, lungs, kidneys, and cecum tonsils were collected, partly fixed in formalin, and embedded in paraffin. Longitudinal 5-μm sections were stained with hematoxylin-eosin (H&E stain). The mucosal thickness, deciliation, goblet cells, and lymphocytes scores for the tracheal mucosa were evaluated blindly and scored from 1 to 5 based on their severity (i.e., normal, mild, moderate, marked, and severe) (van Ginkel et al., 2015). Moreover, viral shedding was quantified in the oropharyngeal secretions from 10 infected chickens at 4, 8, 12, 16, and 20 days after challenge by real-time RT-PCR (Jones et al., 2011).

In vivo Tissue tropism

The tissues collected at 5 days post-IBV challenge, i.e., tracheas, lungs, kidneys, and cecum tonsils, were also subjected to immunohistochemistry (IHC) using monoclonal antibody 6D10, as described previously (de Wit et al., 2011; Xu et al., 2016). Viral loads in selected tissues were determined based on IBV RNA detection by real-time RT-PCR, as described previously (Zhao et al., 2017).

Cross-virus neutralization assay

The seven IBV recombinant strains, Beaudette, and ck/CH/LDL/091022 were analyzed in cross-virus neutralization tests. Sera against the IBV strains were prepared as previously described (Zhang et al., 2015). In the virus neutralization tests, sera were serially diluted two times with sterile PBS and mixed with 200 × EID50 or TCID50 for the IBV strains. The two-way cross-neutralization test between the Beaudette and recombinant IBVs was performed in Vero cells. After incubation for 1 h at 37 °C, the virus–serum mixtures were cultured in 96-well microplates for 5 days. We could not detect the replication with ck/CH/LDL/091022 in Vero cells, so the neutralization tests were performed in 9-day-old SPF embryonated eggs to confirm whether the serotypes of the recombinant IBVs belonged to ck/CH/LDL/091022. The end-point titer for each serum sample was calculated using the Reed–Muench method. Antigenic relatedness values were calculated (Archetti and Horsfall et al., 1950; Wadey and Faragher, 1981).

Adsorption and internalization assessments using a cellular enzyme-linked immunosorbent assay (cELISA)

The cELISA protocol used in this study is similar to the conventional ELISA. The viral solution for each strain was serially diluted two times with sterile PBS and coated on the plate. Standard curves were drawn according to the standard ELISA method. Vero cells were cultured overnight in 96-well microplates (Corning, USA) (105 cells/well). For the adsorption assay, each strain was incubated in cells at a multiplicity of infection (MOI) of 1 for 1 h at 4 °C with three replicates (Fang et al., 2010; Sun et al., 2017). After two washes with PBS, the microplates were fixed with methanol and 1% hydrogen peroxide for 30 min, and then permeabilized with 0.2% Triton X-100 for 10 min at room temperature. Next, the microplates were washed three times and blocked with 8% skim milk for 30 min at room temperature. After washing three times, the microplates were incubated with the primary mouse monoclonal antibody 6D10 for 1 h at 37 °C. A similar procedure was then performed where the plates were incubated for 40 min with the peroxidase-conjugated anti-mouse IgG. Peroxidase substrate solution (TMB; Sigma-Aldrich) was added and the plates were developed in darkness. The color reaction was stopped with stop solution (Sigma-Aldrich) and the absorbance was read at 630 nm. For the internalization assay, cells were seeded into 96-well microplates and inoculated with each strain for 1 h at 37 °C. After incubation, the cells were washed twice with PBS, before treating the infected cells with citrate buffer for 1 min to inactivate the adsorbed but not internalized virus. The cells were washed with PBS to remove the citrate buffer. The cELISA process was performed as described above. The cELISA results were expressed as the relative viral load adsorbed or internalized into cells relative to the Beaudette control.

Adsorption and internalization assay using real-time RT-PCR

Vero cells were seeded in 24-well plates (Corning) and infected with each separate strain at an MOI of 1. In the adsorption and internalization stage, total RNA was extracted from the cells, before storing at −80 °C for the subsequent quantification of viral loads, as described previously (Liu et al., 2006a; Sun et al., 2014). Three replicates were analyzed for each sample. First, the stable expression levels of three candidate reference genes comprising 18S RNA, β-actin, and GAPDH were compared by real-time RT-PCR in Vero cells infected with the Beaudette strain at 4 °C or 37 °C for 1 h. The results were analyzed using geNorm software, NormFinder software, and Delta CT (http://150.216.56.64/referencegene.php). The viral mRNA levels of all the samples were calculated by using the most stably expressed genes as an internal reference for normalization (Fung et al., 2014). The real-time RT-PCR results were expressed as the relative viral load adsorbed or internalized into cells relative to the Beaudette control.

Vaccination challenge tests

We randomly assigned 200 7-day-old SPF layer chickens to 10 groups, with 20 birds in each group. Birds in groups 1–9 were inoculated with the seven recombinant IBVs, Beaudette, and ck/CH/LDL/091022 (105 × EID50 per bird) via intranasal and ocular routes. Birds in group 10 were inoculated with PBS and treated as the negative control. Half of the surviving birds in each group were randomly selected and challenged after 21 days with a 106 × EID50 dose of ck/CH/LDL/091022 via intranasal and ocular routes. The clinical signs were monitored in the challenged birds in each group, and the morbidity and mortality rates were recorded daily. Viral shedding was also quantified using oropharyngeal swabs from the challenged chickens at 4, 8, 12, 16, and 20 days after challenge by real-time RT-PCR (Jones et al., 2011). The remaining chickens in each group were investigated for 15 days.

Statistical analysis

One-way ANOVA followed Tukey’s multiple comparison tests were used to compare differences in the viral loads in selected tissues, as well as the results of the adsorption and internalization assays. All P-values were two-tailed and differences were considered significant when P < 0.05. In addition, Kruskal–Wallis ANOVA followed Dunn’s multiple comparison tests in SPSS statistics were used to compare the trachea lesion scores and clinical scores. Differences in the survival rates were analyzed using the log-rank test.

Results

Rescue of the recombinant IBVs

We constructed seven full-length cDNA clones where the HVRs from Beaudette were substituted with those from ck/CH/LDL/091022 either separately or simultaneously (Fig. 1a and Table 1). The RNA transcripts generated from the full-length cDNA clones were introduced separately into Vero cells together with the N transcripts by electroporation (Fang et al., 2005). After 48 h, the virus present in each medium was collected and used to inoculate 9-day-old SPF embryonated eggs. To differentiate the rescued viruses from the parental viruses, viral RNA was extracted from allantoic fluid and the S1 genes were amplified using RT-PCR, where the RT-PCR products covering the three HVRs were sequenced. Viral antigen was observed in Vero cells infected with the Beaudette strain and the seven recombinant IBVs (Fig. 1b). No virus antigen was found in cells infected with ck/CH/LDL/091022. RT-PCR analysis of subgenomic mRNA 3 and mRNA 4 was performed to confirm the virus replication (Fig. 1c) (Fang et al., 2007). The results confirmed that the recombinant IBVs were adapted to Vero cells in a similar manner to the Beaudette strain.

Characterization of the rescued IBVs

To test whether exchanging the HVRs affected the growth properties and genetic stability of the rescued viruses, the recombinant IBVs were propagated on embryonated eggs or Vero cells for three passages. The S1 gene sequencing results confirmed that the heterogenous HVRs were stably maintained in the recombinant IBVs (Sup Fig. 1), and no additional mutations were detected in the S protein after three passages in cells or eggs. The growth properties of the recombinant IBVs were then determined in Vero cells and embryonated eggs. In Vero cells (Fig. 1c), the growth kinetics of the recombinant IBVs were similar to those of the Beaudette strain, and they all reached their peak titer at 16 h post-infection, and there was no significant difference between the titers for the recombinant IBVs and Beaudette at different time points (Fig. 2 ). In embryonated eggs (Fig. 3 a), although there were no significant difference between the virus titers for the recombinant IBVs and Beaudette at different time points, the titers of ck/CH/LDL/091022 was significantly higher than those of the recombinant IBVs and Beaudette at 12, 36, 48, 60 h (Fig. 3b). In conclusion, the recombinant IBVs exhibited similar growth phenotypes compared to the Beaudette strain in both cells and eggs.
Fig. 2

Analysis of the growth properties of the recombinant IBVs in Vero cells.

Growth curves for the recombinant IBVs in Vero cells. In order to determine the growth curves for the recombinant IBVs and Beaudette, Vero cells were infected and harvested at 0, 4, 8, 16, 24, and 36 h post-infection. Viral stocks were prepared by freezing/thawing the cells three times and TCID50 was determined by infecting Vero cells in 96-well plates with 10-fold serial dilutions of each viral stock. The experiments were conducted based on three replicates. ANOVA followed Tukey’s multiple comparison tests were performed to compare the virus titers of different strains at the same time point, and differences were considered significant at P < 0.05.

Fig. 3

Analysis of the growth properties of the recombinant IBVs in embryonated eggs.

(a) Detection of the recombinant IBVs in embryonated eggs. A fragment of the N gene was amplified by RT-PCR to detect the replication of the recombinant IBVs, Beaudette, and ck/CH/LDL/091022 in embryonated eggs. (b) Replication kinetics of the recombinant IBVs in embryonated eggs. The rescued IBVs and the parental strains (100 × EID50) were inoculated into the allantoic cavities of three 9-day old embryonated eggs. The allantoic fluids from three eggs in each group were then harvested at 12, 24, 36, 48, and 60 h post-inoculation and pooled to determine the EID50 values in embryonated eggs. The experiments were conducted based on three replicates. ANOVA followed Tukey’s multiple comparison tests were performed to compare the virus titers of different strains at the same time point, and differences were considered significant at P < 0.05.

Analysis of the growth properties of the recombinant IBVs in Vero cells. Growth curves for the recombinant IBVs in Vero cells. In order to determine the growth curves for the recombinant IBVs and Beaudette, Vero cells were infected and harvested at 0, 4, 8, 16, 24, and 36 h post-infection. Viral stocks were prepared by freezing/thawing the cells three times and TCID50 was determined by infecting Vero cells in 96-well plates with 10-fold serial dilutions of each viral stock. The experiments were conducted based on three replicates. ANOVA followed Tukey’s multiple comparison tests were performed to compare the virus titers of different strains at the same time point, and differences were considered significant at P < 0.05. Analysis of the growth properties of the recombinant IBVs in embryonated eggs. (a) Detection of the recombinant IBVs in embryonated eggs. A fragment of the N gene was amplified by RT-PCR to detect the replication of the recombinant IBVs, Beaudette, and ck/CH/LDL/091022 in embryonated eggs. (b) Replication kinetics of the recombinant IBVs in embryonated eggs. The rescued IBVs and the parental strains (100 × EID50) were inoculated into the allantoic cavities of three 9-day old embryonated eggs. The allantoic fluids from three eggs in each group were then harvested at 12, 24, 36, 48, and 60 h post-inoculation and pooled to determine the EID50 values in embryonated eggs. The experiments were conducted based on three replicates. ANOVA followed Tukey’s multiple comparison tests were performed to compare the virus titers of different strains at the same time point, and differences were considered significant at P < 0.05.

Adsorption and internalization assays

The IF staining results showed the IBV N antigens in Vero cells infected with the recombinant IBVs (Fig. 1b) and they have the similar ability to replicate in Vero cells with IBV Beaudette. We then evaluated the effects of the heterogenous HVRs on virus adsorption and internalization. The cELISA results for the adsorption assay showed that compared with Beaudette, the recombinant IBVs exhibited significantly reduced adsorption at 4 °C for 1 h (Fig. 4 a). The real-time RT-PCR results were consistent with the cELISA results in the adsorption assays (Fig. 4b). The results indicated that the heterogenous HVRs could reduce the adsorption capacity of the recombinant IBVs. In addition, the cELISA results from the internalization assay showed that the viral yields of the recombinant IBVs internalized into cells did not differ significantly from those with Beaudette (Fig. 4c). The real-time RT-PCR results were consistent with the cELISA results from the internalization assay (Fig. 4d).
Fig. 4

Adsorption and internalization assays.

Vero cells were cultured in 96-well plates and infected with the recombinant IBVs and two parental strains (105 × EID50) for 1 h at 4 °C or 1 h at 37 °C. The experiments were conducted based on three replicates. (a) Infected cells were fixed and cELISA was performed as described in the Materials and Methods. Results are shown as viral load adsorption on cell equivalents relative to EID50 compared with that in the Beaudette strain (100%). (b) Vero cells were cultured in 24-well plates and infected with the recombinant IBVs and parental strains (106 × EID50) for 1 h at 4 °C. Total RNA was extracted from the infected cells before quantifying the viral loads using real-time RT-PCR. Data were normalized against the GAPDH expression levels and viral RNA was calculated relative to that in the Beaudette strain (100%). The experiments were conducted based on three replicates. (c) cELISA was performed to evaluate the viral load internalized into cells. (d) Real-time RT-PCR was also used to evaluate the viral load internalized into cells. The experiments were conducted based on three replicates. Differences were considered significant at P < 0.05 using ANOVA followed Tukey’s multiple comparison tests.

Adsorption and internalization assays. Vero cells were cultured in 96-well plates and infected with the recombinant IBVs and two parental strains (105 × EID50) for 1 h at 4 °C or 1 h at 37 °C. The experiments were conducted based on three replicates. (a) Infected cells were fixed and cELISA was performed as described in the Materials and Methods. Results are shown as viral load adsorption on cell equivalents relative to EID50 compared with that in the Beaudette strain (100%). (b) Vero cells were cultured in 24-well plates and infected with the recombinant IBVs and parental strains (106 × EID50) for 1 h at 4 °C. Total RNA was extracted from the infected cells before quantifying the viral loads using real-time RT-PCR. Data were normalized against the GAPDH expression levels and viral RNA was calculated relative to that in the Beaudette strain (100%). The experiments were conducted based on three replicates. (c) cELISA was performed to evaluate the viral load internalized into cells. (d) Real-time RT-PCR was also used to evaluate the viral load internalized into cells. The experiments were conducted based on three replicates. Differences were considered significant at P < 0.05 using ANOVA followed Tukey’s multiple comparison tests.

Pathogenicity of the recombinant IBVs

In order to test the pathogenicity of the recombinant IBVs, 7-day-old SPF chickens were inoculated via intranasal and ocular routes at a dose of 105 × EID50 per bird (Sun et al., 2011). We found that some of the chickens only had very low levels of snicking at 6 and 7 days post-infection, and there were no obvious clinical signs in the groups treated with the recombinant IBVs and Beaudette. However, 5/10 birds (50%) died during 5–9 days post-challenge with ck/CH/LDL/091022 and the morbidity rate was 100% (Fig. 5 a). The mean scores for the clinical signs in the birds inoculated with the recombinant IBVs and Beaudette were much lower than those treated with ck/CH/LDL/091022 (Fig. 5b). The autopsy results showed that ck/CH/ LDL/091022 caused obvious swollen pale kidneys, where the tubules and ureters were distended with urates, thereby indicating the nephropathogenic potential of the virus. However, the autopsies detected almost no changes in the groups treated with the recombinant IBVs and Beaudette. The H&E staining results also showed that there were no obvious pathological change in the lungs, cecum tonsils, and kidneys in the groups treated with the recombinant IBVs and Beaudette (Sup Fig. 2). We also assessed the severity scores for histopathological lesions in the trachea with deciliation (Fig. 6 a), goblet cells (Fig. 6b), mucosal thickness (Fig. 6c), and lymphocytes (Fig. 6d) at 5 days after challenge with the IBVs (van Ginkel et al., 2015). The scores were lowest in the Beaudette group and highest in the ck/CH/ LDL/091022 group, and there were no differences in the scores between the groups treated with the recombinant IBVs and Beaudette. However, the scores in the groups treated with the recombinant IBVs and Beaudette differed significantly from those with ck/CH/ LDL/091022. Finally, no IBV RNA was detected in the oropharyngeal swabs from chickens inoculated with the recombinant IBVs and Beaudette after 4, 8, 12, 16, and 20 days by real-time RT-PCR, where the results were considered positive when the Ct value was less than 32 (Li et al., 2016; Zhao et al., 2017). The results confirmed that the recombinant IBVs were avirulent according to the histomorphometry and histopathology findings.
Fig. 5

Pathogenicity test.

(a) Mortality was recorded daily for 10 randomly selected infected birds and the survival curve was drawn. (b) At 5 days after challenge, we evaluated the challenged chickens blindly and clinical signs were scored as: 0 = absent, 1 = mild, 2 = moderate, or 3 = severe. Kruskal–Wallis ANOVA followed Dunn’s multiple comparison tests were employed to perform comparisons of the clinical scores using SPSS.

Fig. 6

Trachea lesion scores.

At 5 days after challenge, the other five infected birds in each group were killed humanely using carbon dioxide over inhalation. Tissue samples were collected from the trachea and analyzed by H&E staining. Mucosal thickness (a), deciliation (b), goblet cells (c) and lymphocyte scores (d) for the trachea samples were evaluated blindly and scored from 1 to 5 based on severity. Kruskal–Wallis and Dunn–Bonferroni tests were employed to perform post hoc comparisons of trachea lesion scores using SPSS.

Pathogenicity test. (a) Mortality was recorded daily for 10 randomly selected infected birds and the survival curve was drawn. (b) At 5 days after challenge, we evaluated the challenged chickens blindly and clinical signs were scored as: 0 = absent, 1 = mild, 2 = moderate, or 3 = severe. Kruskal–Wallis ANOVA followed Dunn’s multiple comparison tests were employed to perform comparisons of the clinical scores using SPSS. Trachea lesion scores. At 5 days after challenge, the other five infected birds in each group were killed humanely using carbon dioxide over inhalation. Tissue samples were collected from the trachea and analyzed by H&E staining. Mucosal thickness (a), deciliation (b), goblet cells (c) and lymphocyte scores (d) for the trachea samples were evaluated blindly and scored from 1 to 5 based on severity. Kruskal–Wallis and Dunn–Bonferroni tests were employed to perform post hoc comparisons of trachea lesion scores using SPSS.

Serotypes of the recombinant IBVs

Using a previously described method (Archetti and Horsfall et al., 1950), the serotype relatedness values were calculated based on the cross-virus neutralization studies using Vero cells (Table 2 ) or embryonated chicken eggs (Table 3 ). Viruses with an Archetti and Horsfall relatedness value greater than 25 were considered to be related serotypes. Our results showed that the recombinant IBVs and Beaudette belonged to the same serotype (Table 2), whereas the recombinant IBVs and ck/CH/LDL/091022 belonged to different serotypes (Table 3). In general, we found that the serotype relatedness values decreased between the recombinant strain and Beaudette (Table 2) as the number of substituted heterogenous HVRs increased. These results confirmed that the replacement of the heterogenous HVRs had not caused serotype switches in this case.
Table 2

Results of neutralization tests using the recombinant IBVs and Beaudette strains in Vero cells (%).

12345678
1. rHVR I100
2. rHVR II54.9100
3. rHVR III56.466.6100
4. rHVR I/II64.172.165.5100
5. rHVR I/III73.845.069.644.2100
6. rHVR II/III42.345.867.145.049.4100
7. rHVR I/II/III40.244.152.643.146.765.9100

Virus replication was found in Vero cells infected with Beaudette and the recombinant IBVs, so the neutralization tests between them were performed in Vero cells.

Table 3

Results of neutralization tests using the recombinant IBVs and two parental strains in embryonated eggs (%).

rHVR IrHVR IIrHVR IIIrHVR I/IIrHVR I/IIIrHVR II/IIIrHVR I/II/IIIBeaudette
ck/CH/LDL/091022<2<2<2<2<2<2<2<2

ck/CH/LDL/091022 could not produce CPE in Vero cells so the neutralization tests between ck/CH/LDL/091022 and other strains were performed in embryonated eggs.

Results of neutralization tests using the recombinant IBVs and Beaudette strains in Vero cells (%). Virus replication was found in Vero cells infected with Beaudette and the recombinant IBVs, so the neutralization tests between them were performed in Vero cells. Results of neutralization tests using the recombinant IBVs and two parental strains in embryonated eggs (%). ck/CH/LDL/091022 could not produce CPE in Vero cells so the neutralization tests between ck/CH/LDL/091022 and other strains were performed in embryonated eggs.

In vivo tissue tropisms

The IHC results showed that the viral antigen of ck/CH/LDL/091022 was detected in trachea (Sup Fig. 3a), cecal tonsil (Sup Fig. 3b), and kidney samples (Sup Fig. 3c), but the results were negative in the tissues infected with the recombinant IBVs and Beaudette. The results were also negative in all of the lung samples (Sup Fig. 3d). The viral RNA could be detected by real-time RT-PCR in the selected tissues from chickens infected with ck/CH/LDL/091022, with high viral loads in the kidneys. However, very low RNA levels were detected in only a few trachea samples from the birds infected with the recombinant IBVs and Beaudette (Fig. 7 ). These results confirmed that the recombinant IBVs had the same tissue tropism as the Beaudette strain.
Fig. 7

Detection of IBV replication in challenged chickens.

At 5 days after challenge, the other five infected birds in each group were killed humanely using carbon dioxide over inhalation, and tissue samples of the trachea, lungs, kidneys, and cecum tonsils were collected to determine the presence of IBV by real-time RT-PCR. A Ct value less than 32 was considered to be IBV-positive using real-time RT-PCR. The numbers of tissue samples positive for IBV RNA/the number detected are presented at the bottom. Bars in different colors represent different tissues from chickens, as indicated in the graphical representation. The average copy numbers of IBV RNA in the positive samples are shown. Differences were considered significant at P < 0.05 using ANOVA followed Tukey’s multiple comparison tests.

Detection of IBV replication in challenged chickens. At 5 days after challenge, the other five infected birds in each group were killed humanely using carbon dioxide over inhalation, and tissue samples of the trachea, lungs, kidneys, and cecum tonsils were collected to determine the presence of IBV by real-time RT-PCR. A Ct value less than 32 was considered to be IBV-positive using real-time RT-PCR. The numbers of tissue samples positive for IBV RNA/the number detected are presented at the bottom. Bars in different colors represent different tissues from chickens, as indicated in the graphical representation. The average copy numbers of IBV RNA in the positive samples are shown. Differences were considered significant at P < 0.05 using ANOVA followed Tukey’s multiple comparison tests. Inoculating chickens with the seven recombinant IBVs induced clinical protection against challenge with ck/CH/LDL/091022 (Table 4 ). Viral shedding was detected in some of the chickens challenged with ck/CH/LDL/091022, but inoculating chickens with the seven recombinant IBVs and Beaudette reduced the morbidity and mortality rates compared with birds in the PBS group. However, the morbidity and mortality of the recombinant IBVs and Beaudette vaccinated groups was not as low as that of ck/CH/LDL/091022 inoculated group. These results suggest that although the recombinant IBVs could not offer complete protection against challenge with ck/CH/LDL/091022, inoculation with the seven recombinant IBVs did confer some cross protection against ck/CH/LDL/091022 challenge.
Table 4

Results of vaccination challenge tests.

GroupMorbidityMortalityVirus recoverya
Antibody response

Vaccinated
Challenged
4db8d12d16d20d4d8d12d16d20d4d8d12d16d20d
rHVR I7/101/1010/104/92/91/90/90/102/103/107/1010/106/109/99/99/99/9
rHVR II7/101/1010/107/94/92/90/90/101/103/105/1010/107/109/99/99/99/9
rHVR III8/101/1010/105/92/91/90/90/102/104/105/1010/106/109/99/99/99/9
rHVR I/II7/100/1010/106/104/100/100/100/103/105/107/1010/107/1010/1010/1010/1010/10
rHVR I/III7/101/1010/107/92/90/90/90/102/104/106/1010/106/109/99/99/99/9
rHVR II/III8/102/1010/106/81/80/80/80/101/103/106/1010/107/108/88/88/88/8
rHVR I/II/III7/100/1010/106/105/100/100/100/102/105/107/1010/108/1010/1010/1010/1010/10
Beaudette9/101/1010/104/94/91/90/90/102/104/106/1010/106/109/99/99/99/9
ck/CH/LDL/0910222/5c0/55/53/52/50/50/50/105/65/55/55/55/55/55/55/55/5
PBS10/103/1010/108/93/70/70/70/100/100/100/100/103/104/95/77/77/7

Viral RNA was detected in oral swab samples by real-time RT-PCR and samples with a Ct value less than 32 were considered positive.

Days after challenge.

Five birds died 7 days after inoculation with ck/CH/LDL/091022.

Results of vaccination challenge tests. Viral RNA was detected in oral swab samples by real-time RT-PCR and samples with a Ct value less than 32 were considered positive. Days after challenge. Five birds died 7 days after inoculation with ck/CH/LDL/091022.

Discussion

Coronavirus IBV S protein has multiple biological functions during the viral replication cycle. Previous studies suggest that some of these functions may be associated with HVRs in the S1 subunit of the S protein (Cavanagh and Davis, 1986; Ignjatovic and Galli, 1994; Johnson et al., 2003; Song et al., 1998). These previous studies employed forward genetics methods to determine the effects of the HVRs on serotypes by characterizing phylogenetically closely related isolates. However, these strains inevitably had mutations in other parts of the IBV genome, thereby making it difficult to establish a precise model for further studies based on these previous findings. In the present study, we manipulated the IBV RNA genomes by reverse genetics to produce site-directed mutations in order to elucidate the specific biological functions of the HVRs. We used the Beaudette and ck/CH/LDL/091022 strains in our study. IBV Beaudette is a well-known apathogenic lab strain (Geilhausen et al., 1973), which was adapted to Vero cells from chicken embryos (Fang et al., 2005). The ck/CH/LDL/091022 IBV strain is an epidemic strain isolated from H120-vaccinated layers in China. This strain mainly causes gross lesions in chicken kidneys, with high morbidity and mortality rates (Liu et al., 2008, 2009; Liu et al., 2006b). The ck/CH/LDL/091022 strain can only proliferate in chicken embryos and not Vero cells. In addition, the Beaudette and ck/CH/LDL/091022 strains belong to different serotypes. Thus, the differences in these two strains facilitate research into the effects of the HVRs in intact viral particles on serotypes, virulence, and tropisms. In order to determine the roles of individual HVRs and the accumulated effects of HVRs, we constructed seven recombinant IBVs where the three HVRs in the Beaudette strain were separately or simultaneously substituted with those from ck/CH/LDL/091022. All of the recombinant IBVs proliferated in Vero cells (Figs. 1b and Figure 2), and had the similar growth kinetics as Beaudette in Vero cells (Fig. 2) and embryonated eggs (Fig. 3b). The accumulation of heterogenous HVRs weakened the capacity for adsorption during infection by the recombinant viruses in vitro (Fig. 4a and b). The HVRs may be associated with the receptor-binding domain, so the heterogenous HVRs weakened the interaction between the viruses and their receptors on the host cells. With the same sequences of fusion subunit S2, the recombinant IBVs and Beaudette did not differ significantly in the internalization assay. It is unclear whether the recombinant viruses have more efficient internalization than Beaudette and the S proteins assemble correctly in the recombinant viruses, and whether there is a comparable amount of S on the virus particle. These problems require for further investigation. Both the recombinant IBVs and Beaudette only weakly infected the trachea in 7-day-old SPF chickens (Fig. 5e), whereas ck/CH/LDL/091022 infected multiple chicken tissues, including the trachea, lungs, kidneys, and cecal tonsils. Thus, the replication capacity was similar for the recombinant IBVs and the Beaudette strain in SPF chickens. It appears that only swapping the HVRs did not greatly affect the cell and tissue tropisms, although replacing the ectodomain of the S glycoprotein in the Beaudette strain can alter the growth characteristics (Casais et al., 2003). Virus binding to host cells is the first step in tropism determination and HVRs within the S1 subunit may affect IBV binding (Wickramasinghe et al., 2011), but S2 is responsible for membrane fusion (Sun et al., 2017), and thus exchanging the HVRs did not change their tropism. Previous studies have shown that the S protein has major effects on pathogenicity in coronaviruses (Leparc-Goffart et al., 1997; Phillips et al., 2001), but the specific effects of HVRs in the S protein on pathogenicity are not clear. In the present study, the recombinant IBVs remained avirulent with the HVRs from pathogenic ck/CH/LDL/091022, thereby indicating that only exchanging the HVR sequences did not have major impacts on pathogenicity (Fig. 5, Fig. 6, Sup. Fig. 2). According to Hodgson et al., the apathogenic nature of the recombinant IBV BeauR-M41(S) indicates that the S protein ectodomain from a virulent strain is not necessarily sufficient to overcome the attenuating mutations in other genes in the apathogenic Beaudette strain (Hodgson et al., 2004). It is possible that the replicase gene also contributes to the pathogenicity of IBV (Armesto et al., 2009; Hodgson et al., 2004). The functions of non-structural proteins (Nsp) in the context of pathogenesis are still not well understood, but some of the Nsps in other coronaviruses have been linked to loss of pathogenicity (Eriksson et al., 2008; Sperry et al., 2005). It is considered that the HVRs of the IBV S1 subunit may induce abundant virus neutralizing antibodies (Kant et al., 1992; Koch et al., 1990; Moore et al., 1997; Niesters et al., 1987). However, in our study, the introduction of heterogenous HVRs did not develop an independent serotype, although the antigenic relatedness values for the recombinant IBVs and Beaudette generally decreased as the number of heterogenous HVR exchanges increased (Table 2). This result is consistent with the conclusion of Santos Fernando et al. who found that three IBV isolates mainly exhibited mutations in the HVRs but they belonged to the same serotype (Santos Fernando et al., 2017). The repertoire of neutralizing polyclonal antibodies may react with the many epitopes of an antigen. Exchanging the HVRs could change several antigen determinants but it is not necessarily sufficient to change the serotype because other neutralizing epitopes have been identified in other parts of the S1 subunit and S2 subunit (Ignjatovic and Sapats, 2005; Kusters et al., 1989; Lenstra et al., 1989). In particular cases, a very low number of critical amino acid changes is sufficient to greatly alter the antigenicity (Cavanagh et al., 1992), although this view does not apply in all cases (Chen et al., 2015). In conclusion, the recombinant IBVs exhibited differences in antigenicity, but exchanging only the three HVRs between the two parental strains did not change the serotype. Vaccination is considered the most cost-effective approach for controlling IBV infection. However, current commercial vaccines have been challenged by the emergence of new IBV serotypes. Recently, reverse genetic techniques have been employed to modify IBV vaccine candidates. QX-like strains (LX4-type) emerged in China and spread to Asia (Mahmood et al., 2011), Russia (Bochkov et al., 2006), and Europe (Beato et al., 2005; Worthington et al., 2008). In this study, using ck/CH/LDL/091022 as a representative of epidemic QX-like strains, we modified the genome of the Beaudette strain to construct seven recombinant IBVs. We determined the effects of the HVRs and explored the possibility of developing a vaccine candidate that could proliferate in cells and provide protection against the prevalent field strains. The introduction of a few heterogenous peptides rather than the whole S protein may facilitate the development of multiepitope peptide vaccines to protect against a wide range of IBV serotypes (Yang et al., 2009). In the present study, the virus cross-neutralization and vaccination challenge tests indicated that only swapping the HVRs did not provide sufficient cross-protection, but further exploration of the recombinant IBVs may provide insights into novel vaccine candidates. In conclusion, we manipulated the genome of the IBV Beaudette strain using a reverse genetics system to construct seven recombinant strains by replacing the HVRs in the Beaudette strain with the corresponding fragments from a QX-like nephropathogenic isolate ck/CH/LDL/091022 from China. The results showed that the heterogenous HVRs could weaken the capacity for adsorption during infection in vitro, as well as reducing the antigenic relatedness values between the recombinant strains and Beaudette. The results obtained in this study help to understand the prevention and control of IBV.

Conflict of interest

All authors declare that they have no conflict of interest.
  59 in total

1.  Antigenic domains on the peplomer protein of avian infectious bronchitis virus: correlation with biological functions.

Authors:  G Koch; L Hartog; A Kant; D J van Roozelaar
Journal:  J Gen Virol       Date:  1990-09       Impact factor: 3.891

2.  Mouse hepatitis virus liver pathology is dependent on ADP-ribose-1''-phosphatase, a viral function conserved in the alpha-like supergroup.

Authors:  Klara Kristin Eriksson; Luisa Cervantes-Barragán; Burkhard Ludewig; Volker Thiel
Journal:  J Virol       Date:  2008-10-15       Impact factor: 5.103

3.  Chicken galectin-1B inhibits Newcastle disease virus adsorption and replication through binding to hemagglutinin-neuraminidase (HN) glycoprotein.

Authors:  Junfeng Sun; Zongxi Han; Tianming Qi; Ran Zhao; Shengwang Liu
Journal:  J Biol Chem       Date:  2017-10-04       Impact factor: 5.157

4.  Identification of a trypsin-like serine proteinase domain encoded by ORF 1a of the coronavirus IBV.

Authors:  D X Liu; I Brierley; T D Brown
Journal:  Adv Exp Med Biol       Date:  1995       Impact factor: 2.622

5.  Characterization of cellular furin content as a potential factor determining the susceptibility of cultured human and animal cells to coronavirus infectious bronchitis virus infection.

Authors:  Felicia P L Tay; Mei Huang; Li Wang; Yoshiyuki Yamada; Ding Xiang Liu
Journal:  Virology       Date:  2012-09-18       Impact factor: 3.616

6.  An arginine-to-proline mutation in a domain with undefined functions within the helicase protein (Nsp13) is lethal to the coronavirus infectious bronchitis virus in cultured cells.

Authors:  Shouguo Fang; Bo Chen; Felicia P L Tay; Beng Sern Ng; Ding Xing Liu
Journal:  Virology       Date:  2006-09-18       Impact factor: 3.616

7.  Serotype shift of a 793/B genotype infectious bronchitis coronavirus by natural recombination.

Authors:  Tingting Zhang; Zongxi Han; Qianqian Xu; Qiuling Wang; Mengying Gao; Wei Wu; Yuhao Shao; Huixin Li; Xiangang Kong; Shengwang Liu
Journal:  Infect Genet Evol       Date:  2015-04-03       Impact factor: 3.342

8.  Evidence for a coiled-coil structure in the spike proteins of coronaviruses.

Authors:  R J de Groot; W Luytjes; M C Horzinek; B A van der Zeijst; W J Spaan; J A Lenstra
Journal:  J Mol Biol       Date:  1987-08-20       Impact factor: 5.469

9.  Antigenicity of the peplomer protein of infectious bronchitis virus.

Authors:  J A Lenstra; J G Kusters; G Koch; B A van der Zeijst
Journal:  Mol Immunol       Date:  1989-01       Impact factor: 4.407

10.  Australian infectious bronchitis viruses: identification of nine subtypes by a neutralisation test.

Authors:  C N Wadey; J T Faragher
Journal:  Res Vet Sci       Date:  1981-01       Impact factor: 2.534

View more
  12 in total

1.  Molecular characterization of the S1 gene in GI-17 and GI-13 type isolates of avian infectious bronchitis virus (IBV) in Costa Rica, from 2016 to 2019.

Authors:  Ricardo A Villalobos-Agüero; Bernal León; Rebeca Zamora-Sanabria; James Karkashian-Córdoba
Journal:  Virusdisease       Date:  2022-03-26

2.  Recombinant infectious bronchitis coronavirus H120 with the spike protein S1 gene of the nephropathogenic IBYZ strain remains attenuated but induces protective immunity.

Authors:  Yi Jiang; Xu Cheng; Xiumei Zhao; Yan Yu; Mingyan Gao; Sheng Zhou
Journal:  Vaccine       Date:  2020-02-11       Impact factor: 3.641

3.  Successful establishment of a reverse genetic system for QX-type infectious bronchitis virus and technical improvement of the rescue procedure.

Authors:  Ye Zhao; Jinlong Cheng; Gang Xu; Volker Thiel; Guozhong Zhang
Journal:  Virus Res       Date:  2019-08-17       Impact factor: 3.303

4.  A recombinant infectious bronchitis virus from a chicken with a spike gene closely related to that of a turkey coronavirus.

Authors:  Yan Wang; Xuejiao Cui; Xu Chen; Shixing Yang; Yu Ling; Qianben Song; Su Zhu; Luying Sun; Chuang Li; Yu Li; Xutao Deng; Eric Delwart; Wen Zhang
Journal:  Arch Virol       Date:  2020-01-25       Impact factor: 2.574

5.  Antigenic and Pathogenic Characteristics of QX-Type Avian Infectious Bronchitis Virus Strains Isolated in Southwestern China.

Authors:  Shuyun Li; Lijing Du; Jing Xia; Jiteng Du; Guojin You; Yiping Wen; Xiaobo Huang; Qing Zhao; Xinfeng Han; Qigui Yan; Rui Wu; Min Cui; Sanjie Cao; Yong Huang
Journal:  Viruses       Date:  2019-12-13       Impact factor: 5.048

6.  Genetic and pathogenic characterization of a novel recombinant avian infectious bronchitis virus derived from GI-1, GI-13, GI-28, and GI-19 strains in Southwestern China.

Authors:  Wenjun Yan; Rongbin Qiu; Fuyan Wang; Xue Fu; Hao Li; Pengfei Cui; Yaru Zhai; Chun Li; Lan Zhang; Kui Gu; Lei Zuo; Changwei Lei; Hongning Wang; Xin Yang
Journal:  Poult Sci       Date:  2021-04-29       Impact factor: 3.352

7.  Genetic and Pathogenic Characterization of QX(GI-19)-Recombinant Infectious Bronchitis Viruses in South Korea.

Authors:  So-Youn Youn; Ji-Youn Lee; You-Chan Bae; Yong-Kuk Kwon; Hye-Ryoung Kim
Journal:  Viruses       Date:  2021-06-17       Impact factor: 5.048

8.  Genetic sequence changes related to the attenuation of avian infectious bronchitis virus strain TW2575/98.

Authors:  Cheng-Ta Tsai; Hung-Yi Wu; Ching-Ho Wang
Journal:  Virus Genes       Date:  2020-03-30       Impact factor: 2.332

9.  Genetic and biological characteristics of four novel recombinant avian infectious bronchitis viruses isolated in China.

Authors:  Liwen Xu; Mengting Ren; Jie Sheng; Tianxin Ma; Zongxi Han; Yan Zhao; Junfeng Sun; Shengwang Liu
Journal:  Virus Res       Date:  2019-01-11       Impact factor: 3.303

10.  Replicase 1a gene plays a critical role in pathogenesis of avian coronavirus infectious bronchitis virus.

Authors:  Jing Zhao; Keran Zhang; Jinlong Cheng; Wenfeng Jia; Ye Zhao; Guozhong Zhang
Journal:  Virology       Date:  2020-08-20       Impact factor: 3.616

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.