Literature DB >> 29290804

An Albumin-binding Polypeptide Both Targets Cytotoxic T Lymphocyte Vaccines to Lymph Nodes and Boosts Vaccine Presentation by Dendritic Cells.

Peng Wang1, Peng Zhao1, Shuyun Dong1, Tiefeng Xu2, Xiao He3, Mingnan Chen1.   

Abstract

Rationale: Albumin-binding carriers have been shown to target cytotoxic T lymphocyte (CTL) vaccines to lymph nodes (LNs) and improve the efficacy of the vaccines. However, it was not clear whether the improved efficacy is solely due to the LN targeting, which prompted this study.
Methods: First, we generated a fusion protein consisting of an albumin-binding domain (ABD) and an immune-tolerant elastin-like polypeptide (iTEP). Then, we examined the binding between this fusion protein, termed ABD-iTEP, and mouse serum albumin (MSA). Next, we evaluated the accumulation of ABD-iTEP in LNs and dendritic cells (DCs) in the LNs. We also analyzed antigen presentation and in vitro T cell activation of vaccines that were delivered by ABD-iTEP and investigated possible underlying mechanisms of the presentation and activation results. Last, we measured CTL responses induced by ABD-iTEP-delivered vaccines in vivo.
Results: ABD-iTEP bound with MSA strongly with an affinity of 1.41 nM. This albumin-binding carrier, ABD-iTEP, accumulated in LNs 3-fold more than iTEP, a control carrier that did not bind with albumin. ABD-iTEP also resulted in 4-fold more accumulation in DCs in the LNs than iTEP. Most importantly, ABD-iTEP drastically enhanced the antigen presentation of its vaccine payloads and the T cell activation induced by its payloads. The enhancement was dependent on the formation of the complex between MSA and ABD-iTEP. Meanwhile, the MSA/ABD-iTEP complex was found to have increased stability in acidic subcellular compartments and increased cytosolic accumulation in DCs, which might explain the enhanced vaccine presentation resulting from the complex. Finally, when ABD-iTEP was used to deliver CTL vaccines derived from both self- and non-self-antigens, it boosted the vaccine-induced responses by 2-fold in either case.
Conclusion: ABD-iTEP not only targets vaccines to LNs but also promotes the presentation of the vaccines by DCs. Albumin-binding carriers have more than one mechanism to boost the efficacy of CTL vaccines.

Entities:  

Keywords:  Albumin-binding domain; Antigen presentation; Cytosolic accumulation.; Cytotoxic T lymphocyte response; Lymph node targeting

Mesh:

Substances:

Year:  2018        PMID: 29290804      PMCID: PMC5743471          DOI: 10.7150/thno.21691

Source DB:  PubMed          Journal:  Theranostics        ISSN: 1838-7640            Impact factor:   11.556


Introduction

Vaccines that elicit cytotoxic T lymphocyte (CTL) responses are being developed as prophylactic and therapeutic modules to combat intracellular pathogens and cancers 1, 2. One promising strategy to enhance the effectiveness of CTL vaccines is to target them to lymph nodes (LNs) 3-5 because LNs are abundant with dendritic cells (DCs) and DCs are required to present these vaccines to CD8+ T lymphocytes and hence to initiate CTL responses 6-8. Further, in regard to cancer vaccines, there is an extra benefit to deliver the vaccines to LNs and enhance CTL responses there because tumors often metastasize through LNs 9. Boosting CTL responses in LNs may be an effective approach to halt metastasis 4, 5, 10. Among different strategies to target LNs 11-14, one takes advantage of the intrinsically high LN accumulation of serum albumin 13. This strategy is appealing because the high LN accumulation of albumin is transferable to those molecules that bind with albumin 14. To date, albumin-binding molecules have been used for LN targeting of imaging and therapeutic agents 15-18. In addition, an albumin-binding lipid was used to target vaccines to LNs and enhanced CTL responses 19. While it is clear that albumin-binding carriers are able to boost CTL responses induced by their delivered vaccines and that the boost can be attributed to the increased vaccine accumulation in LNs resulting from the carriers, it is actually not clear at all whether the boost is solely contributed by LN targeting. Whether the complex between albumin-binding carriers and albumin contribute to CTL responses through mechanisms other than LN-targeting was never reported. The speculation of such mechanisms was inspired by two discoveries: first, IgG enhances the DC-mediated presentation of the antigens that are delivered by IgG 20; second, the enhancement is mediated by a neonatal Fc receptor (FcRn) that IgG binds with 20-22. These two discoveries are related to albumin-binding carriers because albumin, like IgG, is a ligand of the FcRn 23. Thus, it would be interesting to investigate whether albumin-binding carriers boost their vaccine payloads through promoting the presentation of vaccines. To investigate interplays between albumin or albumin-binding carriers with the immune system, we designed a single polypeptide-based vaccine carrier, termed ABD-iTEP, that consists of an albumin-binding domain (ABD) and an immune-tolerant elastin-like polypeptide (iTEP). ABD is a 46-residue protein domain derived from protein G 24. ABD has very high binding affinities with albumin of humans, monkeys, and mice and has proven biocompatibility 25-27. iTEPs are peptide polymers with proven immuno-compatibility and reversible phase-transition property 28. We used iTEP in this carrier for the following four reasons: (1) We used iTEP to link ABD and CTL vaccines together but with a distance so that ABD and the vaccines will be delivered to the same cell yet the vaccines will not interfere with the functions of ABD. (2) ABD, iTEP and CTL vaccines are all proteins and peptides in nature so we can generate a recombinant fusion protein consisting of all three of them just like other iTEP fusion proteins we have generated before 29, which offers us a simple method to produce highly reproducible vaccine carriers for this study. (3) Fusion proteins that contain iTEP can be purified by cycling the salt-induced, reversible phase transition 28. Such easy purification method would facilitate the production of the carrier for this study. (4) The particular iTEP used in this study is hydrophilic and able to solubilize hydrophobic vaccines, thus avoiding the solubility problem that was associated with the previous albumin-binding vaccine carrier 19. In this study, we found that ABD-iTEP had a high affinity with mouse serum albumin (MSA). Through the binding with MSA, ABD-iTEP showed an improved LN accumulation and DC accumulation as compared to iTEP. In addition, the association between ABD-iTEP and MSA promoted the antigen presentation of the vaccine delivered by ABD-iTEP. Meanwhile, the complex between MSA and ABD-iTEP had an increased cytosolic accumulation and an increased stability in acid intracellular compartments, which may facilitate antigen presentation. And finally, ABD-iTEP was able to enhance CTL responses of both non-self- and self-antigens.

Materials and Methods

Animals and cell lines

Female C57BL/6 mice, 4-8 weeks of age, were bred and treated in accordance with an approved protocol by the University of Utah Institutional Animal Care and Use Committee (IACUC). DC2.4 cell line (H-2Kb) was kindly provided by Dr. Kenneth Rock (University of Massachusetts). DC2.4 cells were cultured in RPMI 1640 medium supplemented with 10% fetal bovine serum (FBS), 2 mM L-glutamine, 1% nonessential amino acids, 10 mM HEPES, 50 µM 2-mercaptoethanol, 100 U/mL penicillin and 100 µg/mL streptomycin (Life Technologies). The B3Z T cell hybridoma specific for H-2Kb/SIINFEKL complex was kindly provided by Dr. Nilabh Shastri (University of California, Berkeley). B3Z cells were cultured with RPMI 1640 medium supplemented with 10% FBS, 2 mM L-glutamine, 1 mM sodium pyruvate, 50 µM 2-mercaptoethanol, 100 U/mL penicillin and 100 µg/mL streptomycin. All cells were cultured in 37 °C with 5% CO2.

Preparation of recombinant polypeptides

Genes encoding iTEP, ABD, pOVA, and pTRP2 were synthesized (Eurofins Genomics) and inserted into the modified pET25b (+) vector using a previously described method 28. The inserted genes were verified by DNA sequencing (Genewiz). The expression and purification of those recombinant polypeptides were conducted as previously reported 30.

Removal of endotoxin

The endotoxin present in the recombinant polypeptides was removed by the reported method 31. The amount of residual endotoxin in each sample was determined by Limulus Amebocyte Lysate (LAL) single-test vials (Charles River Laboratories). All polypeptides used for in vitro and in vivo immune assays had an endotoxin level < 0.25 EU/mg.

Native polyacrylamide gel electrophoresis (PAGE)

20 µM MSA (Sigma-Aldrich) was incubated with ABD-iTEP of different concentrations including 10, 20, 40 and 80 µM overnight at 4 °C. 5 µL of each sample was mixed with 5 µL sample buffer and loaded into each well of the gel. The electrophoresis was run at 150 V for 2 h. The gel was then stained with Coomassie Brilliant Blue R-250 dye. The image of the gel was taken using the FluorChem FC2 imaging system (Alpha Innotech).

Size exclusion chromatography (SEC)

SEC was conducted on an Agilent 1260 infinity liquid chromatography system (Agilent Technologies) equipped with an Agilent ZORBAX GF-450 size exclusion column (diameter: 9.4 mm, length: 250 mm, particle diameter: 6.0 µm). 60 µM ABD-iTEP was incubated with 30 µM MSA overnight at 4 °C. 100 µL sample was loaded for analysis. Samples were eluted with PBS at a flow rate of 1 mL/min. Spectra were monitored by absorption at 280 nm.

Surface plasmon resonance (SPR) assay

The SPR measurement of binding affinities were measured by a MASS-1 SPR instrument (Sierra Sensors). Following a standard amine-coupling procedure, MSA was immobilized on a SPR affinity sensor (High Capacity Amine, Sierra Sensors). iTEP, ABD-iTEP, iTEP-pOVA, and ABD-iTEP-pOVA were diluted in running buffer (10 mM HEPES pH 7.4, 150 mM NaCl, 3 mM EDTA, 0.05% Tween-20 and 0.2 mg/mL ovalbumin) to 10 nM. The samples were injected at a constant flow rate of 25 µL/min for 3 min, followed by injection of running buffer for 30 min. After each injection cycle, the surface was regenerated with two injections of 25 µL of 10 mM HCl. After subtracting reference surface and buffer injection, the data were fitted to the one-to-one Langmuir binding model with mass transport limitations to calculate the association rate constant (ka), the dissociation rate constant (kd), and the overall affinity (KD), using the MASS-1 analysis software (Sierra Sensors).

LN accumulation, biodistribution and pharmacokinetic study

ABD-iTEP and iTEP were labelled with Alexa Fluor 488 sulfodichlorophenol ester (Life Technologies) following the manufacturer's protocol. Mice were subcutaneously injected with 1.5 nmol of ABD-iTEP or iTEP at each side of their tail bases. Draining LNs (inguinal and axillary LNs), kidney, liver, lung, spleen and blood of the mice were collected at 6, 12, 24 and 48 h after injection. The blood was left at room temperature for 30 min before centrifuging to collect the serum. The organs were then homogenized in cold PBS and sonicated using a model 500 sonic dismembrator (Fisher Scientific). Samples were centrifuged, and the supernatant was collected to measure the fluorescence intensity (excitation 494 nm, emission 518 nm) using an Infinite M1000 pro microplate reader (Tecan). The quantity of iTEP or ABD-iTEP in the tissues was determined by referencing the standard curves of fluorescence intensity of ABD-iTEP and iTEP. One compartment model for extravascular administration was used to calculate the pharmacokinetic metrics of ABD-iTEP and iTEP.

In vivo dendritic cell accumulation assay

C57BL/6 mice were subcutaneously injected with 1.5 nmol of Alexa Fluor 488 labelled iTEP or ABD-iTEP at each side of the base of tail. Inguinal and axillary LNs were isolated 6 h after injection. LNs were pooled and mechanically homogenized to prepare a single-cell suspension by passing through a 40 µm nylon mesh. Cells were then washed and stained with PE anti-mouse CD11c (Clone: N418, Biolegend) and 4′,6-diamidino-2-phenylindole (DAPI). Flow cytometric analysis was conducted using a BD Canto (BD Biosciences). The results were analyzed by FlowJo software.

In vitro dendritic cell uptake assay

This assay was conducted using a previous method with some modifications 32. DC2.4 cells were cultured with medium containing 5 µM fluorescein-labelled polypeptides for 2 h. The medium was then removed and cells were washed. Trypan blue was added to quench extracellular fluorescence and cells were washed another two times. 0.2% Triton X-100 was added to lyse the cells and release the endocytosed polypeptides. The amount of endocytosed polypeptide was detected by measuring the fluorescence intensity.

Antigen presentation assay

DC2.4 cells were cultured in medium containing vaccines at a concentration of 5 µM for 16 h. The cells were then collected and stained with PE anti-mouse H-2Kb/SIINFEKL antibody (Clone: 25-D1.16, Biolegend) and DAPI. SIINFEKL (pOVA) presented on the cellular surface was quantified by flow cytometric analysis. The results are presented as median fluorescence intensity (MFI) relative to the MFI of untreated DC2.4 cells.

B3Z cell activation assay

B3Z cell is a CD8+ T-cell hybridoma 33. Upon recognition of H-2Kb/SIINFEKL complex, B3Z cells will be activated to produce β-galactosidase, which can hydrolyze the substrate into red products. The level of activation of the CD8+ T cells will be reflected by the color of the solution. To do this assay, DC2.4 cells were cultured with medium containing vaccines at a concentration of 5 µM for 16 h. The cells were subsequently co-cultured with B3Z cells for 24 h. Then the cells were lysed for 4 h at 37 °C with lysis buffer (PBS with 100 mM 2-mercaptoethanol, 9 mM MgCl2, 0.2% Triton X-100 and 0.15 mM chlorophenol red-β-D-galactopyranoside). The reaction was stopped by adding the stop buffer (1 M sodium carbonate). CD8+ T cell activation were quantified by measuring the absorbance at 570 nm with 635 nm as a reference wavelength. The B3Z cell activation is shown as the normalized optical density (OD) relative to the control group.

Preparation of MSA/ABD-iTEP-pOVA complex

MSA was incubated with ABD-iTEP-pOVA overnight at 4 °C. Then MSA/ABD-iTEP-pOVA was purified by ÄKTA fast protein liquid chromatography system (GE Healthcare) equipped with a HiPrep Sephacryl S-200 HR column (diameter: 26 mm, length: 600 mm, particle diameter: 50 µm, GE Healthcare). Samples were eluted with PBS at a flow rate of 1 mL/min. The fractions containing the MSA/ABD-iTEP-pOVA complex were combined and concentrated by Vivaspin spin columns (Molecular mass cut-off: 10,000 kDa, GE Healthcare).

Subcellular accumulation study

DC2.4 cells were cultured with medium containing fluorescein-labelled ABD-iTEP-pOVA or the MSA/ABD-iTEP-pOVA complex at a concentration of 5 µM for 2 h. The cells were then washed and traced for various time as indicated in the figure. At the end of each traced time, cells were collected for subcellular fractionation by the method described previously 34 to obtain the cytosolic and vesicular fractions. The amount of ABD-iTEP-pOVA and MSA/ABD-iTEP-pOVA in these subcellular compartments were quantified by measuring the fluorescence intensity of the fractions.

Fluorescence microscopy

Poly-lysine-treated coverslips were added into wells of a 24-well plate. DC2.4 cells were incubated with medium containing either the fluorescein-labelled ABD-iTEP-pOVA or the MSA/ABD-iTEP-pOVA complex at a concentration of 15 µM for 2 h. The cells were then washed and chased for 2 h. After that, the cells were stained with LysoTracker Red DND-99 (Life Technologies). Next, the cells were fixed with 4% paraformaldehyde and stained with DAPI. The coverslips were mounted with Fluoromount-G (SouthernBiotech). Fluorescence images of the DCs were captured under Nikon Eclipse Ti microscope with 40× magnification at room temperature and analyzed by Coloc 2 plugin in Fiji software. The proportion of samples that were co-localized with vesicles including lysosomes and endosomes was determined using Manders' overlap coefficient 35.

Animal vaccination and enzyme-linked immunospot (ELISPOT) assay

C57BL/6 mice were subcutaneously injected with 1.5 nmol vaccines at each side of the tail base on day 0 and day 7. The mice were sacrificed on day 17 and their splenocytes and LN cells were harvested to perform the IFN-γ ELISPOT assay following a previous method 28. Generally, splenocytes were stimulated with medium containing CTL epitopes, SIINFEKL (pOVA) or SVYDFFVWL (pTRP2) for 48 h. Cells were then transferred to a filter plate (Millipore) coated with anti-mouse IFN-γ antibody (Clone: R4-6A2, Biolegend) and cultured for 24 h. The secreted IFN-γ was detected by orderly adding biotinylated anti-mouse IFN-γ antibody (Clone: XMG1.2, Biolegend), horseradish peroxidase avidin (Avidin-HRP), and 3-amino-9-ethylcarbazole (AEC). The spots on the membranes were scanned and counted by Fiji software 35. According to the assay design, only CD8+ T cells with T cell receptors that match the used epitopes are stimulated by the epitopes and release IFN-γ.

Statistical analysis

A two-tailed, unpaired Student's t test and one-way analysis of variance (ANOVA) with the Bonferroni post-test were used to analyze the data. P < 0.05 was considered a significant difference.

Results

ABD-iTEP binds MSA with nanomolar affinity

ABD-iTEP and its control iTEP were designed and produced as recombinant proteins using our previously developed method 28, 29. The sequences of ABD-iTEP and iTEP are shown in Table . ABD-iTEP and iTEP have theoretical molecular mass of 29.7 kDa and 24.6 kDa, respectively. After we generated ABD-iTEP, we first examined the binding between ABD-iTEP and MSA through native polyacrylamide gel electrophoresis (PAGE). There was a clear association between the two proteins, evidenced as a new band of the MSA/ABD-iTEP complex on the native gel (Fig. ). We observed that the intensity of the new band increased along with an increase in the ratio of ABD-iTEP to MSA. Meanwhile, the intensity of the MSA band decreased with an increase in the ratio. The MSA band disappeared completely when the ratio reached 4:1, suggesting that MSA was consumed by complexing with ABD-iTEP. We noticed that ABD-iTEP couldn't be stained by Coomassie Brilliant Blue R-250 in the native gel (Fig. -lane 1). This is likely due to the scarcity of positively charged and hydrophobic residues in ABD-iTEP (11 among all 268 residues, Table ). Coomassie dye molecules bind to proteins through positively charged and hydrophobic residues in the proteins 36. However, the MSA/ABD-iTEP complex can be stained because of MSA. Together, these results suggested that ABD-iTEP bound MSA. This conclusion was affirmed by the result of the size exclusion chromatography (SEC) analysis of the mixture of ABD-iTEP and MSA. On a chromatogram recorded at 280 nm absorbance (Fig. ), MSA emerged as a peak at 10.04 min; ABD-iTEP did not have a peak at the injected amount (6.0 nmol) because of its low extinction coefficient (2980 M-1 cm-1) at 280 nm; the mixture of ABD-iTEP and MSA resulted in a new peak at 9.16 min, presumably the MSA/ABD-iTEP complex. We quantified the binding affinity between ABD-iTEP and MSA by using the surface plasmon resonance (SPR) method (Fig. ). According to binding kinetic data, the association rate constant (ka) between the two proteins was calculated as 2.17±0.07 ×106 M-1s-1; the dissociation rate constant (kd) was 3.05±0.01 ×10-3 s-1. The dissociation constant (KD) between ABD-iTEP and MSA was calculated as 1.41±0.04 nM, which is similar to the reported KD value between ABD and MSA (1.24±0.01 nM) 25. The similar KD values suggested that fusing iTEP to ABD did not interfere with the interaction between ABD and MSA. As a control, iTEP did not bind with MSA (Fig. ).

ABD increases the LN accumulation of ABD-iTEP

We compared the accumulation of ABD-iTEP and iTEP in draining LNs (inguinal and axillary LNs) at 6, 12, 24, and 48 h post injection of the samples at the tail base of mice. Both ABD-iTEP and iTEP reached their peak accumulation in LN at 6 h after injection, 1.31 ± 0.11% and 0.36 ± 0.02% (P < 0.01) of injected doses (ID), respectively (Fig. ). At all of the time points, the LN accumulation of ABD-iTEP was at least 3.5-fold higher than that of iTEP. More strikingly, ABD-iTEP accumulated more in LNs than in those organs where macromolecules typically accumulate: liver, kidney, spleen and lung 37, 38. The LN accumulation of ABD-iTEP per tissue mass was 4- to 10-fold higher than that of kidneys across all observed time points (Fig. ). The superior LN accumulation of ABD-iTEP was even more prominent when the accumulation was compared to the accumulation in liver, spleen, and lungs (Fig. ). In sharp contrast, iTEP had the highest accumulation in kidneys (Fig. ). The higher renal accumulation of iTEP (42.20 %ID/g at 12 h post injection) than ABD-iTEP (22.99 %ID/g at 12 h post injection) may be attributed to the factor of molecular weights (MW) of polypeptides and the renal filtration threshold. The renal filtration threshold for proteins is ~70 kDa: those proteins with MW >70 kDa have significantly decreased clearance from blood to the glomerular capsule of the kidney 39. iTEP has a MW of 24.6 kDa, whereas ABD-iTEP, when complexed with MSA, has a MW of 98.45 kDa. Thus, it is easier for iTEP than the MSA/ABD-iTEP complex to accumulate in the glomerular capsule of the kidney, which explains why iTEP apparently has a higher renal accumulation than ABD-iTEP. We next investigated whether the increased LN accumulation of ABD-iTEP led to an increased accumulation of ABD-iTEP by DCs in LNs. The accumulation of ABD-iTEP in the DCs is critical for the vaccine delivery function of ABD-iTEP. We collected and analyzed DCs from draining LNs of the ABD-iTEP- and iTEP-treated mice and found that the ABD-iTEP-positive fraction among all collected DCs from the ABD-iTEP-treated mice was 13.1 ± 1.4%, which was significantly greater than the iTEP-positive fraction from the iTEP-treated mice, 3.1 ± 0.5% (P < 0.05, Fig. ). Therefore, DCs in draining LNs accumulate more ABD-iTEP than iTEP. The greater accumulation of ABD-iTEP was not likely due to DCs preferentially internalizing ABD-iTEP or its complex with MSA. Indeed, DCs internalized ABD-iTEP, iTEP, and MSA/ABD-iTEP equally in vitro (Fig. ). Thus, the greater accumulation of ABD-iTEP by DCs in LNs is likely due to the increased accumulation of ABD-iTEP in LNs and the consequently increased exposure of ABD-iTEP to the DCs. We also analyzed pharmacokinetics (PK) of ABD-iTEP and iTEP based on serum concentration changes of the two samples after administration (Fig. ). We compared the PK by five metrics, AUC (area under the curve), Cmax (the peak serum concentration after administration), Tmax (the time to reach Cmax), t1/2(abs) (absorption half-life), and t1/2(elim) (elimination half-life) (Table ). The two polypeptides are different in AUC, Cmax, and t1/2(elim): the AUC of ABD-iTEP is ~4-fold higher than that of iTEP (1.20 µg·h/µL versus 0.29 µg·h/µL); the Cmax of ABD-iTEP is also ~4-fold higher than that of iTEP (0.0328 µg/µL versus 0.0083 µg/µL); ABD-iTEP has a longer t1/2(elim) than iTEP (51.6 h versus 24.1 h). In contrast, ABD-iTEP and iTEP have similar Tmax (12.4 h versus 12.8 h) and t1/2(abs) (2.8 h versus 4.2 h). ABD-iTEP is expected to have longer t1/2(elim) than iTEP because albumin-binding molecules have long t1/2(elim) 25, 27, 40. Consistently, the long half-life of ABD-iTEP leads to the greater AUC and Cmax of ABD-iTEP. The similar Tmax and t1/2(abs) of ABD-iTEP and iTEP suggest that ABD doesn't affect the absorption of ABD-iTEP. The greater AUC of ABD-iTEP is advantageous for its vaccine delivery function as this allows ABD-iTEP to deliver more vaccine payloads to spleen and other lymphatic organs 41. Putting together these results, we concluded that ABD increases the LN accumulation and plasma half-life of ABD-iTEP and boosts the accumulation of ABD-iTEP in DCs in LNs.

ABD-iTEP promotes the antigen presentation of its vaccine payload through complexing with MSA

To examine the effectiveness of ABD-iTEP as a vaccine carrier, we generated a fusion polypeptide consisting of ABD-iTEP and pOVA (sequence: SIINFEKL), a CTL epitope derived from chicken ovalbumin (Table ). pOVA was fused to the C-terminus of ABD-iTEP. The fusion was termed ABD-iTEP-pOVA. ABD-iTEP-pOVA had a similar binding affinity with MSA as ABD-iTEP (K =1.4±0.1 nM, Fig. ). We also generated a control fusion, iTEP-pOVA. Using ABD-iTEP-pOVA and iTEP-pOVA, we first examined whether the carrier ABD-iTEP, without forming a complex with MSA, enhanced immune responses toward its vaccine payload, pOVA. We used the B3Z cell-based in vitro T cell activation assay to measure the immune responses because pOVA, when presented by DCs, activates B3Z cells. B3Z is a CD8+ T cell clone that is restricted to pOVA. We found that ABD-iTEP-pOVA and iTEP-pOVA, after being incubated and presented by DCs, were equally effective in activating B3Z cells (Fig. ). The data suggested that ABD-iTEP, alone, was not different to iTEP in enhancing immune responses toward its vaccine payload. The empty carrier, ABD-iTEP, didn't activate any B3Z cells as compared to the untreated B3Z cells (Fig. ). We next investigated whether the carrier ABD-iTEP would enhance pOVA-induced immune responses differently when it was and was not associated with MSA. This is an unanswered yet important question for albumin-binding carriers because the majority of administered carriers likely complex with MSA before they interact with DCs. To answer this question, we compared the purified MSA/ABD-iTEP-pOVA complex and free ABD-iTEP-pOVA using the aforementioned B3Z cell activation assay. MSA/ABD-iTEP-pOVA was found to be 2-fold more potent than free ABD-iTEP-pOVA in activating B3Z cells (Fig. ). The superior activation could have two possible causes: the presence of the MSA/ABD-iTEP-pOVA complex and the mere presence of MSA in the assay. To investigate which cause is true, we compared iTEP-pOVA with the mixture of MSA and iTEP-pOVA using the B3Z activation assay. We found that the two samples have the same capacity to activate B3Z cells (Fig. ). Thus, the mere presence of MSA does not improve B3Z activation results of the MSA/ABD-iTEP-pOVA complex. Thus, the superior activation of the complex is due to interactions between MSA and ABD-iTEP-pOVA. We further explored how the MSA/ABD-iTEP-pOVA complex was able to lead to stronger B3Z activation than free ABD-iTEP-pOVA. We suspected that the MSA/ABD-iTEP-pOVA complex led to greater pOVA presentation by DCs than ABD-iTEP-pOVA because greater epitope presentation leads to stronger B3Z cell activation. Thus, we investigated pOVA presentation by DCs after we incubated the DCs with the MSA/ABD-iTEP-pOVA complex or free ABD-iTEP-pOVA. We examined the presentation by using an antibody that specifically binds with pOVA presented with MHC class I molecules on the DC surface and a flow cytometry assay. Indeed, we found that the MSA/ABD-iTEP-pOVA complex led to a 5-fold greater pOVA presentation than free ABD-iTEP-pOVA, as indicated by the 5-fold higher relative median fluorescence intensity (MFI) from the DCs incubated with the MSA/ABD-iTEP-pOVA complex than the DCs incubated with free ABD-iTEP-pOVA (Fig. ). In summary, the MSA/ABD-iTEP-pOVA complex is advantageous not only for LN targeting but also for CD8+ T cell activation. Further, the superior T cell activation resulting from the complex can be attributed to the increased presentation of vaccines that are delivered by the complex.

The MSA/ABD-iTEP-pOVA complex has increased cytosolic accumulation and endosomal/lysosomal stability

Inspired by the fact that the MSA/ABD-iTEP-pOVA complex enhanced antigen presentation by DCs, we expanded our exploration on interactions between the complex and DCs with a focus on those interactions that may affect the antigen presentation. We first compared the endocytosis of the MSA/ABD-iTEP-pOVA complex and ABD-iTEP-pOVA by DCs because greater endocytosis should facilitate vaccine accumulations in DCs and hence increase antigen presentation. We found that DCs internalized a similar amount of the MSA/ABD-iTEP-pOVA complex and free ABD-iTEP-pOVA (Fig. ). This result agrees with the data showing that DCs have the same uptake of the empty carrier, ABD-iTEP, whether the carrier is associated with MSA or not (Fig. ). Therefore, endocytosis is not a reason for the greater antigen presentation resulting from the MSA/ABD-iTEP-pOVA complex (Fig. ). We then compared cytosolic accumulation of the MSA/ABD-iTEP-pOVA complex and ABD-iTEP-pOVA in DCs. It is in the cytosol of DCs where CTL vaccines are processed and CTL epitopes are released from the vaccines before the epitopes are presented by DCs on the cell surface 42. Thus, more CTL vaccines reaching the DC cytosol after internalization means that more vaccines are available for cytosolic processing and subsequent epitope presentation. For comparison, we traced the amount of the complex and free ABD-iTEP-pOVA in DC cytosol after incubated them with DCs. At the beginning of the tracing, the complex and free ABD-iTEP-pOVA had comparable cytosolic accumulation (Fig. ). However, while the cytosolic ABD-iTEP-pOVA decreased rapidly within 4 h of tracing, the amount of the complex remained almost unchanged (Fig. ). After we normalized the quantity of cytosolic complex and free ABD-iTEP-pOVA against their quantity at the beginning of the tracing, we found that cytosolic ABD-iTEP-pOVA decreased by ~60% and ~70% during the first 2 h and 4 h of the tracing, while the complex only decreased by ~20% and ~25% during the same period (Fig. ). Interestingly, by using the same tracing approach, we also found that the MSA/ABD-iTEP-pOVA complex was more stable than free ABD-iTEP-pOVA in endosomes and lysosomes (Fig. ). During the 4 h tracing, the quantity of free ABD-iTEP-pOVA decreased by 70%, while the quantity of the complex in endosomes and lysosomes decreased by 25% (Fig. . In addition, the major decrease of free ABD-iTEP-pOVA happened in the first 2 h of tracing. These tracing results are consistent with the fluorescence microscopy data we obtained at 2 h after the tracing started (Fig. ). Analysis of these fluorescence imaging data (Fig. ) indicated that the proportion of the MSA/ABD-iTEP-pOVA complex that was overlapped with endosomes and lysosomes was significantly higher than the proportion of free ABD-iTEP-pOVA that was overlapped with these vesicles (Fig. ). Putting together all the interactions between the complex and DCs that we have discovered so far, it is likely that the greater cytosolic accumulation of the MSA/ABD-iTEP-pOVA complex over free ABD-iTEP-pOVA may contribute to the greater pOVA presentation caused by the complex. The high cytosolic accumulation of the MSA/ABD-iTEP-pOVA complex may be related to the increased stability of the complex in endosomes and lysosomes, although a clear elucidation of the relationship between the stability of the complex and the cytosolic accumulation of the complex requires further investigation.

ABD-iTEP enhances the CTL responses of both non-self- and self-antigens in vivo

Since ABD-iTEP had increased LN accumulation and boosted the DC presentation of vaccines it delivered, we next examined whether ABD-iTEP enhanced in vivo CTL responses toward vaccines it delivered. To this end, we compared ABD-iTEP-pOVA, iTEP-pOVA, and ABD-iTEP for their ability to induce pOVA-specific CTL responses using the IFN-γ based ELISPOT assay 43, 44. We found that ABD-iTEP-pOVA induced 2-fold stronger CTL responses than iTEP-pOVA: splenocytes from the ABD-iTEP-pOVA-immunized mice generated 78.4±12.7 spots per 2×105 cells while splenocytes from the iTEP-pOVA-immunized mice only generated 39.2±6.5 spots per 2×105 cells (P < 0.01, Fig. ). The splenocytes from the ABD-iTEP-immunized mice only generated several spots per 2×105 cells (Fig. ), suggesting the carrier itself did not induce any CTL response. Taken together, these results point to the conclusion that ABD-iTEP enhanced CTL responses as a vaccine carrier. Next, we expanded the investigation beyond pOVA by using ABD-iTEP to deliver self-antigens. Self-antigens are generally poorly immunogenic because of self-tolerance. However, these antigens are important in immunotherapies for cancer 2, 45, thus it is worthwhile to examine whether ABD-iTEP also enhance CTL responses against these antigens. To this end, we fused an epitope, pTRP2 (sequence: SVYDFFVWL) to ABD-iTEP and iTEP. pTRP2 is derived from a melanoma-associated self-antigen, tyrosinase-related protein 2 (TRP2) 46. The fusions were termed ABD-iTEP-pTRP2 and iTEP-pTRP2, respectively (Table ). According to CTL vaccination results, we found that ABD-iTEP-pTRP2 induced 2-fold stronger CTL response than iTEP-pTRP2 based on the IFN-γ ELISPOT result (57.25±11.16 spots per 2×105 cells versus 27.00±2.04 spots per 2×105 cells, P < 0.05, Fig. ). In addition to the systemic CTL responses using splenocytes, we also checked the local CTL responses toward the antigen by analyzing lymphocytes from draining LNs. The results showed that ABD-iTEP-pTRP2 also induced ~2-fold stronger CTL responses than iTEP-pTRP2 in the LNs (52.33±3.48 spots per 2×105 cells versus 24.33±2.67 spots per 2×105 cells, P < 0.01, Fig. ). An enhancement of CTL responses in draining LNs is particularly important to tumor immunotherapy. Because tumors utilize the draining LNs to metastasize 9, and thus, a strong anti-tumor CTL response in the LNs could help to halt metastasis 4, 5, 10. Taking all in vivo CTL vaccination results together, we found that ABD-iTEP boosted CTL responses of both non-self-antigens and self-antigens it delivered. Such boosts can be detected at both the systemic and the regional LN levels.

Discussion and Conclusions

Targeting CTL vaccines to LNs is an attractive strategy to improve the efficacy of CTL vaccines. Here, we developed a polypeptide-based, albumin-binding carrier to target CTL vaccines to LNs. More importantly, we established a new mechanism by which albumin-binding vaccine carriers facilitate CTL vaccines. Through this study, we gained new insights in the three following aspects. First, ABD-iTEP, as an albumin-binding vaccine carrier, enhanced a wide range of vaccines, whether they are from self-antigens or non-self-antigens. Equally important, we were able to unambiguously attribute the enhancement to the association between the carrier and albumin because of our experimental design: we compared vaccine-induced CTL responses between ABD-iTEP and iTEP, an otherwise very similar carrier that does not bind with albumins. Such conclusiveness sets our study apart from the previous study of albumin-binding vaccine carriers where CTL responses were compared between free peptide vaccines and peptide vaccines delivered by an albumin-binding, micellar carrier 19. These compared vaccines are different for not only the albumin-binding factor but also the micellar carrier factor. Thus, it is difficult to attribute different CTL responses solely to the factor of albumin-binding, although this factor likely contributed to the difference. Indeed, it was reported that peptide vaccines with or without a carrier have different capacities to induce responses 28, 47, 48. In addition to the distinct experimental design differences between our study and the previous study, it is worth mentioning four interrelated features of ABD-iTEP that make it a robust delivery platform to realize advantages of albumin-binding carriers: (1) ABD-iTEP is a recombinant protein that is easy to produce, and no conjugation is needed to generate this carrier; (2) ABD-iTEP has absolute reproducibility and homogeneity across production batches; (3) ABD-iTEP is biodegradable and biocompatible; and (4) ABD-iTEP has no solubility issues, as reported in the previous albumin-binding vaccine carrier 19. Second, our data have shown that albumin-binding vaccine carriers not only target vaccines to LNs but also promote the antigen presentation of vaccines. Further, we elucidated, by using a series of control treatments, that the improved antigen presentation was not due to the presence of the albumin-binding domain in the carriers or albumin in the experimental system. Instead, the improvement relies on the formation of the complex between MSA and ABD-iTEP-pOVA. Thus, albumin-binding vaccine carriers, for the first time, were found to have a second mechanism to boost vaccine-induced immune responses. This mechanism very likely contributed to the previously reported enhancement of CTL responses that was caused by albumin-binding carriers 19, although this mechanism was never proposed or investigated. The discovery of this new mechanism not only supports a new utility of albumin-binding carriers to improve antigen presentation, but also inspires more efforts to explore mechanisms that these carriers possess to support their delivery function. Last, we discovered three interesting relationships between the MSA/ABD-iTEP-pOVA complex and DCs that may or may not explain the improved antigen presentation. Discovery one, DCs internalize a similar amount of the MSA/ABD-iTEP-pOVA complex and free ABD-iTEP-pOVA, suggesting the improved presentation was not due to an increased uptake of the complex. Discovery two, the complex has a steady presence in DC cytosol as compared to free ABD-iTEP-pOVA. Because both the MSA/ABD-iTEP-pOVA complex and free ABD-iTEP-pOVA are transferred from endosomes to the cytosol and they are both degraded inside the cytosol before epitopes from them are presented by DCs 6-8, the stable presence of the complex may be caused by one of two following possible reasons, or both: (1) the endosome-to-cytosol translocation process replenishes more complex than free ABD-iTEP-pOVA into the cytosol, and (2) the complex is more stable than free ABD-iTEP-pOVA in the cytosol. While the idea of the increased translocation agrees with the improved presentation, the idea of the increased cytosolic stability disagrees with the improved presentation because cytosolic vaccines need to be degraded before the antigen presentation of the vaccines by DCs. Discovery three, the complex is more stable than free ABD-iTEP-pOVA in acidic organelles in DCs. This result is consistent with the above proposed translocation idea because more complex in endosomes and lysosomes would allow more complex to be transported to the cytosol. The increased stability in acidic organelles has been reported for IgG-complexed vaccines and was used to explain the improved presentation of these vaccines 20-22. The increased stability was credited to interactions between IgG and FcRn in acidic organelles such as endosomes and lysosomes. Indeed, FcRn binds with albumin and rescues it from degradation in acidic organelles 49, 50. Interactions between albumin and FcRn was previously proposed as one explanation for the extraordinary stability of albumin in the body 27, 40. Putting together all three discoveries, a simple and plausible mechanism to explain the improved antigen presentation is as follows: the MSA/ABD-iTEP-pOVA complex interacts with FcRn in endosomes and lysosomes and hence becomes more stable and abundant there; consequently, more complex is transferred from these acidic organelles to the cytosol; eventually, more of the complex is available for processing in the cytosol so that more epitopes are released from the complex and presented by DCs. It would be interesting to test whether this hypothetical mechanism is true or not in future studies. In summary, we developed a novel albumin-binding carrier, ABD-iTEP, that enhanced the effectiveness of CTL vaccines through two mechanisms: (1) increasing the LN and DC accumulation of the vaccines; (2) promoting the antigen presentation of the vaccines.
Table 1

Names and sequences of polypeptides used in current study

PolypeptidesSequences (from N- to C-terminus)Molecular mass (kDa)
iTEP a(GVGVPG)35-(GVLPGVG)1624.6
ABD-iTEP bLAEAKVLANRELDKYGVSDFYKRLINKAKTVEGVEALKLHILAALP-(GVGVPG)35-(GVLPGVG)1629.7
iTEP-pOVA c(GVGVPG)35-(GVLPGVG)16-GSIINFEKL25.6
ABD-iTEP-pOVALAEAKVLANRELDKYGVSDFYKRLINKAKTVEGVEALKLHILAALP-(GVGVPG)35-(GVLPGVG)16-GSIINFEKL30.7
iTEP-pTRP2 c(GVGVPG)35-(GVLPGVG)16-GSVYDFFVWL25.9
ABD-iTEP-pTRP2LAEAKVLANRELDKYGVSDFYKRLINKAKTVEGVEALKLHILAALP-(GVGVPG)35-(GVLPGVG)16-GSVYDFFVWL30.9

a The number in the subscript represents the repeating number of the sequences in parentheses.

b ABD was fused at the N-terminus of iTEP. The letters in bold represent positively charged or hydrophobic residues.

c pOVA and pTRP2 were fused at the C-terminus of iTEP. A glycine (G) was inserted between the iTEP and the epitopes to facilitate cleavage of the epitopes from iTEP.

  49 in total

Review 1.  Mechanisms of MHC class I-restricted antigen processing and cross-presentation.

Authors:  Peter Cresswell; Anne L Ackerman; Alessandra Giodini; David R Peaper; Pamela A Wearsch
Journal:  Immunol Rev       Date:  2005-10       Impact factor: 12.988

2.  Engineering of a femtomolar affinity binding protein to human serum albumin.

Authors:  Andreas Jonsson; Jakob Dogan; Nina Herne; Lars Abrahmsén; Per-Ake Nygren
Journal:  Protein Eng Des Sel       Date:  2008-05-22       Impact factor: 1.650

3.  Neonatal Fc receptor for IgG (FcRn) regulates cross-presentation of IgG immune complexes by CD8-CD11b+ dendritic cells.

Authors:  Kristi Baker; Shuo-Wang Qiao; Timothy T Kuo; Victoria G Aveson; Barbara Platzer; Jan-Terje Andersen; Inger Sandlie; Zhangguo Chen; Colin de Haar; Wayne I Lencer; Edda Fiebiger; Richard S Blumberg
Journal:  Proc Natl Acad Sci U S A       Date:  2011-05-31       Impact factor: 11.205

4.  Relationship of effective molecular size to systemic clearance in rats of recombinant interleukin-2 chemically modified with water-soluble polymers.

Authors:  M J Knauf; D P Bell; P Hirtzer; Z P Luo; J D Young; N V Katre
Journal:  J Biol Chem       Date:  1988-10-15       Impact factor: 5.157

5.  Why does Coomassie Brilliant Blue R interact differently with different proteins? A partial answer.

Authors:  M Tal; A Silberstein; E Nusser
Journal:  J Biol Chem       Date:  1985-08-25       Impact factor: 5.157

6.  Lymph node-targeted immunotherapy mediates potent immunity resulting in regression of isolated or metastatic human papillomavirus-transformed tumors.

Authors:  Kent A Smith; Brenna L Meisenburg; Victor L Tam; Robb R Pagarigan; Raymond Wong; Diljeet K Joea; Liz Lantzy; Mayra A Carrillo; Todd M Gross; Uriel M Malyankar; Chih-Sheng Chiang; Diane M Da Silva; Thomas M Kündig; W Martin Kast; Zhiyong Qiu; Adrian Bot
Journal:  Clin Cancer Res       Date:  2009-09-29       Impact factor: 12.531

Review 7.  The spleen in local and systemic regulation of immunity.

Authors:  Vincenzo Bronte; Mikael J Pittet
Journal:  Immunity       Date:  2013-11-14       Impact factor: 31.745

Review 8.  Therapeutic cancer vaccines.

Authors:  Cornelis J M Melief; Thorbald van Hall; Ramon Arens; Ferry Ossendorp; Sjoerd H van der Burg
Journal:  J Clin Invest       Date:  2015-07-27       Impact factor: 14.808

Review 9.  Human Tumor Antigens and Cancer Immunotherapy.

Authors:  Nathalie Vigneron
Journal:  Biomed Res Int       Date:  2015-06-16       Impact factor: 3.411

10.  The major histocompatibility complex-related Fc receptor for IgG (FcRn) binds albumin and prolongs its lifespan.

Authors:  Chaity Chaudhury; Samina Mehnaz; John M Robinson; William L Hayton; Dennis K Pearl; Derry C Roopenian; Clark L Anderson
Journal:  J Exp Med       Date:  2003-02-03       Impact factor: 14.307

View more
  8 in total

1.  Direct loading of CTL epitopes onto MHC class I complexes on dendritic cell surface in vivo.

Authors:  Peng Wang; Shuyun Dong; Peng Zhao; Xiao He; Mingnan Chen
Journal:  Biomaterials       Date:  2018-08-06       Impact factor: 12.479

2.  Promotion of CTL epitope presentation by a nanoparticle with environment-responsive stability and phagolysosomal escape capacity.

Authors:  Shuyun Dong; Sundharraman Subramanian; Kristin N Parent; Mingnan Chen
Journal:  J Control Release       Date:  2020-09-19       Impact factor: 9.776

Review 3.  Overcoming physiological barriers by nanoparticles for intravenous drug delivery to the lymph nodes.

Authors:  Noah Trac; Eun Ji Chung
Journal:  Exp Biol Med (Maywood)       Date:  2021-05-06

4.  Depletion of PD-1-positive cells ameliorates autoimmune disease.

Authors:  Peng Zhao; Peng Wang; Shuyun Dong; Zemin Zhou; Yanguang Cao; Hideo Yagita; Xiao He; Song Guo Zheng; Simon J Fisher; Robert S Fujinami; Mingnan Chen
Journal:  Nat Biomed Eng       Date:  2019-03-04       Impact factor: 29.234

Review 5.  Implantable and Injectable Biomaterial Scaffolds for Cancer Immunotherapy.

Authors:  Jie Li; Yiqian Luo; Baoqin Li; Yuanliang Xia; Hengyi Wang; Changfeng Fu
Journal:  Front Bioeng Biotechnol       Date:  2020-11-30

6.  Extracellular vesicles engineered to bind albumin demonstrate extended circulation time and lymph node accumulation in mouse models.

Authors:  Xiuming Liang; Zheyu Niu; Valentina Galli; Nathalie Howe; Ying Zhao; Oscar P B Wiklander; Wenyi Zheng; Rim Jawad Wiklander; Giulia Corso; Christopher Davies; Justin Hean; Eleni Kyriakopoulou; Doste R Mamand; Risul Amin; Joel Z Nordin; Dhanu Gupta; Samir El Andaloussi
Journal:  J Extracell Vesicles       Date:  2022-07

Review 7.  Nanoparticle cancer vaccines: Design considerations and recent advances.

Authors:  Jingjing Liu; Lei Miao; Jiying Sui; Yanyun Hao; Guihua Huang
Journal:  Asian J Pharm Sci       Date:  2019-12-31       Impact factor: 6.598

Review 8.  Vaccine delivery systems toward lymph nodes.

Authors:  Yingyue Ding; Zhaoting Li; Ana Jaklenec; Quanyin Hu
Journal:  Adv Drug Deliv Rev       Date:  2021-08-04       Impact factor: 17.873

  8 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.