Literature DB >> 29149886

Antibiotic susceptibility profiles of Mycoplasma synoviae strains originating from Central and Eastern Europe.

Zsuzsa Kreizinger1, Dénes Grózner1, Kinga M Sulyok1, Kristin Nilsson1, Veronika Hrivnák1, Dušan Benčina2, Miklós Gyuranecz3.   

Abstract

BACKGROUND: Mycoplasma synoviae causes infectious synovitis and respiratory diseases in chickens and turkeys and may lead to egg shell apex abnormalities in chickens; hence possesses high economic impact on the poultry industry. Control of the disease consists of eradication, vaccination or medication. The aim of the present study was to determine the in vitro susceptibility to 14 different antibiotics and an antibiotic combination of M. synoviae strains originating from Hungary and other countries of Central and Eastern Europe.
RESULTS: Minimal inhibitory concentration (MIC) values of a total of 41 M. synoviae strains were determined by the microbroth dilution method. The strains were collected between 2002 and 2016 and originated from Hungary (n = 26), Austria (n = 3), the Czech Republic (n = 3), Slovenia (n = 3), Ukraine (n = 3), Russia (n = 2) and Serbia (n = 1). Tetracyclines (with MIC50 values of 0.078 μg/ml, ≤0.25 μg/ml and 0.5 μg/ml for doxycycline, oxytetracycline and chlortetracycline, respectively), macrolides (with MIC50 values of ≤0.25 μg/ml for tylvalosin, tylosin and tilmicosin), pleuromutilins (with MIC50 values of 0.078 μg/ml and ≤0.039 μg/ml for tiamulin and valnemulin) and the combination of lincomycin and spectinomycin (MIC50 1 μg/ml (0.333/0.667 μg/ml)) were found to be the most effective antibiotic agents against M. synoviae in vitro. High MIC values were detected in numerous strains for fluoroquinolones (with MIC50 values of 1.25 μg/ml and 2.5 μg/ml for enrofloxacin and difloxacin), neomycin (MIC50 32 μg/ml), spectinomycin (MIC50 2 μg/ml), lincomycin (MIC50 0.5 μg/ml) and florfenicol (MIC50 4 μg/ml). Nevertheless, strains with elevated MIC values were detected for most of the applied antibiotics.
CONCLUSIONS: In the medical control of M. synoviae infections the preliminary in vitro antibiotic susceptibility testing and the careful evaluation of the data are crucial. Based on the in vitro examinations doxycycline, oxytetracycline, tylvalosin, tylosin and pleuromutilins could be recommended for the therapy of M. synoviae infections in the region.

Entities:  

Keywords:  Antibiotic resistance; Chicken; MIC; Microbroth dilution; Mycoplasma synoviae; Turkey

Mesh:

Substances:

Year:  2017        PMID: 29149886      PMCID: PMC5693497          DOI: 10.1186/s12917-017-1266-2

Source DB:  PubMed          Journal:  BMC Vet Res        ISSN: 1746-6148            Impact factor:   2.741


Background

Mycoplasma synoviae is a cell wall-less pathogen which has significant economical impact in the poultry industry [1]. Clinical signs caused by this bacterium comprise synovitis and respiratory diseases in chickens and turkeys, and mainly in commercial egg layers the reduction of egg production and hatchability, and egg shell apex abnormalities [2]. The severity of the clinical signs may vary from sub-clinical to severe forms and is aggravated by the presence of other pathogens (e.g. infectious bronchitis virus, Newcastle disease virus, influenza A virus, Escherichia coli or other mycoplasmas) and inadequate housing conditions [3, 4]. The three main approaches for the control of the disease are eradication followed by prevention, vaccination or medication. While eradication and vaccination provide long-term solution for the control of mycoplasmosis, medication can be a prompt and effective tool to reduce the economic losses by mitigating egg transmission and clinical signs [1]. However, antibiotic susceptibility profile should first be determined to maximize treatment efficacy [5]. Due to their cell wall-less characteristic mycoplasmas are readily resistant to ß-lactam antibiotics and as they do not synthesize folic acid sulphonamides, sulfones or trimethoprim are ineffective against these pathogens also [6]. Natural resistance to erythromycin and other 14-membered ring macrolides was described in M. synoviae [7]. Mycoplasmas showed susceptibility to tetracyclines, fluoroquinolones and macrolides both in vitro and in vivo, and the efficacy of tiamulin and the combination of lincomycin and spectinomycin against M. synoviae under experimental conditions had been proved long before [5, 7–14]. In vitro determination of antibiotic susceptibility of M. synoviae is an essential tool for the choice of the appropriate antibiotic agent in the therapy with taking in consideration the factors which may influence the antimicrobial effect in vivo (e.g. biofilm synthesis) [15]. However, the performance of the in vitro tests in the case of mycoplasmas is time-consuming and requires special techniques, thus usually it is not carried out in routine diagnostics and comparable data about the antibiotic susceptibility of M. synoviae strains originating from Europe are scarce in the literature also [5, 7, 13, 16, 17]. In the present study the antibiotic susceptibility profile of M. synoviae strains originating from Central and Eastern Europe was determined by microbroth dilution method in the case of antibiotics commonly used in veterinary practice and which have potential to be used against avian mycoplasmosis.

Methods

M. synoviae strains were isolated from trachea swabs collected from turkeys and chickens originating from the Central and Eastern European region between 2014 and 2016. Production phase of the sampled chickens varied among breeders, commercial layers and broilers, while only meat-type turkeys were examined in the study (Table 1). Ethical approval and specific permission were not required for the study as all samples were collected by the authors during routine diagnostic examinations or necropsies with the consent of the owners. Trachea swabs were washed in 2 ml modified Frey’s broth medium [18] and incubated at 37 °C with 5% CO2 atmosphere. The broth medium consisted of 0.225 g/ml Frey Mycoplasma broth base, 20% porcine serum, 0.01% NAD, 0.01% cysteine, 200 IU/ml penicillin G, 0.5% glucose, 0.5% pyruvate and 0.005% phenol red in distilled water; all products originated from Sigma-Aldrich, Germany. Strains were gained after one-time filter cloning, minimizing the in vitro mutations of the isolates. The QIAamp DNA Mini Kit (Qiagen Inc., Hilden, Germany) was used for DNA extraction according to the manufacturers’ instructions for Gram-negative bacteria. The purity of the cultures was confirmed by a universal Mycoplasma PCR system targeting the 16S/23S rRNA intergenic spacer region in Mycoplasmatales [19] followed by sequencing on an ABI Prism 3100 automated DNA sequencer (Applied Biosystems, Foster City, CA), sequence analysis and BLAST search. Out of a total of 41 M. synoviae strains tested in the study 26 strains originated from Hungary, three strains each from Austria, the Czech Republic and from Ukraine, two strains from Russia and one from Serbia (Table 1). Also, three strains isolated in Slovenia between 2002 and 2008 were included in the study. The number of colour changing units (CCU) was calculated by microbroth dilution method, from the highest dilution showing colour change (red to yellow shift) after two weeks of incubation [20].
Table 1

Background data and initial MIC values of the isolated Mycoplasma synoviae strains

Strain dataMIC values (μg/ml)
Strain IDHosta Production phaseFarmRegionCountryYearEFXDIFCTCDXOTCTYLTILTVNNSPCLCMLCM-SPCTIAVALFFC
MYCAV 31chlayer1NógrádHungary20140.62550.50.0781≤0.25≤0.25≤0.2532112 (0.666/1.334)≤0.039≤0.0392
MYCAV 79tbroiler2Győr-Moson-SopronHungary20140.3121.25≤0.250.0780.5≤0.25≤0.25≤0.2532112 (0.666/1.334)0.078≤0.0392
MYCAV 102tbroiler3VasHungary20141.251.250.50.0780.5≤0.25≤0.25≤0.2532111 (0.333/0.667)0.078≤0.0392
MYCAV 119tbroiler4Komárom-EsztergomHungary20140.3121.25≤0.250.078≤0.25≤0.25≤0.25≤0.2532212 (0.666/1.334)0.078≤0.0392
MYCAV 130tbroiler5Győr-Moson-SopronHungary20141050.50.0780.5≤0.25≤0.25≤0.2532212 (0.666/1.334)0.156≤0.0394
MYCAV 167chbreeder6Jász-Nagykun-SzolnokHungary20150.6250.6250.5≤0.039≤0.25≤0.25≤0.25≤0.2581≤0.250.5 (0.167/0.333)≤0.039≤0.0392
MYCAV 168chlayer7PardubiceCzech Republic2015>10520.3121≤0.250.5≤0.258211 (0.333/0.667)0.156≤0.0398
MYCAV 170chbreeder8Győr-Moson-SopronHungary20152.52.50.50.0780.5≤0.25≤0.25≤0.251620.50.5 (0.167/0.333)0.156≤0.0398
MYCAV 173chlayer9OryolRussia2015102.510.1560.5≤0.251≤0.25410.50.5 (0.167/0.333)≤0.039≤0.0392
MYCAV 174chlayer10OryolRussia2015>101040.3121≤0.254≤0.2532212 (0.666/1.334)0.078≤0.0398
MYCAV 183chbroiler11Komárom-EsztergomHungary20151.251.250.50.078≤0.25≤0.25≤0.25≤0.25>6480.51 (0.333/0.667)0.078≤0.0398
MYCAV 185chbreeder12Szabolcs-Szatmár-BeregHungary2015>1050.50.3120.52640.5162>642 (0.666/1.334)0.156≤0.0398
MYCAV 186chlayer13Borsod-Abaúj-ZemplénHungary2015>102.520.1560.5≤0.25≤0.25≤0.256420.50.5 (0.167/0.333)0.312≤0.0392
MYCAV 188chbreeder14ZalaHungary2015>101040.3121≤0.25≤0.25≤0.253220.51 (0.333/0.667)≤0.039≤0.0392
MYCAV 189chlayer15CherkasyUkraine201510580.3121≤0.252≤0.2532211 (0.333/0.667)0.078≤0.0398
MYCAV 190chlayer16CherkasyUkraine2015>101040.3120.5≤0.252≤0.2532210.5 (0.167/0.333)0.078≤0.0398
MYCAV 194b chbreeder17unknownSlovenia20020.6251.25≤0.25≤0.039≤0.25≤0.25≤0.25≤0.253240.50.5 (0.167/0.333)0.156≤0.0394
MYCAV 197c chbreeder18unknownSlovenia20020.625100.5≤0.039≤0.25≤0.25≤0.25≤0.2532≤0.250.52 (0.666/1.334)0.078≤0.0394
MYCAV 198d chunknown19unknownSlovenia20080.6255≤0.250.1560.5≤0.25≤0.25≤0.251640.51 (0.333/0.667)0.312≤0.0398
MYCAV 217tbroiler20BékésHungary20152.51010.078≤0.25≤0.250.5≤0.2564111 (0.333/0.667)0.625≤0.0398
MYCAV 236chbreeder21VeszprémHungary20150.3121.2510.078≤0.25≤0.25≤0.25≤0.251610.50.5 (0.167/0.333)0.078≤0.0390.5
MYCAV 249chlayer22South MoraviaCzech Republic2016510≤0.250.1560.5≤0.25≤0.25≤0.25>64411 (0.333/0.667)0.078≤0.0394
MYCAV 256chlayer23South MoraviaCzech Republic201610510.1560.5≤0.25≤0.25≤0.25>64412 (0.666/1.334)0.156≤0.0394
MYCAV 257chlayer24FejérHungary2016>101020.1561≤0.25≤0.25≤0.2532211 (0.333/0.667)0.156≤0.0394
MYCAV 259chbreeder25unknownSerbia2016>1050.50.078≤0.25≤0.25≤0.25≤0.25322≤0.250.5 (0.167/0.333)0.312≤0.0392
MYCAV 261tbroiler26Komárom-EsztergomHungary20161.251.250.50.078≤0.25≤0.25≤0.25≤0.25162≤0.250.5 (0.167/0.333)≤0.039≤0.0394
MYCAV 262tbroiler27Komárom-EsztergomHungary20160.6251.25≤0.250.078≤0.25≤0.25≤0.25≤0.251610.51 (0.333/0.667)≤0.039≤0.0398
MYCAV 263tbroiler28Győr-Moson-SopronHungary20161.251.250.50.078≤0.25≤0.25≤0.25≤0.2581≤0.250.5 (0.167/0.333)≤0.039≤0.0392
MYCAV 268tbroiler29TolnaHungary20161.252.50.50.078≤0.25≤0.25≤0.25≤0.256420.51 (0.333/0.667)0.156≤0.0398
MYCAV 272chlayer30TernopilUkraine20160.6251.25≤0.250.078≤0.25≤0.25≤0.25≤0.25>64421 (0.333/0.667)0.625≤0.0394
MYCAV 274chbroiler31VasHungary20162.52.5≤0.250.078≤0.25≤0.25≤0.25≤0.2564412 (0.666/1.334)0.312≤0.0398
MYCAV 277tbroiler32VeszprémHungary20161.251.25≤0.250.078≤0.25≤0.25≤0.25≤0.253220.51 (0.333/0.667)0.078≤0.0394
MYCAV 278tbroiler33VeszprémHungary20161.251.25≤0.250.156≤0.25≤0.25≤0.25≤0.251620.51 (0.333/0.667)≤0.039≤0.0392
MYCAV 281tbroiler34SomogyHungary20160.3120.625≤0.250.156≤0.25≤0.25≤0.25≤0.2532211 (0.333/0.667)0.156≤0.0398
MYCAV 282chlayer13Borsod-Abaúj-ZemplénHungary20161050.50.1560.5≤0.25≤0.25≤0.25>64412 (0.666/1.334)≤0.039≤0.0390.5
MYCAV 284tbroiler35BurgenlandAustria20161.252.5≤0.250.078≤0.25≤0.25≤0.25≤0.253220.51 (0.333/0.667)0.156≤0.0394
MYCAV 285tbroiler36BurgenlandAustria20161.252.5≤0.250.078≤0.25≤0.25≤0.25≤0.25322≤0.250.5 (0.167/0.333)0.078≤0.0394
MYCAV 288tbroiler37BurgenlandAustria20161.252.5≤0.250.078≤0.25≤0.25≤0.25≤0.25>6410.51 (0.333/0.667)0.078≤0.0394
MYCAV 291tbroiler38Győr-Moson-SopronHungary20160.6252.50.50.1560.5≤0.25≤0.25≤0.25321≤0.250.5 (0.167/0.333)0.078≤0.0394
MYCAV 300chbreeder14ZalaHungary2016>101010.3121≤0.251≤0.2564211 (0.333/0.667)0.078≤0.0394
MYCAV 306tbroiler4Komárom-EsztergomHungary20161.252.5≤0.250.078≤0.25≤0.25≤0.25≤0.2516111 (0.333/0.667)0.078≤0.0394

Abbreviations of antibiotics: EFX enrofloxacin, DIF difloxacin, DX doxycycline, OTC oxytetracycline, CTC chlortetracycline, TYL tylosin, TIL tilmicosin, TVN tylvalosin, N neomycin, SPC spectinomycin, LCM lincomycin, TIA tiamulin, VAL valnemulin, FFC florfenicol

aAll strains were isolated from the trachea of the animals, abbreviations stand for: ch chicken, t turkey

bMYCAV194 is sub-clone of strain ULB02/T6 [41]

cMYCAV197 is sub-clone of strain IT2/A [41]

dMYCAV198 is sub-clone of strain ULB08/T3 [42]

Background data and initial MIC values of the isolated Mycoplasma synoviae strains Abbreviations of antibiotics: EFX enrofloxacin, DIF difloxacin, DX doxycycline, OTC oxytetracycline, CTC chlortetracycline, TYL tylosin, TIL tilmicosin, TVN tylvalosin, N neomycin, SPC spectinomycin, LCM lincomycin, TIA tiamulin, VAL valnemulin, FFC florfenicol aAll strains were isolated from the trachea of the animals, abbreviations stand for: ch chicken, t turkey bMYCAV194 is sub-clone of strain ULB02/T6 [41] cMYCAV197 is sub-clone of strain IT2/A [41] dMYCAV198 is sub-clone of strain ULB08/T3 [42] The following antimicrobial agents were examined during the microbroth dilution tests: the fluoroquinolones: enrofloxacin and difloxacin; the aminocyclitol: spectinomycin; the aminoglycoside: neomycin; the lincosamide: lincomycin; the tetracyclines: doxycycline, oxytetracycline and chlortetracycline; the macrolides: tylosin and tilmicosin; the pleuromutilins: tiamulin and valnemulin; and the amphenicol: florfenicol; all products originated from VETRANAL, Sigma-Aldrich, Germany. Lincomycin and spectinomycin were applied in combination as well, in a ratio of 1:2. The macrolide tylvalosin (Aivlosin, ECO Animal Health Ltd., UK) was also included in the examinations. The antibiotics were diluted and stored according to the recommendations of Hannan [20]. Stock solutions of 1 mg/ml fluoroquinolones were prepared in 0.1 M NaOH; stock solution of 1 mg/ml florfenicol was prepared in 96% ethanol and in sterile distilled water; and the rest of the stock solutions of 1 mg/ml were prepared in sterile distilled water and stored at −70 °C. Freshly prepared two-fold dilutions were used in each microtest after checking the thawed antibiotic solutions for any visible changes in their consistency. The concentration range of the antibiotics was selected to cover values previously suggested to reflect susceptibility, intermediate susceptibility or resistance to the tested agents or which were used in previous publications (Table 2), in details: 0.039–10 μg/ml for fluoroquinolones, doxycycline and pleuromutilins, 0.25–64 μg/ml for neomycin, spectinomycin, lincomycin, oxytetracycline, chlortetracycline and macrolides, 0.125–32 μg/ml for florfenicol and 0.25–64 μg/ml (0.083/0.167–21.333/42.666 μg/ml) for the combination of lincomycin and spectinomycin.
Table 2

Summary of MIC range, MIC50 and MIC90 values (μg/ml) of the isolated Mycoplasma synoviae strains with the suggested non-official breakpoints (in μg/ml; S: susceptible, R: resistant) and MIC values for the type strain WVU1853

Non-official breakpointsWVU1853 initialWVU1853 finalRange initialRange finalMIC50 initialMIC50 finalMIC90 initialMIC90 final
Fluoroquinolones
 EnrofloxacinS ≤ 0.5; R ≥ 2 [5]0.3121.250.312 – >100.312 – >101.251.25>10>10
 DifloxacinS ≤ 0.5; R ≥ 4 [5]1.25–2.51.25–2.50.625 – >100.625 – >102.52.510>10
Aminocyclitol
 SpectinomycinS ≤ 2; R > 4 [28]28≤0.25–81–162248
Aminoglycoside
 NeomycinS ≤ 4; R > 4 [25]64 – >64>644 – >648 – >6432>64>64>64
Lincosamide
 LincomycinS ≤ 2; R ≥ 8 [43]0.50.5≤0.25 – >64≤0.25 – >640.5114
Tetracyclines
 DoxycyclineS ≤ 4; R ≥ 16 [25]≤0.0390.156≤0.039–0.3120.078–1.250.0780.1560.3120.625
 OxytetracyclineS ≤ 4; R ≥ 16 [5]≤0.250.5≤0.25–1≤0.25–8≤0.25114
 ChlortetracyclineS ≤ 4; R ≥ 16 [25]0.51≤0.25–8≤0.25–160.5228
Macrolides
 TylosinS ≤ 1; R ≥ 4 [5]≤0.25≤0.25≤0.25–2≤0.25–8≤0.25≤0.25≤0.25≤0.25
 TilmicosinS ≤ 8; R ≥ 32 [5]≤0.25≤0.25≤0.25–64≤0.25 – >64≤0.25≤0.2512
 TylvalosinS ≤ 0.5; R > 2 [28]≤0.25≤0.25≤0.25–0.5≤0.25–1≤0.25≤0.25≤0.25≤0.25
Pleuromutilins
 TiamulinS ≤ 8; R ≥ 16 [7]0.0780.078≤0.039–0.6250.078–1.250.0780.1560.3120.312
 ValnemulinS ≤ 0.125; R > 0.125 [25]≤0.039≤0.039≤0.039≤0.039≤0.039≤0.039≤0.039≤0.039
Amphenicol
 FlorfenicolS ≤ 2; R ≥ 8 [25]1–21–40.5–81–164888
Combination
 Lincomycin: SpectinomycinS ≤ 2(0.666/1.334); R > 4(1.332/2.668) [25]1 (0.333/0.667)1–2 (0.333/0.667–0.666/1.334)0.5–2 (0.167/0.333–0.666/1.334)0.5–4 (0.167/0.333–1.332/2.668)1 (0.333/0.667)1 (0.333/0.667)2 (0.666/1.334)2 (0.666/1.334)
Summary of MIC range, MIC50 and MIC90 values (μg/ml) of the isolated Mycoplasma synoviae strains with the suggested non-official breakpoints (in μg/ml; S: susceptible, R: resistant) and MIC values for the type strain WVU1853 Microbroth dilution examinations were performed according to Hannan [20] on 104–105 CCU/ml of the strains. In brief, the tests were performed in 96-well microtiter plates containing modified Frey’s broth medium, using growth controls (broth medium without antibiotic), sterility controls (broth medium without antibiotic and Mycoplasma inoculum), pH controls (broth medium adjusted to pH 6.8) and quality controls (the duplicate of the M. synoviae type strain WVU 1853, NCTC 10124). All strains were tested in duplicates. The minimum inhibitory concentrations (MIC) were determined from the lowest concentration of the antibiotics where no pH and colour change of the broth was detected, meaning that the growth of the bacteria was completely inhibited in the broth. Initial MIC values were determined when the growth controls showed colour change. Final MIC values were determined when no further growth was detected, generally after two weeks of incubation. MIC50 and MIC90 values were defined as the lowest concentrations that inhibited the growth of 50% or 90% of the strains [20].

Results

The quality control type strain (WVU 1853, NCTC 10124) showed consistent results throughout the study and the data (Table 2) were in accordance with previously recorded MIC values gained by microbroth dilution method: ranges of initial MIC values were 0.125–0.5 μg/ml for enrofloxacin and difloxacin, 0.1–0.125 μg/ml for oxytetracycline, ≤0.015 μg/ml for doxycycline, 0.025–0.06 μg/ml for tylosin, 0.015–0.06 μg/ml for tilmicosin, and ≤0.03–0.1 μg/ml for tiamulin before [5, 7, 13, 17]. Currently, there are no comparable MIC values available in the case of the M. synoviae type strain (WVU 1853, NCTC 10124) for the rest of the antibiotics tested in the present study. The ranges of the initial and final MIC values, MIC50 and MIC90 values for each antibiotic and for the combination are included in Table 2. In the cases of four antibiotics (oxytetracycline, chlortetracycline, neomycin and lincomycin) at least four-fold difference was observed in the MIC50 or MIC90 values when initial and final MIC values were compared (Tables 1 and 2 and Additional file 1). The initial MIC values are evaluated and discussed throughout the study [20]. The MIC50 values of the strains originating from different countries of the Central and Eastern European region showed high similarity, thus if otherwise not indicated the MIC values of all examined strains are evaluated together. The distribution of the MIC values for enrofloxacin showed two main peaks (Fig. 1a1), while predominantly even distribution of the MIC values for difloxacin was observed (Fig. 1a2). Among the Hungarian strains the MIC50 values for enrofloxacin of the isolates originating from chickens (10 μg/ml, n = 11) was notably higher than of the strains originating from turkeys (1.25 μg/ml, n = 15), which corresponds to the observed two-peaked distribution (Fig. 1a2). In this comparison, four-fold difference was detected between the MIC50 values for difloxacin (with MIC50 1.25 μg/ml and 5 μg/ml of strains from turkeys and chickens, respectively) and the distribution of the MIC values for this agent differed remarkably according to the isolates’ host of origin (Fig. 1b2). No outlier strains with high MIC values were observed for the tetracyclines doxycycline, oxytetracycline and chlortetracycline (Fig. 1c, d and e). The strains generally showed low MIC values for the three examined macrolides (Fig. 1f, g and h), with the exception of one strain (MYCAV 185), especially in the case of tilmicosin (MIC 64 μg/ml). Strain MYCAV 185 was isolated from a backyard flock, where excess antibiotic usage was documented, and it showed elevated MIC values for most antibiotics tested. High MIC values were detected for neomycin in most strains (Fig. 1i), especially after two weeks of incubation (final MIC50 > 64 μg/ml, Table 2 and Additional file 1). The majority of the strains’ MIC values for spectinomycin and for lincomycin distributed around the MIC50 values (Fig. 1j and k). Outlier strains were detected for both antibiotics; one strain with low MIC value in the case of spectinomycin (MYCAV 197), and one with high MIC value in the case of lincomycin (MYCAV 185). When lincomycin and spectinomycin were applied in combination, the range of the MIC values slightly tightened, no outlier strains were detected and lower concentration of the individual antibiotics was sufficient in the combination to inhibit the growth of 50% of the strains (Fig. 1j, k and l). Pleuromutilins showed high efficacy against the M. synoviae strains (Fig. 1m and n). No growth was observed in the presence of valnemulin and most strains were inhibited at the MIC50 concentration of tiamulin. The MIC values of the majority of the strains grouped around the MIC50 value (4 μg/ml) in the case of florfenicol also (Fig. 1o).
Fig. 1

MIC50 values are marked with asterisks. MIC values of 41 M. synoviae strains are demonstrated to enrofloxacin (a1), difloxacin (b1), doxycycline (c), oxytetracycline (d), chlortetracycline (e), tylosin (f), tilmicosin (g), tylvalosin (h), neomycin (i), spectinomycin (j), lincomycin (k), the combination of lincomycin and spectinomycin (l), tiamulin (m), valnemulin (n) and florfenicol (o). The MIC values for enrofloxacin (a2) and difloxacin (b2) of isolates originating from Hungary from meat-type turkeys (white columns; n = 15) and mostly breeder and layer chickens (grey columns; n = 11) are presented in individual diagrams also

MIC50 values are marked with asterisks. MIC values of 41 M. synoviae strains are demonstrated to enrofloxacin (a1), difloxacin (b1), doxycycline (c), oxytetracycline (d), chlortetracycline (e), tylosin (f), tilmicosin (g), tylvalosin (h), neomycin (i), spectinomycin (j), lincomycin (k), the combination of lincomycin and spectinomycin (l), tiamulin (m), valnemulin (n) and florfenicol (o). The MIC values for enrofloxacin (a2) and difloxacin (b2) of isolates originating from Hungary from meat-type turkeys (white columns; n = 15) and mostly breeder and layer chickens (grey columns; n = 11) are presented in individual diagrams also

Discussion

Conventional methods for the determination of antibiotic susceptibility of mycoplasmas is time-consuming, laborious and requires special techniques, thus it is not performed routinely [20]. Moreover, the interpretation of the results is hampered by the lack of official standards. In the case of human pathogen mycoplasmas the Clinical and Laboratory Standards Institute (CLSI) has provided official breakpoints for certain antibiotics [21]. However, given the fastidious nature and inherent differences in the cultivation of these pathogens, procedures and media vary according to each of the examined species [22]. Initiations to establish standard CLSI protocols for mycoplasmas with veterinary relevance have been made, but for the time being the recommendations of Hannan [20] are supposed to be applied in these cases [23]. In the lack of official breakpoints, the data of the present study are interpreted according to values previously used in other publications [5, 7, 13, 20, 24] or to breakpoints of other avian pathogens determined by the CLSI [25] (Table 2). Susceptibility (MIC ≤0.5 μg/ml according to Landman et al. [5]) and also resistance (MICs ≥2 or 4 μg/ml for enrofloxacin or difloxacin, respectively) [5] to fluoroquinolones have been described in M. synoviae strains before [5, 12, 16, 17, 24]. Differences in the antibiotic usage and density of poultry flocks were assumed to be responsible for the observed variations [17] and resistance to fluoroquinolones was described in Europe [5]. In the present study, elevated MIC values of fluoroquinolones were observed regardless of the strains’ geographical origin. On the other hand, MIC values showed correlation with the host of origin, most probably in connection with the length of the hosts’ production cycle. In the interpretation of Landman et al. [5], more than half of the Hungarian strains isolated from chickens (mainly breeders and layers) were regarded resistant to enrofloxacin (MIC ≥2 μg/ml) and difloxacin (MIC ≥4 μg/ml), while most of the strains from meat-type turkeys (short life production cycle) were considered susceptible or intermediately susceptible to these antibiotics. The MIC values of tetracyclines also varied in previous works according to the strains’ country of origin, with most European strains showing susceptibility (MIC ≤4 μg/ml) [20] to these agents [5, 12, 13, 16]. In accordance with previous studies, all strains included in the current study showed high susceptibility to doxycycline and oxytetracycline, and chlortetracycline proved to be highly efficient at least against 90% of the strains. The 16-membered ring macrolides showed good in vitro activity against M. synoviae strains all over the world previously [5, 12, 14, 16, 26–30], but field strains showing intermediate susceptibility or resistance (MIC >1 μg/ml according to Hannan [20]) have been isolated also, even from Europe [13]. In avian Mycoplasma strains resistance to tilmicosin developed more readily and quicker than to tylosin under laboratory conditions [31]. Several previous studies reported the slow increase of resistance to tylosin in M. synoviae and M. gallisepticum in vitro also [7, 32, 33]. In the current examination, the majority of the strains were inhibited by low concentrations of tylvalosin and tylosin, and 90% of the strains were susceptible to tilmicosin (≤1 μg/ml) [5], confirming the high in vitro efficiency of these macrolides against M. synoviae. Elevated MIC values were detected primarily in the case of tilmicosin (with four strains reaching MIC >1 μg/ml), which is concordant with previous observations in vitro [31], and assumes the more rapid development of resistance against this agent. Lincosamides have similar protein synthesis inhibitory mechanism on the 50S subunit of the bacterial ribosome as macrolides [34], and lincomycin was found to be efficacious against avian mycoplasmas before [3, 16]. Cross-resistance was described between macrolides and lincosamides and it was associated with mutations in the 23S ribosomal RNA of M. synoviae [35]. In the current study, all isolates showed susceptibility (≤2 μg/ml) [20] to lincomycin except for one outlier strain (MYCAV 185; MIC >64 μg/ml), which showed elevated MIC values to macrolides as well. Aminoglycosides and aminocyclitols are most commonly administered for the treatment of bacterial enteritis in poultry [36, 37], and by the oral application these compounds absorb poorly from the gastrointestinal tract [38]. Previous in vitro examinations on the efficacy of neomycin against M. synoviae revealed that high concentrations of the antibiotic were needed for the inhibition of the pathogen (MICs 32–128 μg/ml) [30]. On the other hand, spectinomycin proved to be effective against the French and Iranian M. synoviae strains in vitro with MIC values below the susceptibility breakpoint of 4 μg/ml (according to CLSI [25]) [16, 28]. Potentially lower concentrations of spectinomycin were sufficient for the inhibition of the growth of M. synoviae when it was applied in combination with lincomycin [28], and this combination successfully controlled experimental M. synoviae infection in vivo before [9]. In the present study, the majority of the strains showed resistance to neomycin (MIC >4 μg/ml according to CLSI [25]) but were inhibited by spectinomycin at concentrations below the assumed breakpoint (MIC ≤4 μg/ml [25]). The combination of lincomycin with spectinomycin improved the efficacy of both antibiotics against most M. synoviae strains (Tables 1 and 2 and Additional file 1); therefore the use of their combination is supposed to be preferable in the therapy. Pleuromutilins showed high in vitro effect against avian mycoplasmas before [7, 13] and have been used in the treatment of mycoplasmosis in poultry [39]. Resistance against these substances in M. gallisepticum and M. synoviae develops gradually [7], as only one mutation is enough for the elevation of MIC values, but to achieve high level resistance the combination of multiple mutations is required [39]. The M. synoviae strains examined in this study showed high susceptibility to tiamulin and valnemulin, assuming their potential in the therapy. Phenicols are broad-spectrum antibiotics and showed in vitro activity against certain mycoplasmas before [23, 30, 38, 40]. In the present study, although two strains were inhibited by lower concentrations of florfenicol (MIC 0.5 μg/ml), narrow range of MICs was observed among the rest of the strains (MICs between 2 and 8 μg/ml), showing lower effectiveness of florfenicol against M. synoviae than reported in other studies or in M. gallisepticum [30, 40]. The observed differences between the initial and final MIC values of the mycoplasmastatic antibiotics chlortetracycline and lincomycin [34] lead to the re-categorization of certain strains from susceptible to resistant during the interpretation of the results, while in other cases no difference was detected at all. Also, remarkable deviation of the MIC values for neomycin (which has concentration-dependent mycoplasmacidal effect [34]) was observed when initial and final readings were compared, although it did not alter significantly the interpretation of the data. Many factors may influence the growth of the bacteria in the in vitro tests; the discrepancies may indicate the inactivation of the used antibiotics during incubation, or the presence of a slower growing minor population which may have significance in the determination of official breakpoints in the future and in the estimation of the in vivo efficacy of the antibiotics [20, 24, 26]. The combined examination of the in vitro tests with pharmacokinetics/pharmacodynamics studies and in vivo experiments would probably enable the better understanding of the importance of the initial and final MIC values, and the differences in between. Nevertheless, freshly prepared antibiotic solutions are administered during treatment, which minimize the possibility of antibiotic inactivation and initial MIC values are evaluated in the standardized methods for human pathogen mycoplasmas as well [22]; therefore the initial MIC values are advised to be taken into account in the interpretation of the results in mycoplasmas with veterinary relevance. Strains originating from the same farm but from different years possessed similar MIC values (e.g. strains from farms 4, 13 and 14; Table 1). However, apart from oxytetracycline, doxycycline, tylvalosin, valnemulin and the combination of lincomycin and spectinomycin, strains with elevated MIC values were detected in the cases of all antibiotics tested. Even more, as an alarming example for irresponsible antibiotic usage, one strain (MYCAV 185) showed high MIC values to several antibiotics, especially to fluoroquinolones, macrolides and to lincomycin. It is noteworthy, that the combined application of lincomycin with spectinomycin remarkably reduced the inhibitory antibiotic concentration against this strain (from MIClincomycin > 64 μg/ml to MIClincomycin:spectinomycin 2 μg/ml (0.666/1.334 μg/ml)). All of these observations highlight the importance of testing the antibiotic susceptibility of M. synoviae before treatment. On the other hand, in clinical cases when rapid intervention is needed (e.g. mortality or high morbidity with severe clinical signs) and the treatment cannot wait for the results of the time-consuming and laborious in vitro tests, the presented data may serve as a guide in the choice of the appropriate antibiotic therapy in the Central and Eastern European region.

Conclusions

Antibiotic susceptibility testing of M. synoviae is laborious and time-consuming, and is not performed in routine diagnostics, thus empirical antibiotic treatment is usually applied by the clinicians. The MIC values of the 41 M. synoviae strains provided in the present study revealed the in vitro effectiveness of tetracyclines, macrolides and pleuromutilins, and assume the potential usefulness of these agents in the therapy of mycoplasmosis in poultry in Central and Eastern Europe. However, elevated MIC values were observed in several cases during the examinations, which concerns antibiotics with importance in human medicine as well (e.g. fluoroquinolones). In order to preserve these critical antimicrobials for the therapy of humans, prudent antibiotic usage is recommended based on preliminary in vitro antibiotic susceptibility tests and on the careful evaluation of these data by considering the difficulties in the interpretation of the results and the factors influencing antibiotic effectiveness in vivo.
  37 in total

1.  In vitro susceptibility of avian mycoplasmas to enrofloxacin, sarafloxacin, tylosin, and oxytetracycline.

Authors:  C Wang; M Ewing; S Y Aarabi
Journal:  Avian Dis       Date:  2001 Apr-Jun       Impact factor: 1.577

2.  Efficacy of chlortetracycline against Mycoplasma synoviae isolated in two periods.

Authors:  N O Olson; S P Sahu
Journal:  Avian Dis       Date:  1976 Apr-Jun       Impact factor: 1.577

3.  Is Mycoplasma synoviae outrunning Mycoplasma gallisepticum? A viewpoint from the Netherlands.

Authors:  Wil J M Landman
Journal:  Avian Pathol       Date:  2014       Impact factor: 3.378

4.  Decreased Susceptibility to Macrolide-Lincosamide in Mycoplasma synoviae Is Associated with Mutations in 23S Ribosomal RNA.

Authors:  Inna Lysnyansky; Irena Gerchman; Barbara Flaminio; Salvatore Catania
Journal:  Microb Drug Resist       Date:  2015-03-03       Impact factor: 3.431

5.  Effect of tiamulin in chickens and turkeys infected experimentally with avian Mycoplasma.

Authors:  C O Baughn; W C Alpaugh; W H Linkenheimer; D C Maplesden
Journal:  Avian Dis       Date:  1978 Oct-Dec       Impact factor: 1.577

Review 6.  Susceptibility of mycoplasmas to antimicrobial agents: clinical implications.

Authors:  W M McCormack
Journal:  Clin Infect Dis       Date:  1993-08       Impact factor: 9.079

7.  Biofilm formation by mycoplasma species and its role in environmental persistence and survival.

Authors:  Laura McAuliffe; Richard J Ellis; Katie Miles; Roger D Ayling; Robin A J Nicholas
Journal:  Microbiology       Date:  2006-04       Impact factor: 2.777

8.  Development of antibiotic resistance in Mycoplasma gallisepticum in vitro.

Authors:  A Zanella; P A Martino; A Pratelli; M Stonfer
Journal:  Avian Pathol       Date:  1998       Impact factor: 3.378

9.  Mycoplasma synoviae invades non-phagocytic chicken cells in vitro.

Authors:  Daliborka Dusanić; Rebeka Lucijana Bercic; Ivanka Cizelj; Simona Salmic; Mojca Narat; Dusan Bencina
Journal:  Vet Microbiol       Date:  2009-03-04       Impact factor: 3.293

10.  [In vitro resistance acquisition in Mycoplasma gallisepticum against ofloxacin, tylosin and spectinomycin].

Authors:  Isamu Takahashi; Takaharu Yoshida; Yoshihiro Higashide; Takuo Sawada
Journal:  Jpn J Antibiot       Date:  2002-06
View more
  11 in total

1.  Influence of Different Tetracycline Antimicrobial Therapy of Mycoplasma (Mycoplasma synoviae) in Laying Hens Compared to Tea Tree Essential Oil on Table Egg Quality and Antibiotic Residues.

Authors:  Nikola Puvača; Erinda Lika; Vincenzo Tufarelli; Vojislava Bursić; Dragana Ljubojević Pelić; Nedeljka Nikolova; Aleksandra Petrović; Radivoj Prodanović; Gorica Vuković; Jovanka Lević; Ilias Giannenas
Journal:  Foods       Date:  2020-05-11

2.  Antibiotic susceptibility testing of Mycoplasma hyopneumoniae field isolates from Central Europe for fifteen antibiotics by microbroth dilution method.

Authors:  Orsolya Felde; Zsuzsa Kreizinger; Kinga Mária Sulyok; Veronika Hrivnák; Krisztián Kiss; Ákos Jerzsele; Imre Biksi; Miklós Gyuranecz
Journal:  PLoS One       Date:  2018-12-11       Impact factor: 3.240

3.  Evaluation of Minimum Inhibitory Concentrations for 154 Mycoplasma synoviae isolates from Italy collected during 2012-2017.

Authors:  Salvatore Catania; Marco Bottinelli; Alice Fincato; Michele Gastaldelli; Antonio Barberio; Federica Gobbo; Gaddo Vicenzoni
Journal:  PLoS One       Date:  2019-11-07       Impact factor: 3.240

4.  Integrated Transcriptomic and Proteomic Analyses of the Interaction Between Chicken Synovial Fibroblasts and Mycoplasma synoviae.

Authors:  Rui Liu; Bin Xu; Shengqing Yu; Jingfeng Zhang; Huawei Sun; Chuanmin Liu; Fengying Lu; Qunxing Pan; Xiaofei Zhang
Journal:  Front Microbiol       Date:  2020-04-03       Impact factor: 5.640

5.  Pharmacokinetics of Tylvalosin in Broiler Turkeys (Meleagris Gallopavo) After Single Intravenous and Oral Administration.

Authors:  Mohamed Elbadawy; Mohamed Aboubakr; Amira Abugomaa
Journal:  Front Vet Sci       Date:  2019-10-17

6.  Antimicrobial susceptibility profiles of porcine mycoplasmas isolated from samples collected in southern Europe.

Authors:  Rubén S Rosales; Ana S Ramírez; María M Tavío; Carlos Poveda; José B Poveda
Journal:  BMC Vet Res       Date:  2020-09-03       Impact factor: 2.741

7.  Antibiotic-induced alterations and repopulation dynamics of yellowtail kingfish microbiota.

Authors:  Thibault P R A Legrand; Sarah R Catalano; Melissa L Wos-Oxley; James W Wynne; Laura S Weyrich; Andrew P A Oxley
Journal:  Anim Microbiome       Date:  2020-08-03

8.  Antibiotic resistance of Mycoplasma Synoviae strains isolated in China from 2016 to 2019.

Authors:  Xiaorong Zhang; Mengjiao Guo; Di Xie; Yang Chen; Chengcheng Zhang; Yongzhong Cao; Yantao Wu
Journal:  BMC Vet Res       Date:  2022-01-03       Impact factor: 2.741

9.  Doxycycline pharmacokinetics in geese.

Authors:  Irene Sartini; Beata Łebkowska-Wieruszewska; Andrzej Lisowski; Amnart Poapolathep; Andrejs Sitovs; Mario Giorgi
Journal:  J Vet Pharmacol Ther       Date:  2021-07-27       Impact factor: 1.567

10.  Development of molecular assays for the rapid and cost-effective determination of fluoroquinolone, macrolide and lincosamide susceptibility of Mycoplasma synoviae isolates.

Authors:  Katinka Bekő; Zsuzsa Kreizinger; Cécile Yvon; Orsolya Saller; Salvatore Catania; Anneke Feberwee; Miklós Gyuranecz
Journal:  PLoS One       Date:  2020-10-30       Impact factor: 3.240

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.