Literature DB >> 29403929

Quality evaluation of synthetic quorum sensing peptides used in R&D.

Frederick Verbeke1, Evelien Wynendaele1, Sarah Braet1, Matthias D'Hondt1, Bart De Spiegeleer1.   

Abstract

Peptides are becoming an important class of molecules in the pharmaceutical field. Closely related peptide-impurities in peptides are inherent to the synthesis approach and have demonstrated to potentially mask biomedical experimental results. Quorum sensing peptides are attracting high interest in R&D and therefore a representative set of quorum sensing peptides, with a requested purity of at least 95.0%, was evaluated for their purity and nature of related impurities. In-house quality control (QC) revealed a large discrepancy between the purity levels as stated on the supplier׳s certificate of analysis and our QC results. By using our QC analysis flowchart, we demonstrated that only 44.0% of the peptides met the required purity. The main compound of one sample was even found to have a different structure compared to the desired peptide. We also found that the majority of the related impurities were lacking amino acid(s) in the desired peptide sequence. Relying on the certificates of analysis as provided by the supplier might have serious consequences for peptide research, and peptide-researchers should implement and maintain a thorough in-house QC.

Entities:  

Keywords:  Impurity profiling; Quality; Quorum sensing peptides

Year:  2015        PMID: 29403929      PMCID: PMC5762210          DOI: 10.1016/j.jpha.2014.12.002

Source DB:  PubMed          Journal:  J Pharm Anal        ISSN: 2214-0883


Introduction

Peptides are becoming an important class of molecules in the biomedical and pharmaceutical fields owing to their high affinity, strong selectivity for their targets and low toxicity [1]. Despite potential limitations such as overall low oral bio-availability, low metabolic resistance, potential immunogenicity, poor membrane permeability and financial aspects, several peptide drugs have entered the market [2], [3]. The promising future of peptide therapeutics is further highlighted by the number of peptides in clinical and preclinical phases [4]. In 2012, approximately 200 peptides entered the clinical phase, while another 400 were at advanced preclinical stages [4], [5], [6]. Quorum sensing peptides are a group of peptides currently attracting high interest. Quorum sensing, the process of cell-to-cell communication between bacteria, has been the subject of a great number of scientific research papers [7], [8], [9]. Three main groups of quorum sensing molecules can be distinguished: N-acylhomoserine lactone derivatives (AHL or auto-inducer-1), quorum sensing peptides and boron-furan derivatives (auto-inducer-2). The quorum sensing peptides, mainly found in Gram-positive bacteria, show a large structural diversity: short, linear fragments as well as cyclic (thiolacton) derivatives, with or without post-translational isoprenyl modifications, are observed [10]. These peptides bind to (i) bacterial membrane associated receptors, or (ii) cytoplasmatic receptors, after which the transcription of the target genes is activated. Interfering with this bacterial quorum sensing pathway might open interesting application perspectives. Chemical peptide synthesis for medicinal purposes has become economically viable [11]. The possibility to produce small, medium (5–20 residues) to large (20–50 residues) peptides has evolved dramatically, hereby frequently outperforming the biotechnological approaches as they are known to date [6]. In 1965, Merrifield cleared the way for Solid-Phase Peptide Synthesis (SPPS), thus introducing and facilitating a totally new concept in peptide synthesis [12]: a peptidic chain, fixed to a solid support, is created by the consecutive addition of the appropriate amino acids. The reaction can be automated and possible solubilization-issues are avoided due to the fixation of the peptide to the solid matrix [13]. During SPPS, different side-reactions can occur, resulting in several types of peptide impurities [14]: e.g. (i) diketopiperazine structures [15], [16], (ii) aspartimide residues [17], [18], [19], (iii) cysteine racemization [16], (iv) diastereoisomeric products [20], [21], (v) dimers [22], (vi) acid precursors and protected sequences [20], (vii) oxidation and reduction of amino acids [19], [23], (viii) amino acid deletions [15], [23], [24], [25], [26], (ix) amino acid insertions [23], [24], (x) products of side chain reactivity and (xi) amino acid modifications during cleavage [16], [19], [23], [24], [26], [27], [28], [29], [30]. Thus, the crude peptides obtained from SPPS mostly will contain many by-products. These impurities, if present even after purification, have to be quantified and characterized to meet pharmaceutical regulatory requirements, but they need to be under control as well during the unregulated biomedical research and discovery phases [31], [32]. Due to budgetary constraints, peptides used in research are often purchased at undefined or low purity levels, e.g. 70.0% [31]. Generally, the peptide purity used for biomedical research and discovery purposes ranges from as low as 50.0% to more than 95.0% [22], [26]. However, closely related impurities of the target peptide may possess stronger binding affinities compared to the native peptide [26], thus potentially causing erroneous conclusions. Investigations by de Beukelaar et al. [33] indicated different immune responses of a protein-spanning peptide pool of 70.0% pure peptides due to the impurities. False-positive results in a HIV-vaccine trial were also ascribed to impurities in the peptide-mixtures [34]. Zhang et al. [35] were unable to reproduce their initial obestatin results in vitro, possibly due to impurities present in the initially examined peptide. Additionally, Verbeken et al. [31] observed different biofunctional responses in a set of tissue-organ bath experiments caused by impurities of the examined peptides. Impurities are thus able to potentially mask biomedical experimental outcomes and may cause false negative or positive results. Quorum sensing peptides are currently being actively investigated, i.e. for their possible role in the crosstalk between the microbiome and its host [36], [37]. Therefore, a thorough in-house QC analysis of a selected set of quorum sensing peptides will be conducted, followed by identification of the observed impurities. These data not only demonstrate the need for routine QC in peptide research, but also can help in building a global overview of expected related impurities in peptides.

Materials and methods

Chemicals and reagents

A set of 98 representative peptides was selected from the Quorumpeps database [38]. Linear peptide synthesis was conducted by an international supplier, while another supplier synthesized the cyclic peptides, both by means of Fmoc-SPPS. A minimal purity of 95.0% was requested at order. The sequences of the 98 peptides are provided in Table 1. Acetonitrile of HPLC–MS and UPLC-MS grades were purchased from Fisher Scientific (Aalst, Belgium). Formic acid (LC–MS grade) and DMSO (p.a.≥99.9%) were obtained from Sigma-Aldrich (Diegem, Belgium). Trifluoroacetic acid (TFA), NaH2PO4·H20 and Na2HPO4 were purchased from Merck (Overijse, Belgium). Water was purified using an Arium 611 purification system (Sartorius, Gottingen, Germany) yielding≥18.2 MΩ cm quality water. Eppendorf Protein LoBind 2.0 and 1.5 mL tubes were purchased from Eppendorf (Nijmegen, the Netherlands). UPLC/HPLC vials and inserts were purchased from Waters (Milford, MA, USA). The Vydac Everest C18 (250 mm×4.6 mm, 5 µm) column and Alltech Prevail Organic Acid column (250 mm×4.6 mm, 5 µm), both protected with guard columns, were obtained from Grace (Deerfield, IL, USA). The Acquity UPLC BEH300 C18 column (100 mm×2.1 mm, 1.7 µm) with guard column was purchased from Waters (Milford, MA, USA).
Table 1

Peptides information.

Quorumpeps IDSequenceMolecular weightSolventColumnaPurity (%)b
2FNTIPSY839.95WaterC18-FA83.31
5Ac-CGSLF, thiolacton linkage between C1 and F5549.72Water+50% DMSOC18-FA88.30
7FNTWPSY913.00WaterC18-FA98.46
10ADLPFEF837.93WaterC18-FA99.20
11AGTKPQGKPASNLVECVFSLFKKCN2667.14WaterC18-FA72.93
13AIFILAS733.91Water+58% DMSOC18-FA97.82
14AITLIFI790.01Water+60% DMSOC18-FA72.48
15AKDEH598.61WaterC18-TFA69.26
16AKTVQ545.64WaterC18-TFA96.20
17ALILTLVS829.05Water+60% DMSOC18-FA94.43
18ARNQT588.62WaterOrganic Acid92.33
19NNWNN660.64WaterC18-TFA92.66
22CVGIW, thiolacton linkage between C1 and W5558.78Water+50% DMSOC18-FA60.39
24CTFTLPGGGGVCTLTSECIC1962.3Water+1% DMSOC18-FA12.21
25CVFSLFKKCN1188.47WaterC18-FA47.92
28DIRHRINNSIWRDIFLKRK2480.91WaterC18-FA93.68
30DLRGVPNPWGWIFGR1770.03WaterC18-FA91.62
31DLRNIFLKIKFKKK1791.26WaterC18-FA76.74
32DMCNGYF, thiolacton linkage between C3 and F7831.04Water+50% DMSOC18-FA58.05
34DRVGA516.55WaterC18-TFA98.30
40DSVCASYF, thiolacton linkage between C4 and F8873.06Water+50% DMSOC18-FA31.61
42DWRFLNSIRDLIFPKRK2204.61WaterC18-FA97.86
44EKMIG576.71WaterC18-FA99.41
45EMRISRIILDFLFLRKK2178.71WaterC18-FA81.91
46EMRKSNNNFFHFLRRI2109.44WaterC18-FA96.43
47EMRLPKILRDFIFPRKK2187.72WaterC18-FA98.46
49EQLSFTSIGILQLLTIGTRSCWFFYCRY3346.92Water+17% DMSOC18-FA52.58
50ERGMT592.67WaterC18-TFA98.76
51ERNNT632.63WaterOrganic Acid98.24
52ERPVG556.62WaterC18-TFA99.75
53ESRLPKILLDFLFLRKK2116.62WaterC18-FA65.11
54ESRLPKIRFDFIFPRKK2177.62WaterC18-FA99.30
55ESRVSRIILDFLFQRKK2135.54WaterC18-FA96.90
56VNYGNGVSCSKTKCSVNWGQAFQERYTAGINSFVSGVASGAGSIGRRP4969.46WaterC18-FA33.57
58DSRIRMGFDFSKLFGK1904.22WaterC18-FA95.72
62ESRISDILLDFLFQRKK2108.47WaterC18-FA99.27
71QNCPNIFGQWM, lacton linkage between S3 and M111319.70Water+50% DMSOC18-FA77.64
75SINSQIGKATSNLVECVFSLFKKCN2731.2WaterC18-FA30.03
76SNLVECVFSLFKKCN1731.06WaterC18-FA80.63
81FNTIPKY881.04WaterC18-FA99.29
82NTIPKY733.87WaterC18-FA69.22
84FFNTCPSY978.09WaterC18-FA96.54
85FNTCPSY830.91WaterC18-FA92.98
92FHWWQTSPAHFS1530.66WaterC18-FA99.54
93FLVMFLSG913.14Water+33% DMSOC18-FA91.31
97QNSPNIFGQWM, lacton linkage between S3 and M111303.63Water+50% DMSOC18-FA43.95
99GKAEF550.61WaterC18-FA99.33
100GKATSSISKCVFSFFKKC1968.36Water+33% DMSOC18-FA28.65
101GLWEDILYSLNIIKHNNTKGLHHPIQL3167.67WaterC18-FA96.92
102GLWEDLLYNINRYAHYIT2254.53Water+33% DMSOC18-FA97.98
103GNWNN603.59WaterC18-FA97.70
105GSQKGVYASQRSFVPSWFRKIFRN2846.25WaterC18-FA99.31
107GVNACSSLF, thiolacton linkage between C5 and F9879.13Water+50% DMSOC18-FA39.15
111GWWEDFLYRFNIIEQKNTKGFYQPIQL3434.91Water+50% DMSOC18-FA89.72
121ILSGAPCIPW1056.29WaterC18-FA77.04
123IRFVT634.78WaterC18-FA99.53
125KSSAYSLQMGATAIKQVKKLFKKWGW2985.59WaterC18-FA66.39
132LFSLVLAG819.01Water+33% DMSOC18-FA96.92
133LFVVTLVG847.06Water+60% DMSOC18-FA97.74
134LPFEF651.76Water+50% DMSOC18-FA17.17
135LPFEH641.72WaterC18-FA94.23
137LVTLVFV790.01Water+50% DMSOC18-FA84.02
138MAGNSSNFIHKIKQIFTHR2229.59Water+17% DMSOC18-FA81.90
140MKAEH614.72WaterC18-FA66.91
143MPFEF669.79WaterC18-FA86.24
146NEVPFEF880.95WaterC18-FA99.90
147NGWNN603.59WaterC18-FA94.53
148YSTCDFIM, thiolacton linkage between C4 and M8961.25Water+50% DMSOC18-FA44.40
151NNGNN531.48WaterC18-TFA96.79
152NNNWNNN888.85WaterC18-FA98.42
153NNWGN603.59WaterC18-FA99.10
154NNWNG603.59WaterC18-FA99.33
155NWN432.44WaterC18-FA98.40
156FNTIP589.69WaterC18-FA99.27
157FNTWP662.75WaterC18-FA99.23
160QKGMY625.74WaterC18-FA99.04
162QRGMI603.74WaterC18-FA94.36
164SDLPFEH843.89WaterC18-FA91.37
165SDMPFEF871.96WaterC18-FA99.44
166SGSLSTFFLLFNRSFTQALGK2321.66WaterC18-FA92.99
174SGSLSTFFRLFNRSFTQALG2236.52WaterC18-FA97.41
176SGSLSTFFRLFNRSFTQALGK2364.69WaterC18-FA98.96
177SGSLSTFFRLFNRSFTQALGKIR2634.04WaterC18-FA55.68
180SGSLSTFFRLFNRSQTQALGK2345.65WaterC18-FA99.06
184SIFTLVA749.90Water+33% DMSOC18-FA93.17
186SKDYN625.64WaterC18-TFA92.88
188SLSTFFRLFNFSFTQALG2083.37Water+33% DMSOC18-FA85.61
191SRKAT561.64WaterC18-TFA78.31
192SRNAT547.57WaterOrganic Acid81.74
193SRNVT575.62WaterC18-TFA81.49
206SYPGWSW881.94WaterC18-FA99.45
207TAGPAIRASVKQCQKTLKATRLFTVSCKGKNGCK3595.31WaterC18-FA32.42
208TNRNYGKPNKDIGTCIWSGFRHC2668.01WaterC18-FA89.19
210VAVLVLGA740.94Water+33% DMSOC18-FA92.98
212VPFEF637.73WaterC18-FA97.65
214WPFAHWPWQYPR1670.89WaterC18-FA58.94
215FNTWPKY954.10WaterC18-FA95.52
218YNPCSNYL, thiolacton linkage between C4 and L8955.18Water+50% DMSOC18-FA16.87

C18-FA: acquity UPLC BEH 300 C18 column (100 mm×2.1 mm, 1.7 µm). C18-TFA: Vydac Everest C18 column (250 mm×4.6 mm, 5 µm). Organic acid: Grace Alltech Prevail Organic Acid column (250 mm×4.6 mm, 5 µm).

Purity assigned based on UV chromatogram with internal normalization to the most abundant peak.

Peptides information. C18-FA: acquity UPLC BEH 300 C18 column (100 mm×2.1 mm, 1.7 µm). C18-TFA: Vydac Everest C18 column (250 mm×4.6 mm, 5 µm). Organic acid: Grace Alltech Prevail Organic Acid column (250 mm×4.6 mm, 5 µm). Purity assigned based on UV chromatogram with internal normalization to the most abundant peak.

Sample preparation

0.5–1 mg of each lyophilized, linear peptide was dissolved in water or a mixture of water and DMSO, depending on the calculated log P values and the solubility in water, to obtain a concentration of approximately 1.0 mg/mL (Table 1). The quantity of DMSO used was determined experimentally, by adding DMSO stepwise to the peptide-water suspension until no more precipitate was observed. The dissolved peptides were stored at −35 °C. The cyclic peptides (i.e. ID5, 22, 32, 40, 71, 97, 107, 148 and 218) were dissolved in DMSO-water (50/50, V/V) to obtain a concentration of approximately 0.5 mg/mL.

HPLC and UPLC

QC purity profiling

Three LC systems were consecutively applied in the analysis. To avoid carry-over peaks, 50% acetonitrile in water was always used as needle wash. Each peptide was first analyzed with the Acquity UPLC BEH300 C18 column. Sample compartment was kept at 5 °C (± 2 °C) and column was maintained at 30 °C (±2 °C). Injection volume was set at 2 µL for the linear and 5 µL for the cyclic peptides. Mobile phases consisted of 0.1% (m/V) formic acid in water (A) and 0.1% (m/V) formic acid in acetonitrile (B). A general linear gradient was applied running from 95% A to 20% A during 22 min, followed by returning to initial condition and re-equilibration with a flow rate set at 0.5 mL/min. Analysis was conducted using a Waters Acquity UPLC Class BioQuaternary Solvent Manager, a Waters Acquity Bio-sample Manager, combined with a Flow Through Needle and a Waters Acquity UPLC PDA (500 nL to 10 mm path length analytical flow cell) detector (Waters, Milford, MA, USA). Empower™ 2 software was employed for data acquisition and analysis. Peptides and related impurities were quantified by area-normalization at 210 nm, using a sampling rate of 20 points/s and a detector time constant of 0.1 s. A reporting threshold (i.e. 0.1% of main peak AUC in the UV chromatogram) and identification threshold (i.e. 0.5% of main peak AUC in the UV chromatogram) as stated in the European Pharmacopoeia were applied [39]. Solvent and system peaks, observed in the blank (i.e. the solvent used to dissolve a certain peptide, Table 1), were excluded. If no retention of the peptides was observed using the Acquity UPLC BEH300 C18 column, peptides were analyzed with the Vydac Everest C18 column on a Waters Alliance 2695 HPLC apparatus equipped with a Waters 2695 Separations Module, combined with a Flow Through Needle, and a Waters 2996 Photodiode Array Detector with Empower™ 2 software for data acquisition. Mobile phases consisted of 0.1% (m/V) TFA in water (A) and 0.1% (m/V) TFA in acetonitrile (B). A general linear gradient was applied running from 95% A to 20% A during 30 min, followed by returning to initial condition and re-equilibration with a flow rate set at 1.0 mL/min. For peptide ID191, a slightly modified linear gradient was applied, i.e. running from 98% A to 80% A during 10 min, followed by returning to initial conditions and re-equilibration with a flow rate set at 1.0 mL/min. Sample compartment was kept at 5 °C (±2 °C) and column was maintained at 30 °C (±2 °C); 20 µL of the samples dissolved in suitable solvent composition were injected. UV detection was performed at 215 nm using a sample rate of 1.0 point/s combined with a detector time constant of 0.2 s. The flow rate was set to 1.0 mL/min. The peptide purity was quantified through normalization by calculating the area (UV) of the most abundant peak as a percentage of total peak areas. Finally, peptides ID18, 51 and 192 were analyzed using a Grace Alltech Prevail Organic Acid column (250 mm×4.6 mm, 5 µm), using the same Waters Alliance 2695 HPLC equipment as used with the Vydac column. Mobile phases consisted of 10 mM phosphate buffer (pH 7) (A) and acetonitrile (B). A general linear gradient was applied running from 95% A to 60% A during 20 min, followed by returning to initial condition and re-equilibration with a flow rate set at 1.0 mL/min. Sample compartment was kept at 5 °C (±2 °C) and column maintained at 30 °C (±2 °C). 20 µL of the samples dissolved in suitable solvent composition were injected. UV detection was performed at 215 nm, using a sample rate of 1.0 point/s combined with a detector time constant of 0.2 s. The peptide purity was quantified through normalization by calculating the area (UV) of the most abundant peak as a percentage of total peak areas.

Identification of main LC peak and related impurities

Mass spectroscopic characterization was performed with a Thermo HPLC system consisting of a Waters 2487 dual λ absorbance UV/VIS-detector (UV at 215 nm), a Finnigan LCQ ion trap mass spectrometer with electrospray ionization (ESI) and Xcalibur™ software version 2.0 for data acquisition. The LC–MS equipment is yearly qualified using a tune solution and qualification solution according to the EDQM guideline [40]. The tune solution consists of 100 µL 1.0 mg/mL caffeine (Sigma-Aldrich, Diegem, Belgium) in methanol, 15 µL 5 nmol/µL MRFA (Met-Arg-Phe-Ala) (Research Plus Inc., Atlantic City, NJ, USA) in 50/50 methanol/water (V/V), 2.5 mL 0.1% (V/V) Ultramark 1621 (Alfa Aesar, Karlsruhe, Germany) in acetonitrile, 50 µL glacial acetic acid (Riedel de Haen, Diegem, Belgium) and 2.34 mL of 50/50 methanol/water (V/V). The EDQM qualification solution consists of a 10.0 µg/mL reserpine (Flandria, Ghent, Belgium) solution in acidified methanol (i.e. 1% acetic acid in methanol (V/V)). The reserpine solution is infused in the mass spectrometer with a flow rate of 3 µL/min with a collision energy of 35.00 eV. The m/z value of 609.4 is selected as parent ion and the m/z range for the daughter ions is set to m/z 165.0-800.0. The obtained m/z values are compared with the acceptance criteria as set by the EDQM. For the analysis of the quorum sensing peptides, column temperature was set at 30 °C (±2 °C) and samples were kept at room temperature. 20 µL of aqueous peptide solution was injected into the HPLC system and a flow rate of 1.0 mL/min was applied. All 15 selected quorum sensing peptides were analyzed using the Vydac Everest C18 column (250 mm×4.6 mm, 5 µm). Mobile phases consisted of 0.1% (m/V) formic acid in water (A) and 0.1% (m/V) formic acid in acetonitrile (B) with a flow rate of 1.00 mL/min. An isocratic period consisting of 95% A during 5 min was maintained, followed by a linear gradient running from 95% A to 40% A in 60 min and returning to the initial conditions and re-equilibration afterwards. The ion transfer capillary was operated at 250 °C, nitrogen was used as sheath gas (80 arbitrary units corresponding to 1.2 L/min) and helium as auxiliary gas (20 arbitrary units corresponding to 0.2 L/min). The spray voltage was 4.50 kV and the capillary voltage was 46 V. MS1 (100–2000 m/z) and MS2 (data dependent, i.e. highest abundant MS1 m/z value for MS2) data were obtained. All m/z values possessing an abundance higher than 25% in the according MS1 spectrum were subject to identification via their respective MS2 fragmentation pattern. Theoretical MS2 fragmentation patterns of the peptides were calculated in silico with ProteinProspector [41] (University of California, San Francisco, CA, USA). The proposed sequences of the related impurities were confirmed using the ProteinProspector generated MS2 spectra. The nomenclature originally proposed by Roepstorff and Fohlman [42] was used to annotate MS2 fragments.

Results and discussion

Quorum sensing peptide analysis flow chart

To determine the purity of the quorum sensing peptides, we developed a UPLC/HPLC-analysis flow chart (Fig. 1). Each peptide was analyzed first with the Acquity UPLC BEH300 C18 column, using the method described above. A C18 column with a 0.1% (m/V) formic acid in water/acetonitrile gradient is widely used for peptide analysis and was therefore selected as the initial method of analysis. If no retention of the peptides was observed, the peptides were analyzed with the Vydac Everest C18 column with TFA as ion-pairing reagent, which is known to have a narrowing effect on peak width and an increased retention. Finally, if no retention was observed with the aforementioned columns, the Prevail Organic Acid column (mobile phase of pH 7) with a 10 mM phosphate buffered water/acetonitrile gradient was used for peptide quality control. Previous experience indicated that peptides which had no retention using standard C18 peptide columns might have appropriate retention using a polar-embedded column for highly hydrophilic compounds, like the Prevail Organic Acid column.
Fig. 1

(U)HPLC column flow chart for quorum sensing peptides analysis.

(U)HPLC column flow chart for quorum sensing peptides analysis.

QC purity assay

Despite a requested purity of at least 95.0%, only 43 out of 98 peptides met these purity specifications (Fig. 2). However, all the 98 peptides were accompanied by a certificate of analysis stating at least 95.0% purity. Our QC analysis upon arrival showed purity levels sometimes far below the demanded purity level (Table 1). In Fig. 3, the chromatogram of ID76, as provided by the supplier on the certificate of analysis versus our QC analysis, is given. The mobile phases of the supplier consisted of 0.1% (m/V) TFA in acetonitrile (A) and 0.1% (m/V) TFA in water (B). A general linear gradient was applied running from 22% A to 47% A during 22 min with a Kromasil C18-5 (250 mm×4.6 mm, 5 µm) column with quantification at 220 nm. The peptide was analyzed in our laboratory with the Acquity UPLC BEH300 C18 column, using the operational details as described above.
Fig. 2

Purity levels of quorum sensing peptides determined by in-house QC.

Fig. 3

The in-house QC control shows a distinct difference in peptide purity. (A) Chromatogram of supplier; Kromasil C18-5 (250 mm×4.6 mm, 5 µm), quantification at 220 nm; (B) chromatogram of in-house QC; Vydac Everest C18 column (250 mm×4.6 mm, 5 µm), quantification at 210 nm.

Purity levels of quorum sensing peptides determined by in-house QC. The in-house QC control shows a distinct difference in peptide purity. (A) Chromatogram of supplier; Kromasil C18-5 (250 mm×4.6 mm, 5 µm), quantification at 220 nm; (B) chromatogram of in-house QC; Vydac Everest C18 column (250 mm×4.6 mm, 5 µm), quantification at 210 nm. The method applied by the supplier clearly lacked selectivity to determine the purity level of the peptide. We demonstrated the necessity of a reliable QC method, i.e. the need of a suitable chromatographic system to analyze peptide purity. The supplier claimed ≥95.0% purity using its system, where we determined a purity level of 80.6%. Especially the cyclic peptides (n=9) were characterized by low purity levels: none of the peptides had a purity exceeding 90.0%. Of all cyclic peptides, 1 peptide had a purity between 80.0% and 90.0%, whereas the other 8 had purity levels below 80.0%. Nevertheless, each of these peptides was accompanied by a certificate of analysis stating a purity of at least 95.0%. After communication with the suppliers, they revealed that they were unable to produce these cyclic peptides at the requested purity level.

Identification of related impurities

A set of 15 peptides with varying purities was selected to determine the identity of the impurities (Table 1, depicted in red). The main peak was characterized as the desired peptide for 14 out of 15 peptides. The main peak from peptide ID25 was not the requested amino acid sequence. Instead of CVFSLFKKCN, a peptide with a mass difference of −2.1 Da compared with the requested peptide sequence was noted. Therefore, the formation of a disulfide bond (and thus cyclisation) between C1 and C9 is suggested. Because sulfur-containing amino acids are prone to oxidation [43], a spontaneous cyclisation is suspected for this peptide (Fig. 4).
Fig. 4

TIC and UV chromatogram (A), MS1 (B) and MS2 (C) spectra of the related impurity C1VFSLFKKC9N (disulfide bond between C1 and C9) of peptide ID25 at a retention time of 23.47 min with appointed isotopic mass patterns and b- and y-fragmentation are allocated.

TIC and UV chromatogram (A), MS1 (B) and MS2 (C) spectra of the related impurity C1VFSLFKKC9N (disulfide bond between C1 and C9) of peptide ID25 at a retention time of 23.47 min with appointed isotopic mass patterns and b- and y-fragmentation are allocated. The MS1 spectrum of a related peptide impurity of peptide ID134 (retention time of 29.75 min) showed an impurity with a monoisotopic mass of 666.22 Da (Fig. 5). The difference with the monoisotopic mass of the requested peptide sequence (LPFEF) amounted to 14.04 Da, a mass difference that could be associated with the addition of a methyl group. The MS2 fragmentation pattern of the related peptide impurity (Fig. 5C) showed a difference of +14 Da with the requested peptide sequence fragmentation pattern at b4, y2-H2O, y4, MH-H20, while the b3 fragment of requested peptide and related impurity were the same, thus suggesting the addition of a methyl group to Glu4.
Fig. 5

TIC and UV chromatogram (A), MS1 (B) and MS2 (C) spectra of the related impurity LPFE(methyl)F of peptide ID134 at a retention time of 29.75 min with appointed isotopic mass patterns and b- and y-fragment allocation.

TIC and UV chromatogram (A), MS1 (B) and MS2 (C) spectra of the related impurity LPFE(methyl)F of peptide ID134 at a retention time of 29.75 min with appointed isotopic mass patterns and b- and y-fragment allocation. A related impurity of peptide ID82 (retention time 9.34 min) possessed an m/z value of 621.14 (Fig. 6). Compared with the desired peptide, i.e. NTIPKY, there was a mass difference of 114.02 Da, a mass difference which could be bridged by the deletion of Asn1. The suggested sequence TIPKY was confirmed by the MS2 spectrum in Fig. 6C. On the other hand, we also demonstrated a related impurity characterized by the incorporation of an additional amino acid at the C-terminus of peptide ID121 (retention time 35.70 min) (Fig. 7). The MS2 spectrum (Fig. 7C) confirmed the addition of an extra Trp residue at the C-terminus of peptide ID121, thus resulting in the related impurity ILSGAPCIPWW. Another example of a related peptide impurity was the combination of both deleted and additionally inserted amino acids in the desired peptide sequence. In Fig. 8, such an example is given: ILSGAPCIPPPP is a related impurity of peptide ID121 and lacks the C-terminal Trp residue, but is characterized by 3 additional Pro residues at the C-terminus.
Fig. 6

TIC and UV chromatogram (A), MS1 (B) and MS2 (C) spectra of the related impurity TIPKY of peptide ID82 at a retention time of 9.59 min with appointed isotopic mass patterns and b- and y-fragment allocation.

Fig. 7

TIC and UV chromatogram (A), MS1 (B) and MS2 (C) spectra of the related impurity ILSGAPCIPWW of peptide ID121 at a retention time of 35.70 min with appointed isotopic mass patterns and b- and y-fragment allocation.

Fig. 8

TIC and UV chromatogram (A), MS1 (B) and MS2 (C) spectra of the related impurity ILSGAPCIPPPP of peptide ID121 at a retention time of 33.55 min with appointed isotopic mass patterns and b- and y-fragment allocation.

TIC and UV chromatogram (A), MS1 (B) and MS2 (C) spectra of the related impurity TIPKY of peptide ID82 at a retention time of 9.59 min with appointed isotopic mass patterns and b- and y-fragment allocation. TIC and UV chromatogram (A), MS1 (B) and MS2 (C) spectra of the related impurity ILSGAPCIPWW of peptide ID121 at a retention time of 35.70 min with appointed isotopic mass patterns and b- and y-fragment allocation. TIC and UV chromatogram (A), MS1 (B) and MS2 (C) spectra of the related impurity ILSGAPCIPPPP of peptide ID121 at a retention time of 33.55 min with appointed isotopic mass patterns and b- and y-fragment allocation. In total, 84 impurities (Table 2) were observed and 73% could be assigned a structure related to the requested peptide by means of MS2. Analysis of these identified impurities revealed a high abundance of impurities with at least one deletion (i.e. in 74% of all identified impurities is involved) (Fig. 9). Inappropriate deletion of blocking groups during synthesis results in such sequences, thereby lacking at least 1 amino acid [20], [44]. A minority of the observed peptide impurities were characterized by the incorporation of additional amino acids. During synthesis, an excess of amino acid equivalents used to assure a maximum coupling efficiency might result in the incorporation of additional amino acids [20], [45]. Impurities can also be a combination of alteration types, e.g. one or more desired amino acid(s) might be missing at the N-terminus whilst at the C-terminus additional amino acid(s) are incorporated.
Table 2

Overview of the observed peptides (blue) and impurities (purple).

1Purity assigned based on UV chromatogram with internal normalization to the most abundant peak.

2The peptide C1VFSLFKKC9N (disulfide bond between C1 and C9) was the most abundant peak and was not the desired sequence.

3Structural deviations are defined as follows: (a) Chemical modifications of an amino acid are depicted in between brackets following the modified amino acid; (b) X signals a “semi-identified” impurity with already part of the peptide sequence allocated in the MS2 fragmentation pattern.

4Solely observed in UV spectrum, no signal in TIC.

Fig. 9

Types of related peptide impurities found in the 61 experimentally determined sequences.

Types of related peptide impurities found in the 61 experimentally determined sequences. Overview of the observed peptides (blue) and impurities (purple). 1Purity assigned based on UV chromatogram with internal normalization to the most abundant peak. 2The peptide C1VFSLFKKC9N (disulfide bond between C1 and C9) was the most abundant peak and was not the desired sequence. 3Structural deviations are defined as follows: (a) Chemical modifications of an amino acid are depicted in between brackets following the modified amino acid; (b) X signals a “semi-identified” impurity with already part of the peptide sequence allocated in the MS2 fragmentation pattern. 4Solely observed in UV spectrum, no signal in TIC.

Conclusions

In conclusion, “purified” synthetic peptides still contain a considerable amount and wide variety of related impurities, with peptides missing amino acid(s) being the most prominent. As a consequence, a thorough in-house quality characterization of peptides, already used in basic biomedical research, is mandatory. Remarkably, there is a large discrepancy between the certificates of analysis provided by the suppliers and the in-house quality control, which can at least partly be explained by the methods used. Finally, researchers should also be aware that the main peak observed in the chromatogram might be an impurity instead of the requested peptide; hence MS is requested in this QC.
  28 in total

1.  The influence of peptide impurity profiles on functional tissue-organ bath response: the 11-mer peptide INSL6[151-161] case.

Authors:  Mathieu Verbeken; Evelien Wynendaele; Romain A Lefebvre; Els Goossens; Bart De Spiegeleer
Journal:  Anal Biochem       Date:  2011-10-06       Impact factor: 3.365

2.  Outlook for the next 5 years in drug innovation.

Authors:  Roy Berggren; Martin Møller; Rachel Moss; Pawel Poda; Katarzyna Smietana
Journal:  Nat Rev Drug Discov       Date:  2012-06-01       Impact factor: 84.694

3.  The impact of impurities in synthetic peptides on the outcome of T-cell stimulation assays.

Authors:  Janet W de Beukelaar; Jan W Gratama; Peter A Sillevis Smitt; Georges M Verjans; Jaco Kraan; Theo M Luider; Peter C Burgers
Journal:  Rapid Commun Mass Spectrom       Date:  2007       Impact factor: 2.419

Review 4.  Inter-kingdom signalling: communication between bacteria and their hosts.

Authors:  David T Hughes; Vanessa Sperandio
Journal:  Nat Rev Microbiol       Date:  2008-02       Impact factor: 60.633

5.  Identification and characterization of impurities of tetracosactide by capillary electrophoresis and liquid chromatography coupled to time-of-flight mass spectrometry.

Authors:  Angelina Taichrib; Gerhard K E Scriba; Christian Neusüss
Journal:  Anal Bioanal Chem       Date:  2011-07-06       Impact factor: 4.142

Review 6.  The future of peptide-based drugs.

Authors:  David J Craik; David P Fairlie; Spiros Liras; David Price
Journal:  Chem Biol Drug Des       Date:  2013-01       Impact factor: 2.817

Review 7.  Related impurities in peptide medicines.

Authors:  Matthias D'Hondt; Nathalie Bracke; Lien Taevernier; Bert Gevaert; Frederick Verbeke; Evelien Wynendaele; Bart De Spiegeleer
Journal:  J Pharm Biomed Anal       Date:  2014-06-13       Impact factor: 3.935

8.  A cleavage method which minimizes side reactions following Fmoc solid phase peptide synthesis.

Authors:  D S King; C G Fields; G B Fields
Journal:  Int J Pept Protein Res       Date:  1990-09

9.  Reduction of Cys36-Cys42 and Cys64-Cys74 disulfide bonds in recombinant human granulocyte colony stimulating factor.

Authors:  J Léon; E Reubsaet; J H Beijnen; W P van Bennekom; A Bult; A J Hoekstra; E Hop; P J van Os; J Teeuwsen; W J Underberg
Journal:  J Pharm Biomed Anal       Date:  1999-05       Impact factor: 3.935

10.  Peptide impurities in commercial synthetic peptides and their implications for vaccine trial assessment.

Authors:  Jeffrey R Currier; Lynee M Galley; Holger Wenschuh; Vivian Morafo; Silvia Ratto-Kim; Clive M Gray; Leonard Maboko; Michael Hoelscher; Mary A Marovich; Josephine H Cox
Journal:  Clin Vaccine Immunol       Date:  2007-12-12
View more
  2 in total

1.  Enfuvirtide biosynthesis in thermostable chaperone-based fusion.

Authors:  Vladimir Zenin; Maria Yurkova; Andrey Tsedilin; Alexey Fedorov
Journal:  Biotechnol Rep (Amst)       Date:  2022-05-14

2.  Quorum Sensing Peptides Selectively Penetrate the Blood-Brain Barrier.

Authors:  Evelien Wynendaele; Frederick Verbeke; Sofie Stalmans; Bert Gevaert; Yorick Janssens; Christophe Van De Wiele; Kathelijne Peremans; Christian Burvenich; Bart De Spiegeleer
Journal:  PLoS One       Date:  2015-11-04       Impact factor: 3.240

  2 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.