Literature DB >> 29342181

Optimization of mNeonGreen for Homo sapiens increases its fluorescent intensity in mammalian cells.

Emiko Tanida-Miyake1,2, Masato Koike1, Yasuo Uchiyama3, Isei Tanida1.   

Abstract

Green fluorescent protein (GFP) is tremendously useful for investigating many cellular and intracellular events. The monomeric GFP mNeonGreen is about 3- to 5-times brighter than GFP and monomeric enhanced GFP and shows high photostability. The maturation half-time of mNeonGreen is about 3-fold faster than that of monomeric enhanced GFP. However, the cDNA sequence encoding mNeonGreen contains some codons that are rarely used in Homo sapiens. For better expression of mNeonGreen in human cells, we synthesized a human-optimized cDNA encoding mNeonGreen and generated an expression plasmid for humanized mNeonGreen under the control of the cytomegalovirus promoter. The resultant plasmid was introduced into HEK293 cells. The fluorescent intensity of humanized mNeonGreen was about 1.4-fold higher than that of the original mNeonGreen. The humanized mNeonGreen with a mitochondria-targeting signal showed mitochondrial distribution of mNeonGreen. We further generated an expression vector of humanized mNeonGreen with 3xFLAG tags at its carboxyl terminus as these tags are useful for immunological analyses. The 3xFLAG-tagged mNeonGreen was recognized well with an anti-FLAG-M2 antibody. These plasmids for the expression of humanized mNeonGreen and mNeonGreen-3xFLAG are useful tools for biological studies in mammalian cells using mNeonGreen.

Entities:  

Mesh:

Substances:

Year:  2018        PMID: 29342181      PMCID: PMC5771595          DOI: 10.1371/journal.pone.0191108

Source DB:  PubMed          Journal:  PLoS One        ISSN: 1932-6203            Impact factor:   3.240


Introduction

Green fluorescent protein (GFP) was first isolated from Aequorea victoria jelly fish, and GFP-variants, like monomeric enhanced GFP (mEGFP) [1], are useful tools for investigating cellular and intracellular events, including organelle morphology, intracellular localization of proteins, intracellular Ca2+ concentration, pH monitoring, and protein-protein interactions [2-8]. The main advantage of GFP is its fluorescent intensity and stability in cells. Recently, one of brightest GFPs, mNeonGreen, was derived from Branchiostoma lanceolatum (European lancelet) and has several advantages over EGFP and mEGFP [1, 3–5, 9, 10]. mNeonGreen is a monomeric protein that is about 3- to 5-fold brighter than GFP and EGFP, and its maturation time is about 3-fold shorter than that of EGFP [2, 3]. These properties indicate mNeonGreen is a better fluorescent tool than EGFP and mEGFP to investigate biological functions [1, 2, 10]. To utilize mNeonGreen in mammalian cells more effectively, it is important to obtain efficient expression. Previously, mNeonGreen cDNA was found to contain at least seven codons used rarely in H. sapiens [3]. Therefore, we hypothesized that expression of mNeonGreen in mammalian cells would improve upon optimization of its codons for H. sapiens. Another disadvantage of mNeonGreen versus mEGFP and EGFP is that there are few antibodies available for mNeonGreen recognition. While there are many commercially available antibodies for GFP and its other variants, they cannot be used to detect mNeonGreen due to the low amino acid sequence homology between mNeonGreen and mEGFP (Table 1). Therefore, we also generated a plasmid that would help optimize expression of 3xFLAG-tagged, humanized mNeonGreen [11]. These improvements will be very useful for analyzing biological events using this protein in mammalian cells.
Table 1

Comparison of the amino acid sequence of mNeonGreen with that of EGFP using Clustal-W alignment.

mNeonGreen1MVSKGEEDNMASLPATHELHIFGSINGVDFDMVGQGTGNP
EGFP1MVSKGEELFTGVVPILVELD--GDVNGHKFSVSGEGEGDA
*******.****.***.*.**
mNeonGreen41NDGYEELNLKSTKGDLQFSPWILVPHIGYGFHQYLPYPDG
EGFP38TYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDH
.**.*****.**..***
mNeonGreen81MSP---FQAAMVDGSGYQVHRTMQFEDGASLTVNYRYTYE
EGFP70MKQHDFFKSAMPEG--YVQERTIFFKDDGNYKTRAEVKFE
**..**.****.**.*
mNeonGreen118GSHIKGEAQVKGTGFPADGPVMTNSLTAADWCRSKKTYPN
EGFP117GDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMAD
*....*****...*..
mNeonGreen158DK--TIISTFKWSYTTGNGKRYRSTARTTYTFAKPMAAN-
EGFP157KQKNGIKVNFKIRHNIEDGS---VQLADHYQQNTPIGDGP
.*.**.***..
mNeonGreen195YLKNQPMYVFRKTELKHSKTELN----FKEWQKAFTDVMG
EGFP194VLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLG
**...*..***.*
mNeonGreen231MDELYK
EGFP 234 M234MDELYK
******

mNeonGreen had low sequence homology with EGFP (27% identity, 14% similarity).

EGFP, enhanced green fluorescent protein.

mNeonGreen had low sequence homology with EGFP (27% identity, 14% similarity). EGFP, enhanced green fluorescent protein.

Materials and methods

Cells, media, materials, and antibodies

HEK293 and COS1 cells were obtained from the American Type Culture Collection, and cultured in Dulbecco’s Modified Eagle’s Medium (Wako, 045–30285) containing 10% fetal calf serum (JRH Biosciences/Sigma-Aldrich, 12603C). The mouse monoclonal antibody, clone M2, against the FLAG peptide (DYKDDDDK; F1804) was purchased from Sigma-Aldrich, and the mouse monoclonal antibody against glyceraldehyde-3-phosphate dehydrogenase was from Abcam (ab8245). Protein concentrations were determined using the bicinchoninic acid protein assay (Pierce, 23225). FuGENE HD transfection reagent was used to introduce the plasmid into cells (Promega, E2311). mCherry2-C1 was a gift from Dr. Michael Davidson (Addgene plasmid # 54563), and pLL7.0: Venus-iLID-Mito (From ActA) was from Dr. Brian Kuhlman (Addgene plasmid # 60413) [12].

DNA synthesis and construction of plasmids for expression of humanized mNeonGreen and mNeonGreen-3xFLAG

mNeonGreen amino acid sequence (GenBank Accession No. AGG56535.1) codon optimization for H. sapiens was performed using MacVector software based on the codon usage database on the Kazusa DNA Research Institute website (http://www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=9606). The resultant optimized DNA fragment was synthesized by Integrated DNA Technologies with a linker sequence (5’-AAAAAAGCTAGCGCCACC-3’) before the start codon and another (5’-AAGTCCGGAACTAGTTTTTT-3’) before the stop codon. The synthesized DNA fragment was digested by restriction enzymes NheI and BspEI, and a NheI-BspEI site was introduced to pAcGFP-G; pAcGFP-G is similar to pAcGFP-C1 and contains a triple Gly-Gly-Gly-Ser linker sequence at the C-terminus before its multicloning site. The resultant plasmid was designated as pmNeonGreenHO-G (Fig 1). For the expression of original mNeonGreen, a DNA fragment of mNeonGreen (GenBank Accession No. AGG56535.1) was synthesized by Integrated DNA Technologies with a linker sequence (5’-AAAAAAGCTAGCGCCACC-3’) before the start codon and another (5’-AAGTCCGGAACTAGTTTTTT-3’) before the stop codon. The plasmid used for expression of original mNeonGreen (pmNeonGreen-G) was constructed using the same strategy as for humanized mNeonGreen above.
Fig 1

DNA sequence and plasmid maps of mNeonGreen.

(A) Comparison of the DNA sequence of humanized mNeonGreen with that of the original one. A pairwise alignment of two DNA sequences of humanized (GenBank Accession No. LC279210) and original mNeonGreen (GenBank Accession No. KC295282) was performed using a CLUSTAL W program (http://clustalw.ddbj.nig.ac.jp/). (B) Plasmid maps for the expression of humanized mNeonGreen and mNeonGreen-3xFLAG. Humanized mNeonGreen cDNA with a triple Gly-Gly-Gly-Ser linker was inserted into the NheI-BglII site of pAcGFP-C1 after removing AcGFP cDNA to create pmNeonGreenHO-G. Humanized mNeonGreen-3xFLAG cDNA was inserted into the NheI-BglII site of pAcGFP-C1 after removing AcGFP cDNA to create pmNeonGreenHO-3xFLAG. MCS, multicloning sites; CMV, cytomegalovirus.

DNA sequence and plasmid maps of mNeonGreen.

(A) Comparison of the DNA sequence of humanized mNeonGreen with that of the original one. A pairwise alignment of two DNA sequences of humanized (GenBank Accession No. LC279210) and original mNeonGreen (GenBank Accession No. KC295282) was performed using a CLUSTAL W program (http://clustalw.ddbj.nig.ac.jp/). (B) Plasmid maps for the expression of humanized mNeonGreen and mNeonGreen-3xFLAG. Humanized mNeonGreen cDNA with a triple Gly-Gly-Gly-Ser linker was inserted into the NheI-BglII site of pAcGFP-C1 after removing AcGFP cDNA to create pmNeonGreenHO-G. Humanized mNeonGreen-3xFLAG cDNA was inserted into the NheI-BglII site of pAcGFP-C1 after removing AcGFP cDNA to create pmNeonGreenHO-3xFLAG. MCS, multicloning sites; CMV, cytomegalovirus. For the expression of mitochondria-localized humanized mNeonGreen protein, we amplified a DNA fragment encoding a mitochondrial targeting signal of ActA gene of Listeria monocytogenes derived from pLL7.0: Venus-iLID-Mito (From ActA) using a mtSig-ActA-Bgl2-F primer (5’-CCCAGATCTAAACTAATTGCTAAAAGTGCAGAA-3’) and a mtSig-ActA-ST-SalI-Rv primer (5imCCCGTCGACTTAATTATTTTTTCTTAATTGAAT-3’)[12]. The amplified DNA fragment was digested with BglII and SalI. The BglII-SalI DNA fragment was introduced into the BglII-SalI site of pmNeonGreenHO-G. The resultant plasmid was designated as pmNeonGreenHO-mito. For the expression of C-terminal 3xFLAG-tagged, humanized mNeonGreen, a DNA fragment encoding 2xSTREP-3xFLAG (5’-GCTAGCGCCACCATGTGGAGCCACCCGCAGTTCGAGAAAGGTGGAGGTTCCGGAGGTGGATCGGGAGGTGGATCGTGGAGCCACCCGCAGTTCGAAAAAACTAGTCGGGCTGACTACAAAGACCATGACGGTGATTATAAAGATCATGACATCGACTACAAGGATGACGATGACAAGAGATCTTAGGCGGCCGCTCGAGTCTAGAGGGCCCG-3’) was synthesized. The DNA fragment was digested by BspEI-BglII and inserted into a BspEI-BglII site. The resultant plasmid used for the expression of mNeonGreen-3xFLAG was designated as pmNeonGreenHO-3xFLAG.

Immunoblotting

Cells were washed twice in phosphate-buffered saline and lysed in lysis buffer (10 mM sodium phosphate [pH 7.2], 150 mM NaCl, and 1% sodium dodecyl sulfate [SDS]) containing a protease-inhibitor cocktail (04080–24, Nacalai Tesque). Lysate proteins (10 μg) were separated by SDS-polyacrylamide gel electrophoresis. After transferring the proteins to a polyvinylidine difluoride membrane using a Trans-Blot SD transfer cell (Bio-Rad, 170–3940), mNeonGreen-3xFLAG and glyceraldehyde-3-phosphate dehydrogenase were recognized using the appropriate antibodies and developed with a chemiluminescent method according to standard protocols using SuperSignal West Dura Extended Duration Substrate (Pierce, 34075).

Fluorescence microscopy

Cells were fixed in fixation solution (4% paraformaldehyde in phosphate-buffered saline) at room temperature for 5 min, and fluorescence was monitored using a BZ-X700 microscope (Keyence, Tokyo, Japan).

Analyses of fluorescence intensity of humanized mNeonGreen

The plasmids, pmNeonGreen-G or pmNeonGreenHO-G was transfected into HEK293 cells. As a control of transfection efficiency, mCherry2-C1 was employed. At 48 h after transfection, the fluorescent intensity of mNeonGreen and mCherry in 293 cells was analyzed using a 2300 EnSpire multimode reader (PerkinElmer, Massachusettes).

Results and discussion

Increased fluorescent intensity of humanized mNeonGreen in mammalian cells

mNeonGreen is one of brightest GFPs derived from Branchiostoma lanceolatum. To investigate whether the reported cDNA sequence of mNeonGreen (GenBank Accession No. KC295282) is suitable for expression in human cells, we analyzed its codon usage with the Kazusa DNA Research Institute website (http://www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=9606) [Table 2].
Table 2

Homo sapiens codon usage.

codonAAFRTcodonAAFRTcodonAAFRTcodonAAFRT
UUUF17.6UCUS15.2UAUY12.2UGUC10.6
UUCF20.3UCCS17.7UACY15.3UGCC12.6
UUAL7.7UCAS12.2UAA*1UGA*1.6
UUGL12.9UCGS4.4UAG*0.8UGGW13.2
CUUL13.2CCUP17.5CAUH10.9CGUR4.5
CUCL19.6CCCP19.8CACH15.1CGCR10.4
CUAL7.2CCAP16.9CAAQ12.3CGAR6.2
CUGL39.6CCGP6.9CAGQ34.2CGGR11.4
AUUI16ACUT13.1AAUN17AGUS12.1
AUCI20.8ACCT18.9AACN19.1AGCS19.5
AUAI7.5ACAT15.1AAAK24.4AGAR12.2
AUGM22ACGT6.1AAGK31.9AGGR12
GUUV11GCUA18.4GAUD21.8GGUG10.8
GUCV14.5GCCA27.7GACD25.1GGCG22.2
GUAV7.1GCAA15.8GAAE29GGAG16.5
GUGV28.1GCGA7.4GAGE39.6GGGG16.5

40662582 codons of Homo sapiens were analyzed with the Kazusa DNA Research Institute website (http://www.kazusa.or.jp/codon/).

AA, single letter amino acid code; FPT, frequency per 1000 codons.

40662582 codons of Homo sapiens were analyzed with the Kazusa DNA Research Institute website (http://www.kazusa.or.jp/codon/). AA, single letter amino acid code; FPT, frequency per 1000 codons. The original mNeonGreen mRNA sequence was found to contain some codons that are rarely used in H. sapiens, especially two UUA (7.7 frequency per 1000 codons), three UCG (4.4 frequency per 1000 codon), one CCG (6.9 frequency per 1000 codons) and one CGU (4.5 frequency per 1000 codons) [Table 3]. Therefore, we concluded that optimization of the mNeonGreen codon sequence for H. sapiens would improve its expression and thereby, its fluorescent intensity, in mammalian cells.
Table 3

Codon usage in original mNeonGreen.

codonFRTncodonFRTncodonFRTncodonFRTn
UUU25.46UCU4.21UAU12.73UGU0.00
UUC25.46UCC25.36UAC50.612UGC4.21
UUA8.42UCA0.00UAA4.21UGA0.00
UUG0.00UCG12.73UAG0.00UGG16.94
CUU4.21CCU21.15CAU16.94CGU4.21
CUC16.94CCC12.73CAC12.73CGC12.73
CUA0.00CCA12.73CAA8.42CGA0.00
CUG25.36CCG4.21CAG29.57CGG8.42
AUU4.21ACU21.15AAU12.73AGU8.42
AUC25.36ACC54.913AAC38.09AGC12.73
AUA0.00ACA8.42AAA8.42AGA0.00
AUG46.411ACG4.21AAG67.516AGG4.21
GUU4.21GCU12.73GAU21.15GGU29.57
GUC8.42GCC29.57GAC33.88GGC33.88
GUA4.21GCA0.00GAA4.21GGA16.94
GUG29.57GCG16.94GAG46.411GGG12.73

FPT, frequency per 1000 codons; n, number of codons used in mNeonGreen cDNA

FPT, frequency per 1000 codons; n, number of codons used in mNeonGreen cDNA Accordingly, we changed 51 out of 236 codons within mNeonGreen (GenBank Accession No. KC295282) to more frequently used codons in H. sapiens, synthesized a DNA fragment encoding humanized mNeonGreen (GenBank Accession No. LC279210), and generated our expression pmNeonGreenHO-G (Fig 1). The resultant plasmid was transfected into HEK293 cells, and the fluorescent intensity of mNeonGreen in the cells 24 h after transfection was examined. As a control for transfection efficiency, mCherry2-C1 was employed. The fluorescent intensity of humanized mNeonGreen was significantly increased (1.39 ± 0.06-fold, p<0.01) compared with that of original mNeonGreen, while there is no significant difference of that of mCherry2 (Fig 2). This increase was obtained by substituting codons within original mNeonGreen cDNA that are rarely used in humans to more highly used codons. Especially, the codons, UUA, UCG, CGU, and CCG, are rarely used in Mus musculus and Rattus rattus, therefore the fluorescent intensity of humanized mNeonGreen will be increased in mouse and rat cell lines.
Fig 2

Original and humanized mNeonGreen fluorescence in HEK293.

Plasmids designed for expression of original or humanized mNeonGreen were transfected into HEK293 cells. As a control of transfection efficiency, mCherry2-C1 was employed. Fluorescent intensity of mNeonGreen and mCherry2 was obtained 48 h after transfection using a 2300 EnSpire multimode reader. The data were analyzed with a Welch’s t-test; p < 0.01 in green fluorescent intensity of mNeonGreen; p > 0.7 in red fluorescent intensity of mCherry2. Graphs show the relative fluorescent intensity of both fluorescent proteins (%).

Original and humanized mNeonGreen fluorescence in HEK293.

Plasmids designed for expression of original or humanized mNeonGreen were transfected into HEK293 cells. As a control of transfection efficiency, mCherry2-C1 was employed. Fluorescent intensity of mNeonGreen and mCherry2 was obtained 48 h after transfection using a 2300 EnSpire multimode reader. The data were analyzed with a Welch’s t-test; p < 0.01 in green fluorescent intensity of mNeonGreen; p > 0.7 in red fluorescent intensity of mCherry2. Graphs show the relative fluorescent intensity of both fluorescent proteins (%).

Humanized mNeonGreen with a mitochondria-targeting signal was showed mitochondria-distribution

To investigate whether the pmNeonGreenHO-G is suitable for monitoring intracellular organelle, we generated a plasmid, pmNeonGreenHO-mito, for the expression of a mNeonGreen with a mitochondria-targeting signal. This plasmid was transfected into COS1 cells, and its green fluorescence in the cells were investigated. As shown in Fig 3, the humanized mNeonGreen with a mitochondria-targeting signal showed a representative distribution of mitochondria. Therefore, at least, the pmNeonGreenHO-G is available to monitor mitochondria morphology. The original mNeonGreen is available to investigate the other organelle-morphology [3].
Fig 3

Mitochondrial distribution of humanized mNeonGreen tagged with a mitochondria-targeting signal.

The plasmid pmNeonGreen-mito was transfected into COS1 cells. 48 h after transfection, the green fluorescent images in the cells were monitored using a BZ-X700 microscope. Bar indicates 50 μm.

Mitochondrial distribution of humanized mNeonGreen tagged with a mitochondria-targeting signal.

The plasmid pmNeonGreen-mito was transfected into COS1 cells. 48 h after transfection, the green fluorescent images in the cells were monitored using a BZ-X700 microscope. Bar indicates 50 μm. Considering the codon-optimization for Homo sapiens leads to no change of amino acid sequence of mNeonGreen protein itself, this plasmid can be used for monitoring the intracellular distribution of a certain protein as a fusion protein

Generation of mNeonGreen-3xFLAG expression plasmid

Clustal-W analyses revealed the amino acid sequence of mNeonGreen has low homology with that of EGFP (27% identity, 14% similarity; Table 1), indicating most commercially available anti-GFP antibodies will not react with mNeonGreen. To solve this problem, we generated the pmNeonGreenHO-3xFLAG expression plasmid (Fig 1). The plasmid was introduced into HEK293 cells and lysates prepared 24 h after transfection. Total proteins were separated by SDS-polyacrylamide gel electrophoresis, and the mNeonGreen-3xFLAG protein was recognized with an anti-FLAG-M2 antibody (Fig 4). As expected, an approximately 33 kDa band corresponding to mNeonGreen-3xFLAG was recognized. FLAG tags are one of the most employed epitopes for biochemical and cellular biology analyses. In conclusion, our pmNeonGreenHO-3xFLAG plasmid and mNeonGreen-3xFLAG fusion protein system will provide certain advantages to biochemical studies in mammalian cells.
Fig 4

Expression of humanized mNeonGreen-3xFLAG in HEK293 cells.

A pmNeonGreenHO-3xFLAG plasmid for expression of humanized mNeonGreen-3xFLAG was introduced into HEK293 cells. Cells were lysed 24 h after transfection, and total proteins in the lysate were separated on 12.5% SDS-polyacrylamide gels. The mNeonGreen-3xFLAG fusion protein was detected with an anti-FLAG M2 antibody. As a loading control, glyceraldehyde-3-phosphate dehydrogenase (GAPDH) was recognized using anti-glyceraldehyde-3-phosphate dehydrogenase antibody.

Expression of humanized mNeonGreen-3xFLAG in HEK293 cells.

A pmNeonGreenHO-3xFLAG plasmid for expression of humanized mNeonGreen-3xFLAG was introduced into HEK293 cells. Cells were lysed 24 h after transfection, and total proteins in the lysate were separated on 12.5% SDS-polyacrylamide gels. The mNeonGreen-3xFLAG fusion protein was detected with an anti-FLAG M2 antibody. As a loading control, glyceraldehyde-3-phosphate dehydrogenase (GAPDH) was recognized using anti-glyceraldehyde-3-phosphate dehydrogenase antibody.

The original fluorescent images of mNeonGreen used in Fig 3.

(TIF) Click here for additional data file.

The original immunoblotting images in Fig 4.

(A) The original immunoblotting data of Humanized mNeonGreen with 3xFlag tag using mouse monoclonal anti-Flag-M2 antibody. The lysate of cells transfected into pmNeonGreenHO-3xFLAG (mNeonGreenHO-3xFlag) or a control plasmid (CON) was separated on SDS-PAGE, and Flag-tagged proteins and GAPDH were recognized. From the left, molecular weight marker (Mk, lanes 1 and 7), negative control (CON) (lanes 2 and 8), mNeonGreen-3xFlag (lanes 3–6 and 9–12). (B) The original data of Humanized mNeonGreen with 3xFlag tag using a rabbit polyclonal anti-glyceraldehyde-3-phosphate dehydrogenase (GAPDH) antibody. As a loading control, GAPDH in the lysate was recognized after removing anti-Flag-M2 antibody. (TIFF) Click here for additional data file.
  12 in total

1.  Partitioning of lipid-modified monomeric GFPs into membrane microdomains of live cells.

Authors:  David A Zacharias; Jonathan D Violin; Alexandra C Newton; Roger Y Tsien
Journal:  Science       Date:  2002-05-03       Impact factor: 47.728

2.  Sample Preparation and Choice of Fluorophores for Single and Dual Color Photo-Activated Localization Microscopy (PALM) with Bacterial Cells.

Authors:  Juri N Bach; Giacomo Giacomelli; Marc Bramkamp
Journal:  Methods Mol Biol       Date:  2017

3.  Development of fluorescence expression tools to study host-mycoplasma interactions and validation in two distant mycoplasma clades.

Authors:  Tiffany Bonnefois; Marie-Stéphanie Vernerey; Valérie Rodrigues; Philippe Totté; Carinne Puech; Chantal Ripoll; François Thiaucourt; Lucía Manso-Silván
Journal:  J Biotechnol       Date:  2016-08-04       Impact factor: 3.307

4.  FACS-optimized mutants of the green fluorescent protein (GFP).

Authors:  B P Cormack; R H Valdivia; S Falkow
Journal:  Gene       Date:  1996       Impact factor: 3.688

5.  Multiple epitope tagging of expressed proteins for enhanced detection.

Authors:  R Hernan; K Heuermann; B Brizzard
Journal:  Biotechniques       Date:  2000-04       Impact factor: 1.993

6.  Quantitative assessment of fluorescent proteins.

Authors:  Paula J Cranfill; Brittney R Sell; Michelle A Baird; John R Allen; Zeno Lavagnino; H Martijn de Gruiter; Gert-Jan Kremers; Michael W Davidson; Alessandro Ustione; David W Piston
Journal:  Nat Methods       Date:  2016-05-30       Impact factor: 28.547

7.  Expression of varied GFPs in Saccharomyces cerevisiae: codon optimization yields stronger than expected expression and fluorescence intensity.

Authors:  Misato Kaishima; Jun Ishii; Toshihide Matsuno; Nobuo Fukuda; Akihiko Kondo
Journal:  Sci Rep       Date:  2016-10-26       Impact factor: 4.379

8.  A bright monomeric green fluorescent protein derived from Branchiostoma lanceolatum.

Authors:  Nathan C Shaner; Gerard G Lambert; Andrew Chammas; Yuhui Ni; Paula J Cranfill; Michelle A Baird; Brittney R Sell; John R Allen; Richard N Day; Maria Israelsson; Michael W Davidson; Jiwu Wang
Journal:  Nat Methods       Date:  2013-03-24       Impact factor: 28.547

9.  A new design for a green calcium indicator with a smaller size and a reduced number of calcium-binding sites.

Authors:  Natalia V Barykina; Oksana M Subach; Danila A Doronin; Vladimir P Sotskov; Marina A Roshchina; Tatiana A Kunitsyna; Aleksey Y Malyshev; Ivan V Smirnov; Asya M Azieva; Ilya S Sokolov; Kiryl D Piatkevich; Mikhail S Burtsev; Anna M Varizhuk; Galina E Pozmogova; Konstantin V Anokhin; Fedor V Subach; Grigori N Enikolopov
Journal:  Sci Rep       Date:  2016-09-28       Impact factor: 4.379

10.  Comparative assessment of fluorescent proteins for in vivo imaging in an animal model system.

Authors:  Jennifer K Heppert; Daniel J Dickinson; Ariel M Pani; Christopher D Higgins; Annette Steward; Julie Ahringer; Jeffrey R Kuhn; Bob Goldstein
Journal:  Mol Biol Cell       Date:  2016-07-06       Impact factor: 4.138

View more
  9 in total

1.  Photophysical Behavior of mNeonGreen, an Evolutionarily Distant Green Fluorescent Protein.

Authors:  Frederik Steiert; Eugene P Petrov; Peter Schultz; Petra Schwille; Thomas Weidemann
Journal:  Biophys J       Date:  2018-04-27       Impact factor: 4.033

2.  In-resin CLEM of Epon-embedded cells using proximity labeling.

Authors:  Takahito Sanada; Junji Yamaguchi; Yoko Furuta; Soichiro Kakuta; Isei Tanida; Yasuo Uchiyama
Journal:  Sci Rep       Date:  2022-07-01       Impact factor: 4.996

3.  Lineage tracing and analog recording in mammalian cells by single-site DNA writing.

Authors:  Theresa B Loveless; Joseph H Grotts; Mason W Schechter; Elmira Forouzmand; Courtney K Carlson; Bijan S Agahi; Guohao Liang; Michelle Ficht; Beide Liu; Xiaohui Xie; Chang C Liu
Journal:  Nat Chem Biol       Date:  2021-03-22       Impact factor: 16.174

4.  Visualization of cytoplasmic organelles via in-resin CLEM using an osmium-resistant far-red protein.

Authors:  Isei Tanida; Soichiro Kakuta; Juan Alejandro Oliva Trejo; Yasuo Uchiyama
Journal:  Sci Rep       Date:  2020-07-09       Impact factor: 4.379

5.  Two-color in-resin CLEM of Epon-embedded cells using osmium resistant green and red fluorescent proteins.

Authors:  Isei Tanida; Yoko Furuta; Junji Yamaguchi; Soichiro Kakuta; Juan Alejandro Oliva Trejo; Yasuo Uchiyama
Journal:  Sci Rep       Date:  2020-12-14       Impact factor: 4.379

6.  Establishment of the monomeric yellow-green fluorescent protein mNeonGreen for life cell imaging in mycelial fungi.

Authors:  Antonia Werner; Kolja L Otte; Gertrud Stahlhut; Stefanie Pöggeler
Journal:  AMB Express       Date:  2020-12-21       Impact factor: 3.298

7.  Increased expression of the fluorescent reporter protein ymNeonGreen in Saccharomyces cerevisiae by reducing RNA secondary structure near the start codon.

Authors:  Ronald E Hector; Jeffrey A Mertens; Nancy N Nichols
Journal:  Biotechnol Rep (Amst)       Date:  2021-12-31

8.  A genetically encoded BRET-based SARS-CoV-2 Mpro protease activity sensor.

Authors:  Anupriya M Geethakumari; Wesam S Ahmed; Saad Rasool; Asma Fatima; S M Nasir Uddin; Mustapha Aouida; Kabir H Biswas
Journal:  Commun Chem       Date:  2022-09-28

9.  α-/γ-Taxilin are required for centriolar subdistal appendage assembly and microtubule organization.

Authors:  Dandan Ma; Fulin Wang; Rongyi Wang; Yingchun Hu; Zhiquan Chen; Ning Huang; Yonglu Tian; Yuqing Xia; Junlin Teng; Jianguo Chen
Journal:  Elife       Date:  2022-02-04       Impact factor: 8.140

  9 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.