Literature DB >> 29373732

Study of Novel Autoantibodies in Schizophrenia.

Ruth Whelan1, David St Clair2, Colette J Mustard1, Philomena Hallford1, Jun Wei1.   

Abstract

A recent genome-wide association (GWA) study confirmed 108 genetic loci that were strongly associated with schizophrenia. Fifteen schizophrenia-associated genes were selected for this study based on a number of selection criteria including their high expression in both brain tissues and B-lymphocyte cells. We aimed to investigate whether individuals with schizophrenia showed different levels of plasma IgG antibodies against protein-derived fragments encoded by these 15 genes. A total of 356 plasma samples were used to analyze circulating IgG antibodies against 18 target peptide antigens using an in-house enzyme-linked immunosorbent assay. Of 18 antigens tested, 6 (derived from DPYD, MAD1L1, ZNF804A, DRD2, TRANK1, and MMP16, respectively) showed increased IgG levels and 3 (derived from TSNARE1, TCF4, and VRK2, respectively) showed decreased IgG levels in patients with schizophrenia compared with control subjects. Receiver operating characteristic (ROC) curve analysis revealed that the anti-TRANK1 IgG assay had the area under the ROC curve of 0.68 (95% CI = 0.62-0.73), with the highest sensitivity of 20.7% against specificity of 95.2% among all 18 tests. There was no difference in positivity of anti-double strand DNA IgG between the patient group and the control group and no correlation between total IgG levels and each individual IgG level tested. Although risperidone treatment showed confounding effects on overall IgG levels in the circulation (combined P = .005), anti-TRANK1 IgG levels did not appear to be significantly affected (t = 1.358, P = .176). In conclusion, this study suggests that circulating anti-TRANK1 IgG is likely to serve as a biomarker for identification of a subgroup of schizophrenia.

Entities:  

Mesh:

Substances:

Year:  2018        PMID: 29373732      PMCID: PMC6192490          DOI: 10.1093/schbul/sbx175

Source DB:  PubMed          Journal:  Schizophr Bull        ISSN: 0586-7614            Impact factor:   9.306


Introduction

The World Health Organization identifies schizophrenia as one of the top 10 causes of disability for both men and women, affecting around 0.7% of the population worldwide.[1] Antipsychotic medication is the first line treatment of schizophrenia but 20%–30% of patients do not have a good response to antipsychotic treatment. Although clozapine can be effective in up to one-third of patients, side effects are severe.[2] A definitive etiology for the development of schizophrenia remains complex and unclear, suggesting that there may be a number of underlying mechanisms involved. The most well-documented biochemical mechanisms are the disturbances of dopamine and glutamate systems, although dysfunction of these neurotransmitter systems cannot account for all cases and psychotic symptoms.[3] Schizophrenia is a highly heritable disease with complex modes of transmission. A recent genome-wide association (GWA) study analyzed more than 30000 case–control samples and confirmed 108 genetic loci significantly associated with risk of the disease.[4] The expression levels of the candidate genes in most loci were found to be the highest in brain tissues and B-lymphocytes (CD20+ and CD19+ cells) over 50 human tissues and cell lines analyzed, supporting the hypothesis that an immunological component is likely to be involved in the development of schizophrenia.[4] Further support of an autoimmune role in schizophrenia is the genetic association for the human leukocyte antigen (HLA) region in the short arm of chromosome 6.[4] Microglia are the resident immune cells in the brain, compromising around 15% of total cells in the central nervous system (CNS).[5] Microglia can be activated either in response to a systemic inflammatory challenge or through the process of priming, whereby different stimuli sensitize the microglia so that a weak stimulus is able to produce an exaggerated immune response.[6] Priming is key in triggering immune and inflammatory responses within the CNS; eg, stress-induced immune activation can lead to some psychotic symptoms.[5] This compliments the theory that infection early in childhood, followed by either re-infection or exposure to new stimuli may induce a release of sensitized cytokines resulting in neurotransmission disturbances.[6] Microglial activation and subsequent cytokine production have the ability to disrupt the blood–brain barrier, thus allowing movement of some inflammatory cytokines and other molecules into the brain.[7] Altered cytokine levels are found in both drug naïve, first-episode psychosis patients and chronically medicated patients, suggesting a problem independent of the effects of antipsychotic medications.[7] The concentrations of some inflammatory molecules may be clinically state-dependent. Inflammatory state-related markers include interleukin 1-beta (IL-1ß), IL-6, transforming growth factor beta (TGF-ß); the concentrations of these molecules are increased during acute psychotic episodes, returning to normal levels during the period of clinical stability.[8] IL-12, interferon-gamma (IFN-γ), and tumor necrosis factor alpha (TNF-α) are inflammatory markers that are elevated in peripheral blood in both stable patients and first-episode psychoses.[8] Degraded products of inflammatory molecules have been identified in the cerebrospinal fluid (CSF) and brain tissues in around 50% of patients with schizophrenia.[9] These observations suggest that there are significant changes in the inflammatory signaling process at least in a subgroup of schizophrenia patients. Gross inflammatory changes have not been found in neuroimaging or neuropathological studies of schizophrenia, but a decrease in brain volume has been observed as early as the first episode of psychosis occurs, followed by progressive loss in brain volume during further development of the disease.[9] Infection during a critical period of brain development may increase risk of developing schizophrenia later in life.[10] Antibodies against different viruses were detected although these findings have been inconsistent across the studies.[11] A recent study reported that 20% of patients with first-episode psychosis carried serum antibodies against neuronal cell surface molecules.[12] Schizophrenia-associated changes in immunoglobulin levels in both plasma and CSF support an immunological role in the pathogenesis of the disease.[11] Benros et al[13] have recently reviewed evidence that pre-existing autoimmune disease might be a risk factor for schizophrenia, according to the link between schizophrenia and coeliac disease, rheumatoid arthritis, and other autoimmune conditions. Goldsmith and Rogers[14] investigated the role of autoimmunity in schizophrenia and found contrasting reports of autoantibody levels, due to heterogeneity between studies and failure to account for the confounding effects of antipsychotic medication. The current study aimed to identify potential autoantigens encoded by selected genes present in schizophrenia-associated loci confirmed in the 2014 GWA study and to explore the association of circulating autoantibodies with schizophrenia.

Methods

Study Samples

A total of 356 archived plasma samples collected from patients with schizophrenia (n = 169, 132 males and 37 females), aged 42.0 ± 13.3 years, and control subjects (n = 187, 125 males and 62 females), aged 44.1 ± 12.8 years, were used to examine circulating antibodies against the linear peptide antigens derived from the target proteins. These case–control samples were collected through the University of Aberdeen in the period between 2003 and 2008, and stored long term at −80°C without thawing until they were aliquoted for antibody testing. Subjects were all classified as British Caucasian including English, Scottish, Welsh, and Irish individuals. All healthy controls had no previous history or current diagnosis of any mental health condition. All patients were diagnosed as having schizophrenia based on the DSM-IV criteria. Antipsychotic drugs prescribed to schizophrenia patients at the time of sampling are listed in supplementary table S1, with 128 patients taking a single antipsychotic drug, 14 taking more than one drug, and 27 without medication details. All control subjects were recruited during the same period from local communities and screened for psychiatric disorders as described previously.[15] All subjects gave written informed consent to donate blood samples for the study of the pathogenesis of schizophrenia. This study was approved by a local ethics committee and conformed to the provisions of the Declaration of Helsinki.

Detection of Antibodies Against Linear Peptide Antigens

Target proteins encoded by the genes harboring or near to the index SNPs confirmed recently were identified from the NCBI protein database (http://www.ncbi.nlm.nih.gov/protein).[4] They were selected based on the following criteria: 1) the genes were highly expressed in both B-lymphocytes and brain tissues based on the BioGPS gene expression database (http://biogps.org), 2) odds ratio (OR) from combined samples should be >1.08 or <0.93 based on the GWA study, and 3) the number of genes present in a schizophrenia-associated locus of interest should be less than 3.[4] A total of 15 proteins were selected in this study, which are encoded by the following genes: NRGN, TCF4, MMP16, ZNF804A, VRK2, CACNA1C, DPYD, SLC39A8, DRD2, TSNARE1, MAD1L1, TRANK1, FANCL, ERCC4, and IGSF9B. supplementary table S2 summarizes their location in the human genome, index SNPs, and physiological function. Linear peptide antigens were designed based on the computational prediction of the HLA-II epitopes and on the epitope information for human disease in the Immune Epitope Database (http://www.iedb.org/). All peptide antigens were synthesized by solid-phase chemistry with a purity of >95% (Severn Biotech Ltd). An in-house enzyme-linked immunosorbent assay (ELISA) was developed in-house with each antigen listed in table 1 to coat maleimide activated 96-well plates (ThermoFisher Scientific) according to the manufacturer’s guidelines. Each peptide antigen was dissolved in 67% acetic acid to a concentration of 5 mg/ml and stored at −20°C. The stock solution of each antigen was then diluted in coating buffer (0.1 M phosphate buffer containing 0.15 M NaCl and 10 mM EDTA, pH 7.2) to a concentration of 20 µg/ml as working solution. Each plate was coated with 100 µl of working solution and incubated overnight at 4°C. Plates were washed 3 times using 200 µl of wash buffer 1 (0.1 M phosphate buffer containing 0.15 M NaCl and 0.05% Tween-20, pH 7.2), and blocked using 10 µg/ml cysteine in coating buffer for 1 h at room temperature. Plates were washed twice with 200 µl of wash buffer 1 and dried at 40°C for 2 h. Plates, once dried, were sealed with sealing film and stored at 4°C until use. Sealing film was removed just before use and the plates were washed twice with 200 µl of wash buffer 2 (phosphate-buffered saline (PBS) containing 0.1% Tween-20), in each well to rehydrate. The plasma sample (including positive control, PC) was diluted 1:150 in assay buffer (PBS containing 0.5% bovine serum albumin) and 50 µl of the sample was loaded into each sample well; 50 µl of assay buffer was added to each negative control (NC) well. Following incubation at room temperature for 90 minutes, the plate was washed 3 times with 200 µl of wash buffer 2 and 50 µl of peroxidase-conjugated goat anti-human IgG Fc (ab98624, Abcam) diluted 1:50000 in assay buffer was then added and incubated for 60 min at room temperature. After incubation the plate was washed 3 times with 200 µl of wash buffer 2, 50 µl of 3,3′,5,5′-tetramethylbenzidine (TMB, SB02, Life Technologies) was added and the plate was incubated in the dark for 20 min before 25 µl of the stop solution was added (SS04, Life Technologies). The optical density (OD) of each well was then measured within 10 min with a plate reader at 450 nm with a reference wavelength of 620 nm. All samples were tested in duplicate and the specific binding ratio (SBR) was calculated for each sample using the following formula:
Table 1.

Sequences of Peptide Antigens Derived From Target Proteins Tested

Antigen NameProtein Coding GeneSequence
DPYD1DPYDDIE SIL ALN PRT QTH ATL CST SAK KLD
CA1CaCACNA1CCKLSWQAAIDAARQAKLMGSAGNATI
ARE1aTSNARE1RCW LQE LFQ EMS ANV FRI NSS VTS LER
SLC39aSLC39A8DFV ILL NAG MST RQA LLF NFL SAC SH
D1L1aMAD1L1LIE VHL RRQ DSI PAF LSS ELF SRC
F804A-1ZNF804AECY YIV ISS THL SNG HFR NIK GVF RGP LID
NRGN-1NRGNCDIPLDDPGANAAAAKIQASFRGHMARKKIK
TCF4aTCF4CLK SDK PQT KLL ILH QAV AVI LSL EQQ VRE
SB2-1TCF4ILH QAV AVI LSL EQQ VRE RNL NPK AAC
VRK2aVRK2CKT ISQ FTL SEE TNA DVY III PVL H
DRD2aDRD2DLC AIS IDR YTA VAM PML YNT RYS SKR
MP16-1MMP16LLTFSTGRRLDFVHHSGVFFLQTLLWILC
MP16-2MMP16DVYTVFQFKRKGTPRHILYCKRSMQEWVD
SB2-2TRANK1CLQ WDP TYV KGV YRA GYS LLR LHQ RYE A
SB2-3TRANK1NIL ILS VRD ARD WLM KTE TRL KKE C
SB2-4FANCLCKS LIS IYS QFL AAI ESL KAF WDV MDH
ERC4aERCC4CQE AFI LRL FRQ KNK RGF IKA FTD NAV D
F9B1IGSF9BVYF QND LKL RVR ILI DGT LTI FRC
Sequences of Peptide Antigens Derived From Target Proteins Tested

Detection of Total IgG Levels and Double Stranded DNA Antibodies

To look at how specific each individual IgG test was in identification of schizophrenia subgroups, all plasma samples were tested for total IgG levels using the human IgG total Ready-SET-Go! ELISA kit (ThermoFisher Scientific) and also for IgG antibodies against double-stranded DNA using the anti-dsDNA-NcX ELISA (IgG) kit (EUROIMMUN UK Ltd).

Data Analysis

Shapiro–Wilk statistic was used to test a normal distribution of the resulting data; 15 of the 18 tests showed significantly skewed distributions in the patient group and 14 in the control group (supplementary table S3). Mann–Whitney U-test was thus used to examine the differences in antibody levels between these 2 groups, and Spearman correlation analysis was applied to test the correlation in circulating levels between individual IgG antibodies tested and the correlation between total IgG levels and each individual IgG level; a P-value of <.003 was considered to be statistically significant as 18 antigens were tested in this study. Linear regression was applied to determine the effects, if any, of the antipsychotic medication on the secretion of circulating antibodies with adjustment for age and sex. In such analysis, IgG levels were used as the dependent variable, and medication, age, and sex were used as the independent variables. Fisher’s combining probability test was applied to determine the combined P-value for each medication on overall antibody levels; a P-value of <.006 was considered to be statistically significant, due to the number of groups tested.[16] Receiver operating characteristic (ROC) curve analysis was carried out on each of the antigens to calculate the area under the ROC curve (AUC) with the in-house ELISA sensitivity against a specificity of ≥95% that was used to determine the cut-off for calculation of the positive predictive value (PPV) and the negative predictive value (NPV). The coefficient of variation (CV) was used to represent an inter-assay deviation estimated using pooled plasma samples, called quality control (QC) sample, which were randomly collected from >20 healthy subjects and tested on every 96-well plate.

Results

The reproducibility of the in-house ELISA test was excellent, with inter-assay deviation below 15% from every IgG assay (supplementary table S4). As shown in table 2, 9 of the 18 antigens tested in this study showed significant differences in plasma IgG levels between the patient group and the control group (P < .003), in which 6 showed an increase in plasma IgG levels including DPYD1 (Z = −3.22, P = .001), D1L1a (Z = −4.05, P < .001), F804A-1 (Z = −3.41, P = .001), DRD2a (Z = −3.31, P = .001), SB2-3 (Z = −5.71, P < .001), and MP16-2 (Z = −3.99, P < .001), and 3 showed a decrease including ARE1a (Z = −6.47, P < .001), TCF4a (Z = −8.70, P < .001) and VRK2a (Z = −3.25, P = .001).
Table 2.

Analysis of Circulating IgG Against Each of 18 Antigens Tested

AntigensPatients, Mean ± SD (n)Controls, Mean ± SD (n) Z P a
DPYD10.56 ± 0.24 (169)0.48 ± 0.22 (187)−3.22.001
CA1Ca0.54 ± 0.34 (168)0.51 ± 0.34 (187)−1.44.150
ARE1a0.36 ± 0.18 (169)0.57 ± 0.37 (187)−6.47<.001
SLC39a0.46 ± 0.32 (169)0.42 ± 0.28 (187)−1.40.161
D1L1a1.00 ± 0.25 (169)0.90 ± 0.22 (187)−4.05<.001
F804A-10.47 ± 0.17 (169)0.42 ± 0.15 (187)−3.41.001
NRGN-10.59 ± 0.29 (169)0.56 ± 0.28 (187)−1.12.240
TCF4a0.21 ± 0.07 (169)0.41 ± 0.21 (187)−8.70<.001
SB2-10.72 ± 0.27 (169)0.74 ± 0.24 (187)−1.18.236
VRK2a0.54 ± 0.18 (169)0.61 ± 0.21 (187)−3.25.001
DRD2a0.82 ± 0.26 (169)0.74 ± 0.25 (187)−3.31.001
MP16-10.73 ± 0.28 (169)0.69 ± 0.24 (187)−1.193.233
MP16-20.42 ± 0.15 (169)0.36 ± 0.13 (187)−3.99<.001
SB2-20.84 ± 0.25 (169)0.81 ± 0.21 (187)−1.30.193
SB2-31.06 ± 0.63 (169)0.75 ± 0.40 (187)−5.71<.001
SB2-41.16 ± 0.39 (169)1.14 ± 0.35 (187)−0.18.856
ERC4a1.01 ± 0.88 (169)0.77 ± 0.59 (187)−2.90.004
F9B10.85 ± 0.23 (169)0.78 ± 0.21 (187)−2.67.008

a P <.003 was considered to be statistically significant.

Analysis of Circulating IgG Against Each of 18 Antigens Tested a P <.003 was considered to be statistically significant. ROC curve analysis revealed that of 18 IgG tests, the anti-TRANK1 (SB2-3) IgG assay was the most sensitive, with a sensitivity of 20.7% against the specificity of 95.2% (AUC = 0.68, 95% CI = 0.62–0.73); anti-TCF4a IgG assay showed the largest AUC (AUC = 0.78, 95% CI = 0.73–0.83) but its sensitivity was just 10.7%. The remaining of IgG tests all had a sensitivity of less than 15% (table 3).
Table 3.

ROC Curve Analysis of Plasma IgG Antibodies Against Each Antigen in Schizophrenia

AntigensSensitivity (%)aAUCSEAsymptotic 95% CIPPVNPV
Lower BoundUpper Bound
DPYD112.50.600.0300.540.660.720.52
CA1Ca6.50.550.0320.490.610.580.50
ARE1a10.10.700.0280.650.750.680.51
SLC39a6.50.540.0320.480.600.580.50
D1L111.20.620.0300.570.680.700.52
F804A-111.80.610.0300.550.670.710.52
NRGN-17.10.540.0310.480.590.600.51
TCF4a10.70.780.0250.730.830.690.52
SB2-19.50.530.0310.470.590.660.51
VRK2a7.70.600.0300.540.660.620.51
DRD2a13.00.600.0300.540.660.730.52
MP16-18.90.540.0310.480.590.650.51
MP16-213.60.620.0310.560.680.740.52
SB2-26.50.540.0310.480.600.580.50
SB2-320.70.680.0280.620.730.810.55
SB2-411.20.510.0310.450.570.700.52
ERC4a13.60.590.0300.530.650.740.52
F9B15.90.580.0300.520.640.550.50

Note: ROC, receiver operating characteristic; AUC, are under the ROC curve; PPV, positive predictive value; NPV, negative predictive value.

aAgainst a specificity of 95.2%.

ROC Curve Analysis of Plasma IgG Antibodies Against Each Antigen in Schizophrenia Note: ROC, receiver operating characteristic; AUC, are under the ROC curve; PPV, positive predictive value; NPV, negative predictive value. aAgainst a specificity of 95.2%. Risperidone was the only antipsychotic drug that was likely to affect overall IgG levels (supplementary table S5) (combined P = .005) with individual effects on circulating IgG against VRK2a (P = .018), F804A-1 (P = .01), ARE1a (P = .005), and SB2-4 (P = .007). All other antipsychotic drugs were not found to have significant effects on circulating IgG against these linear antigens tested. Kruskal–Wallis (supplementary table S6) analysis revealed that risperidone could up-regulate the secretion of plasma IgG against VRK2a (H = 4.92, P = .027), ARE1a (H = 6.08, P = .014) and SB2-4 (H = 5.88, P = .015); however, all these tests failed to survive the Bonferroni corrections. There was a significant correlation in circulating levels between all IgG antibodies tested (P < .003) in the patient group and between most IgG antibodies in the control group; their coefficients and P-values are given in tables 4 and 5.
Table 4.

Spearman Correlation Analysis for the Correlation in Plasma Levels Between Individual IgG Antibodies Tested in Patients With Schizophrenia

TCF4aNRGN-1MP16-1MP16-2VRK2aF804A-1CA1CaDPYD1ARE1aSLC39aD1L1DRD2aSB2-1SB2-2SB2-3SB2-4ERC4a
NRGN-1 r a .525
P b <.001
MP16-1 r .453.458
P <.001<.001
MP16-2 r .610.437.704
P <.001<.001<.001
VRK2a r .444.327.508.390
P <.001<.001<.001<.001
F804A-1 r .508.427.581.523.877
P <.001<.001<.001<.001<.001
CA1Ca r .434.335.445.494.602.588
P <.001<.001<.001<.001<.001<.001
DPYD1 r .511.322.490.570.517.552.770
P <.001<.001<.001<.001<.001<.001<.001
ARE1a r .446.444.694.585.574.646.523.491
P <.001<.001<.001<.001<.001<.001<.001<.001
SLC39a r .283.404.598.576.395.433.581.491.699
P <.001<.001<.001<.001<.001<.001<.001<.001<.001
D1L1 r .371.327.615.475.575.512.389.476.452.388
P <.001<.001<.001<.001<.001<.001<.001<.001<.001<.001
DRD2a r .548.478.600.587.576.578.495.519.551.485.749
P <.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001
SB2-1 r .484.380.642.568.416.434.416.438.481.501.623.564
P <.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001
SB2-2 r .507.403.678.575.458.516.343.401.561.468.694.609.804
P <.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001
SB2-3 r .410.430.614.538.507.541.414.461.510.380.606.652.533.612
P <.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001
SB2-4 r .412.453.657.551.651.593.503.506.615.502.712.649.619.641.746
P <.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001
ERC4 r .473.358.478.412.405.457.233.295.467.379.390.457.363.423.432.420
P <.001<.001<.001<.001<.001<.001.002<.001<.001<.001<.001<.001<.001<.001<.001<.001
F9B1 r .447.295.650.496.534.540.321.377.543.441.725.563.668.745.555.657.587
P <.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001

aSpearman correlation coefficient.

b P <.003 was considered to be significantly significant.

Table 5.

Spearman Correlation Analysis for the Correlation in Plasma Levels Between Individual IgG Antibodies Tested in Control Subjects

TCF4aNRGN-1MP16-1MP16-2VRK2aF804A-1CA1CaDPYD1ARE1aSLC39aD1L1DRD2aSB2-1SB2-2SB2-3SB2-4ERC4a
NRGN-1 r a .466
P b <.001
MP161 r .210.444
P .004<.001
MP162 r .239.392.653
P .001<.001<.001
VRK2a r .488.411.462.342
P <.001<.001<.001<.001
F804A-1 r .239.443.448.415.722
P .001<.001<.001<.001<.001
CA1Ca r .141.307.455.439.414.439
P .057<.001<.001<.001<.001<.001
DPYD1 r .082.276.333.384.346.329.696
P .271<.001<.001<.001<.001<.001<.001
ARE1a r .740.378.391.348.598.325.306.271
P <.001<.001<.001<.001<.001<.001<.001<.001
SLC39a r .150.361.468.498.209.244.483.317.396
P .042<.001<.001<.001.004.001<.001<.001<.001
D1L1 r −.033.360.608.444.330.439.337.291.113.291
P .650<.001<.001<.001<.001<.001<.001<.001.126<.001
DRD2a r .155.423.550.482.348.421.398.312.259.431.765
P .035<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001
SB2-1 r .370.537.638.472.465.397.308.252.454.369.608.573
P <.001<.001<.001<.001<.001<.001<.001.001<.001<.001<.001<.001
SB2-2 r .251.408.612.509.409.401.323.272.331.381.633.592.845
P .001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001
SB2-3 r −.028.396.427.357.256.466.481.332.097.442.456.423.505.508
P .704<.001<.001<.001<.001<.001<.001<.001.188<.001<.001<.001<.001<.001
SB2-4 r .254.534.522.321.500.509.397.333.276.352.539.505.666.631.650
P <.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001
ERC4 r .049.317.242.376.221.297.331.315.093.298.366.360.403.423.488.399
P .501<.001.001<.001.002<.001<.001<.001.207<.001<.001<.001<.001<.001<.001<.001
F9B1 r .224.481.592.476.444.454.277.275.299.374.677.599.781.807.466.653.502
P .002<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001<.001

aSpearman correlation coefficient.

b P <.003 was considered to be significantly significant.

Spearman Correlation Analysis for the Correlation in Plasma Levels Between Individual IgG Antibodies Tested in Patients With Schizophrenia aSpearman correlation coefficient. b P <.003 was considered to be significantly significant. Spearman Correlation Analysis for the Correlation in Plasma Levels Between Individual IgG Antibodies Tested in Control Subjects aSpearman correlation coefficient. b P <.003 was considered to be significantly significant. Three individuals in the patient group and 3 in the control group were positive for double stranded DNA antibodies, and the chi-square test failed to show statistically significant (χ2 = 0.02, P = .9). There was no significant difference in total IgG levels (Z = 1.28, P = .221) between patients with schizophrenia (27.3 ± 10.8 mg/ml) and control subjects (26.7 ± 12.6 mg/ml); no significant correlation between total IgG levels and each individual IgG level was shown in either the patient group (supplementary table S7) or the control group (supplementary table S8).

Discussion

The present study demonstrated that patients with schizophrenia had significant changes in circulating levels of IgG antibodies against peptide antigens encoded by schizophrenia-associated genes.[4] ROC curve analysis is a plot of the true positive against the false positive rate, the AUC provides a measure of how well each parameter is to distinguish between case and control groups. It is particularly important that the anti-TRANK1 IgG assay gave a sensitivity (true positive) of 20.7% against the specificity (true negative) of 95.2% (table 3) and failed to show a significant correlation with total IgG levels in plasma (supplementary tables S7 and S8), suggesting that anti-TRANK1 IgG test could serve as useful biomarker for a subgroup of schizophrenia. The TRANK1 gene is localized in the short arm of chromosome 3, 3p22.2, and encodes tetratricopeptide repeat and ankyrin repeat containing 1. Although its function remains largely unclear, autoantibodies against TRANK1 protein (also called lupus brain antigen 1) have been reported to be associated with systemic lupus erythematosus (SLE).[17] It is worth noting that the proportion of individuals positive for plasma IgG against double stranded DNA was less than 2% in our samples, with no difference between the case and control groups, suggesting that SLE is unlikely to be a cause of schizophrenia. A recent study demonstrated that IFN-α could up-regulate expression of the TRANK1 gene in differentiated hepatic cells by activation of the STAT-JAK pathway.[18] The IFN pathway is involved in regulating the cellular innate immune system to eliminate invading pathogens, so an increase in anti-TRANK1 IgG levels may disrupt IFN-mediated immune function in schizophrenia. Further investigation is required to explore the precise mechanism by which TRANK1 plays a central role in regulating IFN-mediated immune response and protecting individuals from the development of schizophrenia. All IgG antibodies tested in this study were significantly correlated to each other in the patients group (table 4) while most IgG antibodies (but not all tested) were significantly correlated to each other in the control group (table 5), suggesting that there may be something wrong with the humoral immunity in schizophrenia although there was no significant difference in total IgG levels between patients with schizophrenia and control subjects. Of 18 antigens studied, 6 showed an increase in circulating IgG levels in schizophrenia. The increased antibody levels may result from a breakdown of immune tolerance to the products of these schizophrenia-associated variants, causing an autoimmune response.[14] Alternatively, this could result from a hyperactivity of the immune system as part of the etiology of schizophrenia, which would be concordant with current literature suggesting an increase in pro-inflammatory molecules with an increased immune response in those undergoing both acute psychosis and chronic schizophrenia.[11] Adjunctive trials of anti-inflammatory agents alongside anti-psychotic medication have demonstrated only modest clinical gains, potentially targeting effect rather than cause.[19] It could therefore be suggested that targeting of the immune system may gain more effective outcomes from clinical practices. Decreased antibody secretion was also observed in this study such as significant low levels of circulating IgG against peptide antigens derived from TCF4, TSNARE1, and VRK2. Possibly, these IgG antibodies have a protective effect on schizophrenia. Several lines of research have suggested that natural antibodies play an important role not only in eliminating pathogens invaded but also in maintaining homeostasis of the immune system through suppression of inflammatory reactions.[20,21] Since both autoantibodies and natural antibodies are produced by the B1 type of lymphocytes in the absence of external antigen stimulation or immunization, the balance between them may be very important for human health.[22,23] Based on linear regression analysis (supplementary table S5), risperidone is the only antipsychotic drug affecting antibody levels in plasma, suggesting that its antipsychotic effect may partially depend on a regulatory process of the immune system. A systematic review demonstrated altered levels of some autoantibodies in drug-naïve patients with first-episode psychosis and also suggested a link between disease-associated SNPs identified and a number of autoantibodies.[24] Risperidone administration has previously been demonstrated to have an effect on inflammatory process and the immune system, consistent with our finding in this study.[25,26] The relationship between anti-VRK2 IgG levels and risperidone treatment is particularly interesting. Those patients prescribed with the drug showed an increase in circulating antibodies against VRK2 in comparison to controls, whereas those who did not take risperidone appeared to have a significant decrease in this antibody level (supplementary table S6). However, there is only a small number of the cases prescribed risperidone in comparison to the number of nonrisperidone prescriptions. This initial finding needs replication in a large sample size. There are several limitations in this study. First, it was impossible to fully control the confounding effects of lifestyle factors such as alcohol consumption, diets, and use of any legal or illegal substances on the antibody levels measured, as samples were already collected and detailed information available was limited. Second, this study contains no subjects who were either antipsychotic-free or drug-naïve, so that the true effects of antipsychotic medication on the immune system may be masked or overestimated. Third, there was little clinical information of case–control subjects such as history of autoimmune disorders that may affect antibody analysis although the prevalence of severe autoimmune conditions is less than 4% in the European populations. It will also be useful to test these autoantibodies in individuals with bipolar, major depressive disorders or other psychiatric diseases to determine if abnormalities of the humoral immunity are limited to schizophrenia. Obviously, the addition of further control groups would demonstrate the possibility of using the findings of GWA study to identify autoantigen targets.

Supplementary Material

Supplementary data are available at Schizophrenia Bulletin online. Click here for additional data file.
  23 in total

Review 1.  Adjunctive use of nonsteroidal anti-inflammatory drugs for schizophrenia: a meta-analytic investigation of randomized controlled trials.

Authors:  Masahiro Nitta; Taishiro Kishimoto; Norbert Müller; Mark Weiser; Michael Davidson; John M Kane; Christoph U Correll
Journal:  Schizophr Bull       Date:  2013-05-29       Impact factor: 9.306

Review 2.  Inflammation and schizophrenia.

Authors:  Brian Kirkpatrick; Brian J Miller
Journal:  Schizophr Bull       Date:  2013-09-26       Impact factor: 9.306

3.  Identification and cloning of a brain autoantigen in neuro-behavioral SLE.

Authors:  P M Moore; T Vo; L R Carlock
Journal:  J Neuroimmunol       Date:  1998-03-01       Impact factor: 3.478

4.  Serum TNF-α, IL-10 and IL-2 in schizophrenic patients before and after treatment with risperidone and clozapine.

Authors:  Abolghasem Ajami; Farshideh Abedian; Seyyed Hamzeh Hosseini; Elahe Akbarian; Reza Alizadeh-Navaei; Mehrdad Taghipour
Journal:  Iran J Immunol       Date:  2014-09       Impact factor: 1.603

5.  Schizophrenia after prenatal exposure to 1957 A2 influenza epidemic.

Authors:  E O'Callaghan; P Sham; N Takei; G Glover; R M Murray
Journal:  Lancet       Date:  1991-05-25       Impact factor: 79.321

Review 6.  A systematic, quantitative review of blood autoantibodies in schizophrenia.

Authors:  Amaka Ezeoke; Andrew Mellor; Peter Buckley; Brian Miller
Journal:  Schizophr Res       Date:  2013-08-14       Impact factor: 4.939

Review 7.  Inflammation and immunity in schizophrenia: implications for pathophysiology and treatment.

Authors:  Golam M Khandaker; Lesley Cousins; Julia Deakin; Belinda R Lennox; Robert Yolken; Peter B Jones
Journal:  Lancet Psychiatry       Date:  2015-02-25       Impact factor: 27.083

Review 8.  Glutamate and dopamine in schizophrenia: an update for the 21st century.

Authors:  Oliver Howes; Rob McCutcheon; James Stone
Journal:  J Psychopharmacol       Date:  2015-01-13       Impact factor: 4.153

9.  Effects of risperidone on cytokine profile in drug-naïve first-episode psychosis.

Authors:  Cristiano Noto; Vanessa Kiyomi Ota; Eduardo S Gouvea; Lucas B Rizzo; Leticia M N Spindola; Pedro H S Honda; Quirino Cordeiro; Sintia Iole Belangero; Rodrigo Affonseca Bressan; Ary Gadelha; Michael Maes; Elisa Brietzke
Journal:  Int J Neuropsychopharmacol       Date:  2014-10-31       Impact factor: 5.176

10.  Biological insights from 108 schizophrenia-associated genetic loci.

Authors: 
Journal:  Nature       Date:  2014-07-22       Impact factor: 49.962

View more
  11 in total

Review 1.  Impaired blood-brain barrier in the microbiota-gut-brain axis: Potential role of bipolar susceptibility gene TRANK1.

Authors:  Jianbo Lai; Jiajun Jiang; Peifen Zhang; Caixi Xi; Lingling Wu; Xingle Gao; Yaoyang Fu; Danhua Zhang; Yiqing Chen; Huimin Huang; Yiyi Zhu; Shaohua Hu
Journal:  J Cell Mol Med       Date:  2021-05-20       Impact factor: 5.310

2.  Circulating anti-p16a IgG autoantibodies as a potential prognostic biomarker for non-small cell lung cancer.

Authors:  Huan Zhao; Xuan Zhang; Zhifeng Han; Yanjun Wang
Journal:  FEBS Open Bio       Date:  2018-10-18       Impact factor: 2.693

3.  Alteration of circulating natural autoantibodies to CD25-derived peptide antigens and FOXP3 in non-small cell lung cancer.

Authors:  Huan Zhao; Xuan Zhang; Zhifeng Han; Wenjing Xie; Wei Yang; Jun Wei
Journal:  Sci Rep       Date:  2018-06-29       Impact factor: 4.379

4.  Anti-TSNARE1 IgG plasma levels differ by sex in patients with schizophrenia in a Chinese population.

Authors:  Chan Li; Ruth Whelan; Hua Yang; Yaling Jiang; Chaosen Qiu; Qingyong Meng; Jun Wei
Journal:  FEBS Open Bio       Date:  2019-09-04       Impact factor: 2.693

5.  Further Study of Circulating Antibodies to P16, CD25 and FOXP3 in Hepatocellular Carcinoma.

Authors:  Jiaxin Wang; Yangchun Xu; Yanjun Wang; Xuan Zhang; Guizhen Zhang
Journal:  Onco Targets Ther       Date:  2019-12-02       Impact factor: 4.147

6.  Autoantibody profiles associated with clinical features in psychotic disorders.

Authors:  August Jernbom Falk; Cherrie Galletly; David Just; Catherine Toben; Bernhard T Baune; Scott R Clark; Dennis Liu; Peter Nilsson; Anna Månberg; K Oliver Schubert
Journal:  Transl Psychiatry       Date:  2021-09-13       Impact factor: 6.222

7.  MAD1L1 and TSNARE gene polymorphisms are associated with schizophrenia susceptibility in the Han Chinese population.

Authors:  Xianglai Liu; Hailing Xie; Zejuan Fu; Qiankun Yao; Tianming Han; Dafei Zhan; Zhan Lin; Hong Zhu
Journal:  BMC Med Genomics       Date:  2021-09-04       Impact factor: 3.063

8.  Immune System Abnormalities in Schizophrenia: An Integrative View and Translational Perspectives.

Authors:  Evgeny A Ermakov; Mark M Melamud; Valentina N Buneva; Svetlana A Ivanova
Journal:  Front Psychiatry       Date:  2022-04-25       Impact factor: 5.435

9.  Skewing of the antibody repertoire in cerebrospinal fluid B cells from healthy controls and patients with schizophrenia.

Authors:  Sehba Husain-Krautter; Jihui Lee; Duncan Vos; Juan A Gallego; Anil K Malhotra; Thomas L Rothstein
Journal:  Behav Brain Res       Date:  2022-01-07       Impact factor: 3.352

10.  Exploring autoantibody signatures in brain tissue from patients with severe mental illness.

Authors:  David Just; Anna Månberg; Nicholas Mitsios; Craig A Stockmeier; Grazyna Rajkowska; Mathias Uhlén; Jan Mulder; Lars Feuk; Janet L Cunningham; Peter Nilsson; Eva Lindholm Carlström
Journal:  Transl Psychiatry       Date:  2020-11-18       Impact factor: 6.222

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.