We performed epitope mapping studies on the major surface glycoprotein (GP) of Ebola virus (EBOV) using Chemically Linked Peptides on Scaffolds (CLIPS), which form linear and potential conformational epitopes. This method identified monoclonal antibody epitopes and predicted additional epitopes recognized by antibodies in polyclonal sera from animals experimentally vaccinated against or infected with EBOV. Using the information obtained along with structural modeling to predict epitope accessibility, we then constructed 2 DNA vaccines encoding immunodominant and subdominant epitopes predicted to be accessible on EBOV GP. Although a construct designed to produce a membrane-bound oligopeptide was poorly immunogenic, a construct generating a secreted oligopeptide elicited strong antibody responses in mice. When this construct was administered as a boost to a DNA vaccine expressing the complete EBOV GP gene, the resultant antibody response was focused largely toward the less immunodominant epitopes in the oligopeptide. Taken together, the results of this work suggest a utility for this method for immune focusing of antibody responses elicited by vaccination.
We performed epitope mapping studies on the major surface glycoprotein (GP) of Ebola virus (EBOV) using Chemically Linked Peptides on Scaffolds (CLIPS), which form linear and potential conformational epitopes. This method identified monoclonal antibody epitopes and predicted additional epitopes recognized by antibodies in polyclonal sera from animals experimentally vaccinated against or infected with EBOV. Using the information obtained along with structural modeling to predict epitope accessibility, we then constructed 2 DNA vaccines encoding immunodominant and subdominant epitopes predicted to be accessible on EBOV GP. Although a construct designed to produce a membrane-bound oligopeptide was poorly immunogenic, a construct generating a secreted oligopeptide elicited strong antibody responses in mice. When this construct was administered as a boost to a DNA vaccine expressing the complete EBOV GP gene, the resultant antibody response was focused largely toward the less immunodominant epitopes in the oligopeptide. Taken together, the results of this work suggest a utility for this method for immune focusing of antibody responses elicited by vaccination.
Ebola virus (EBOV) causes severe hemorrhagic fever with a mortality rate as high as 90%. The recent epidemic in West Africa resulted in renewed efforts to develop efficacious recombinant DNA-based vaccines, most of which are based on eliciting immune responses to the major surface glycoprotein (GP) of EBOV. We previously reported the development and animal testing of filovirus DNA vaccines expressing full-length GP genes. Similar to protein and whole-virus vaccination, the expression products of the DNA vaccines present a multitude of epitopes to the host immune system, many of which do not confer protective immunity. Since immunodominant epitopes are those that offer the most favorable accessibility and binding kinetics to antibodies, the immune response is skewed toward them. This phenomenon has been observed for other pathogens, with the best example being influenza virus. In this case, the influenza virus hemagglutinin 1 (HA1) globule undergoes rapid evolution under immune pressure generating poorly cross-protective immunodominant epitopes that can serve as immunological decoys.Here, we sought to determine if it is possible to overcome immunodominance using a defined multi-epitope DNA vaccine construct expressing both immunodominant and subdominant gene regions. Toward this goal, we conducted a 3-part study to select and test the immunogenicity of DNA vaccine constructs encoding both immunodominant and subdominant epitopes. First, we performed epitope mapping studies using Chemically Linked Peptides on Scaffolds (CLIPS), which are able to form both linear and conformational epitopes. We screened EBOV GP-specific monoclonal antibodies (mAbs), which recognize immunodominant epitopes. We next screened polyclonal sera from mice, guinea pigs and nonhuman primates (NHP) experimentally vaccinated against or infected with EBOV in an attempt to identify less immunodominant epitopes. Finally, we selected a subset of these epitopes to design 2 minimal epitope-based DNA vaccines. We show here that not only can such a construct focus a humoral immune response, but immunodominance can be overcome due to epitope availability within the construct.
Results
CLIPS libraries
A general description of CLIPS technology and types of scaffolds used in screenings has been described previously. A total of 7,286 different CLIPS peptides derived from the EBOV GP-1 and GP-2 amino sequences were synthesized on scaffolds and placed into 14 different groups for screening. Group 1 included overlapping looped 15-mers, and Group 2 comprised overlapping linear 15-mers. The remaining groups consisted of 21-mer or 32-mer peptides constructed from 9-mers separated by 2 cysteine residues and additional terminal cysteine residues to allow disulfide bond formation. Each 9-mer in the sequence was paired with sequential 9-mers across the GP amino acid sequence resulting in a peptide library that was intended to simulate both linear and conformational epitopes. For fine mapping of specific antigenic regions of EBOV GP, a series of 6,518 additional CLIPS peptides were generated based on the initially retrieved leads. These fine mapping variants include all proteogenic amino acid substitutions at each amino acid position within putative epitopes to allow assessment of the individual residue contributions to the epitopes.
Epitope mapping with murine antibodies
The CLIPS libraries were probed with murine mAbs 13F6, 13C6, 6D8 and 6E36. As described previously, all 4 of these mAbs were found to provide partial protection against EBOV challenge when passively transferred to BALB/c mice. mAbs 13F6 and 6E3 are in the same competitive binding group (Group 1), but have different isotypes (IgG1 or IgG2a, respectively). Neither of these mAbs neutralized EBOV in cell culture assays. mAbs 6D8 and 13C6 are in different competitive binding groups (2 and 4, respectively) and both were shown to neutralize EBOV in cell culture assays in the presence of complement. Polyclonal sera tested included archived samples from previous studies.Initial screening showed that mAb 13F6 binds to peptides in groups 1, 2, 7, and 13 (Figure S1). Fine mapping by full substitution mutagenesis revealed clear binding to the amino acid region 391TPVYKLDISEATQVEQHHRRTDNDS415 with 406QHHRRTD412 as core of the epitope and the motif 406QXXRXT411 being most essential (Fig. 1A). Similarly, mAb 6E3, which was previously found to be in the same competition group as mAb 13F66, bound to this same region, and full substitution mutagenesis revealed that the core of the epitope was 406QHHRRTD412 with 406QXHRR410 as the most important residues (Fig. 1B). The mAb 6D8 also bound to CLIPS peptides having the amino acid sequence 391TPVYKLDISEATQVEQHHRRTDNDS415, and full substitution mutagenesis showed that 394YKLDI398, was the core of the epitope with 395KLD397 as the most essential amino acids (Fig. 1C).
Figure 1.
Antibody binding after full substitution mutagenesis of 391TPVYKLDISEATQVEQHHRRTDNDS415. Substituted amino acids are shown on the right side of each heat map. Green indicates significantly reduced binding. (A) The core of the mAb 13F6 epitope was determined to be 406QHHRRTD412, with 406QXXRXT411 being most essential for binding. (B) The core of mAb 6E3 was also 406QHHRRTD412, with 406QXHRR410 most essential to binding. (C) The core of the epitope for mAb 6D8 was determined to be 394YKLDI398, with 395KLD397 as the most essential amino acids. (D) Polyclonal sera from mice vaccinated with WT GP of EBOV showed strongest binding to 397DISEAT402, with 398ISXXT402 as the most crucial amino acids.
Antibody binding after full substitution mutagenesis of 391TPVYKLDISEATQVEQHHRRTDNDS415. Substituted amino acids are shown on the right side of each heat map. Green indicates significantly reduced binding. (A) The core of the mAb 13F6 epitope was determined to be 406QHHRRTD412, with 406QXXRXT411 being most essential for binding. (B) The core of mAb 6E3 was also 406QHHRRTD412, with 406QXHRR410 most essential to binding. (C) The core of the epitope for mAb 6D8 was determined to be 394YKLDI398, with 395KLD397 as the most essential amino acids. (D) Polyclonal sera from mice vaccinated with WT GP of EBOV showed strongest binding to 397DISEAT402, with 398ISXXT402 as the most crucial amino acids.Negative control sera from naïve mice or mice vaccinated with an empty vector DNA vaccine showed no binding in the CLIPS screening (data not shown). Positive control sera included pooled sera from mice that had been vaccinated with either a wild-type EBOV GP DNA vaccine (initial screening) or a codon-optimized GP DNA vaccine (fine mapping). Both of these GP DNA vaccine constructs were previously found to protect mice from challenge with EBOV, but the optimized construct displayed improved expression in cell culture. In the initial CLIPS screening, we found that the positive control sera bound to peptides in groups 1, 2, 3, and 13 (Figure S2). Positional scanning showed 397DISEAT402 to be the core of the epitope recognized, with 398ISXXT402 as the most crucial amino acids (Fig. 1D). In addition to this region, we also observed lesser binding by the polyclonal WT GP DNA-vaccinated mice to 41STLQVSDVDKLVCRDKLLSSTNMLRS65 and 197HPLREPVNATED206 (data not shown).We also screened the CLIPS libraries with a serum sample from mice that were vaccinated with the Venezuelan equine encephalitis virus replicon particle (VRP)-based EBOV GP vaccine that was originally used to generate the mouse mAbs in this study and that survived challenge with EBOV. As with sera from mice vaccinated with the GP DNA vaccines (but not challenged), sera from the VRP-vaccinated and EBOV challenged survivor showed strong binding to 391TPVYKLDISEATQVEQHHRRTDNDS415 and positional scanning of the VRP survivor showed 395KLDI398 as the core of the epitope (data not shown) similar to what was observed for mAb 6D8. In total, our CLIPS screening data with murine antibodies indicated that this region of the mucin-like domain, which includes the epitope binding regions for mAbs 13F6, 6E3, and 6D8, is highly immunodominant in mice.The results obtained with mAbs 13F6, 6E3 and 6D8, were consistent with earlier studies; however, our results using mAb 13C6 were not. Our initial screening with mAb 13C6 showed binding to CLIPS peptides in Groups 1, 2, 7, 12, and 13 (Figure S3). The mAb 13C6 epitope is conformational and binds to both GP1 and sGP. The epitope for this mAb has been reported to reside in the glycan cap region of GP1, a region containing 6 N-linked glycosylation sites, which is believed to shield the receptor binding domain. Our CLIPS binding results differ from this finding, and instead show binding to a region near epitopes for mAbs 12B56 and 14G76. We repeated the experiment using a different aliquot of mAb 13C6, which was derived from a separate hybridoma subclone, with the same results. We also compared the productive IGH rearranged nucleotide sequences from the 2 clonal derivatives (13C6 1.1 and 13C61.1.1) and found them to be identical to one another and to the original reported nucleotide sequences for 13C6 (data not shown). To further investigate our findings with mAb 13C6, we generated phage libraries displaying WT EBOV GP peptides as described previously. This library was constructed to display 50-mer long peptides from EBOV GP at the end of the T7 capsid, with a sliding window of 10 amino acids from the previous peptide. Panning with mAb 13C6 enriched phages displaying 461NNNTHHQDTGEESASSGKLGLITNTIAGVAGLITGGRRTR 500 peptide, which includes the same region (underlined) identified with CLIPS. This region also includes the epitope for mouse mAbs 12B5 and 14G7.To explore the residues that contribute most to the mAb 13C6 binding, we performed positional scanning with mAb 13C6 in comparison to mAb 6D8. As expected, mAb 6D8 bound to 391TPVYKLDISEATQVEQHHRRTDNDS415, and substitutions for residues 394YKLDI398 negatively impacted binding (Fig. 2A). Also as expected, mAb 6D8 did not bind to the 470GEESASSGKLGLITNTIAGVAGLIT494 region identified for mAb 13C6 binding (Fig. 2B). Conversely, mAb 13C6 bound poorly to the mAb 6D8 epitope 391TPVYKLDISEATQVEQHHRRTDNDS415 (Fig. 2C), but bound strongly to 470GEESASSGKLGLITNTIAGVAGLIT494 (Fig. 2D). The residues that contribute most to mAb 13C6 binding in this assay are those comprising the motif on the end of this peptide: 487GxAGLIT494. Of note, introduction of a negatively charged residue (D or E) at any point disturbed binding (Fig. 2D).
Figure 2.
Full substitution mutagenesis of mAbs 13C6 and 6D8. The letter plots depict pepscan results for each peptide on the X axis with recorded intensities (optical density, OD) expressed in arbitrary units (AU) plotted on the Y axis. (A) Binding of mAb 6D8 to a full series of substitutions of 391TPVYKLDISEATQVEQHHRRTDNDS415 indicates decreased binding upon mutations to 393VYKLD397 (boxed), which is thought to be the epitope core. (B) Binding of mAb 6D8 to a full substitution series of 470GEESASSGKLGLITNTIAGVAGLIT494 indicates no binding to this stretch of amino acids. (C) Binding of mAb 13C6 to a full substitution series of 470GEESASSGKLGLITNTIAGVAGLIT494 indicates decreased binding upon mutations to 487GVAGLIT493 (boxed) and appears to be generally sensitive to introduction of negative charges into the peptides. (D) Binding of mAb 13C6 to a full substitution series of 391TPVYKLDISEATQVEQHHRRTDNDS415 indicates no binding to this stretch of amino acids.
Full substitution mutagenesis of mAbs 13C6 and 6D8. The letter plots depict pepscan results for each peptide on the X axis with recorded intensities (optical density, OD) expressed in arbitrary units (AU) plotted on the Y axis. (A) Binding of mAb 6D8 to a full series of substitutions of 391TPVYKLDISEATQVEQHHRRTDNDS415 indicates decreased binding upon mutations to 393VYKLD397 (boxed), which is thought to be the epitope core. (B) Binding of mAb 6D8 to a full substitution series of 470GEESASSGKLGLITNTIAGVAGLIT494 indicates no binding to this stretch of amino acids. (C) Binding of mAb 13C6 to a full substitution series of 470GEESASSGKLGLITNTIAGVAGLIT494 indicates decreased binding upon mutations to 487GVAGLIT493 (boxed) and appears to be generally sensitive to introduction of negative charges into the peptides. (D) Binding of mAb 13C6 to a full substitution series of 391TPVYKLDISEATQVEQHHRRTDNDS415 indicates no binding to this stretch of amino acids.
Comparison of epitopes bound by a variety of experimentally vaccinated or infected mice, guinea pigs or NHP
To attempt to identify additional EBOV epitopes for inclusion in the multi-epitope constructs, we performed CLIPS screenings using sera from mice and guinea pigs experimentally vaccinated against EBOV but not challenged and from rhesus macaques that were not vaccinated, but had been treated with antiviral drugs and survived EBOV infection. These studies were intended to ascertain if varying the antigenic presentation of GP with different types of vaccines, or by infection with EBOV without prior vaccination, resulted in antibody responses to unique epitopes. Sera tested included pooled sera from mice vaccinated with a WT EBOV GP DNA vaccine, negative control samples from mice vaccinated with the empty vector DNA vaccine, and sera from mice vaccinated with DNA constructs in which one or the other of the 2 GP2N-linked glycosylation sites were mutated as described previously. In our earlier studies, we found that mutating 563NET565 to 563AET565
(MUTC, Fig. 3) resulted in GP2 that did not co-precipitate with GP1 and that had reduced immunogenicity and protective efficacy in mice. In contrast, mutating 618NIT620 to 618AIT620 (MUTD, Fig. 3) resulted in GP2 that still co-precipitated with GP1 and minimally impacted elicitation of protective immunity. Consequently, we reasoned that these sera might recognize different GP epitopes than sera from mice vaccinated with WT EBOV GP DNA vaccines. The 2 pooled guinea pig serum samples were from earlier EBOV DNA vaccine studies (unpublished), both of which were collected 21 d after the final vaccination, but before challenge with EBOV. Sample 107 (Fig. 3) came from guinea pigs vaccinated by gene gun with an EBOV DNA vaccine expressing both the GP and NP genes of EBOV and boosted with recombinant baculovirus generated GP. Sample 130 (Fig. 3) came from guinea pigs vaccinated with the EBOV GP DNA vaccine and boosted with a recombinant vaccinia virus expressing EBOV GP (unpublished).
Figure 3.
Relative binding of serum samples from mice, guinea pigs and rhesus macaques to amino acids in CLIPS. Blue indicates strong binding and tan indicates weaker binding. No color indicates no measureable binding with that particular sample.
Relative binding of serum samples from mice, guinea pigs and rhesus macaques to amino acids in CLIPS. Blue indicates strong binding and tan indicates weaker binding. No color indicates no measureable binding with that particular sample.Like samples from mice vaccinated with the WT EBOV GP DNA vaccine (Fig. 1 and S3), CLIPS screening of pooled sera from mice that had been vaccinated with MUTD DNA showed strong binding to CLIPS peptides containing 391TPVYKDLDIS399, whereas samples from MUTC vaccinated mice did not (Fig. 3 and S5). One of the guinea pig samples (130, Fig. 3) and one of the rhesus macaque samples (C250B, Fig. 3) also showed strong binding to this region of GP. Sera from mice vaccinated with MUTC and MUTD, but not with WT GP DNA vaccines, bound strongly to 43LQVSDVDKLVCRDKL57 (Fig. 3), suggesting that the mutant DNA vaccines were eliciting different antibody responses. This same region was also recognized by one of the guinea pig samples (130, Fig. 3). The 2 guinea pig samples also recognized several epitopes that were not strongly bound by antibodies in the polyclonal mouse sera, but were bound by rhesus macaque sera (Fig. 3). Only 2 of the rhesus macaque sera (R1510 and C250B, Fig. 3) bound strongly to epitopes in GP2, although weaker binding was also noted for mouse and guinea pig samples (Fig. 3).
Construction of epitope-based DNA vaccines
Using the CLIPS data and structural modeling based on the initial X-ray crystal structure of EBOV GP, we sought to determine if it is possible to present the immune system with both immunodominant and subdominant epitopes and generate immune responses to all of them. As representative immunodominant epitopes, we included gene regions encoding the epitopes for mouse mAb 6D8 (392PVYKLDISEA401), and mAbs 13F6 and 6E3 (406QHHRRT411). We also included the gene region encoding 477GKLGLITN484, because in CLIPS screening this epitope was recognized strongly by sera from guinea pigs and rhesus macaques (Fig. 3). Also, this region encodes the amino acids in the 2 overlapping peptides that were originally shown to be recognized by mouse mAbs 12B5 and 14G7 (477GKLGLITNTIAGVAGLI493) (mAb 12B5 (partial), Table 1), as well as in our CLIPS and phage display screenings with mAb 13C6 (Fig. 2 and S4). Multi-epitope construct 1 (Mep1) was designed to also include 2 subdominant epitopes that were predicted to be accessible on the surface of EBOV GP (M1 & M2, Fig. 4), one of which (88FRSGVPPK95) was weakly recognized in CLIPS screenings using guinea pig and rhesus macaque sera and the other of which (111LEIKKPDG118) was not recognized by any of the immune sera (Fig. 3). There was no linker between the signal peptide and the M1 epitope in Mep1, but all of the other epitopes were separated by flexible linkers consisting of 4 glycine residues (Table 1). This construct also included the N-terminal EBOV signal peptide (33 amino acids) preceding the epitopes to facilitate intracellular trafficking. The EBOV transmembrane domain was included to anchor the construct to the cell surface (Table 1).
Table 1.
Predicted features and amino acid compositions of expression products encoded by the Mep1 and Mep2 DNA vaccines.
Mep1
Epitope
Predicted Features
Predicted Amino Acid Sequence
Linker
Amino Acids
SP
Signal peptide
MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSI
none
1–33
M1
Linear- Accessible
FRSGVPPK
GGGG
88–95
M2
Linear- Accessible
LEIKKPDG
GGGG
111–118
MAb6D8
Linear- mucin
PVYKLDISEA
GGGG
392–401
MAb13F6
Linear- mucin
QHHRRT
GGGG
406–411
MAb12B5 (partial)
Linear- mucin
GKLGLITN
GGGG
477–484
TM
transmembrane domain
WIPAGIGVTGVIIAVIALFCICKFVF
none
651–676
Mep2
Epitope
Predicted Features
Predicted amino acid sequence
linker
Amino Acids
SP-GP1
Signal peptide
MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSI -PLGVIHN
GGGG
1–40
MAb6D8
Linear- mucin
PVYKLDISEA
GGGG
392–401
MAb13F6
Linear- mucin
QHHRRT
GGGG
406–411
MAb12B5 (partial)
Linear- mucin
GKLGLITN
GGGG
477–484
M3
Linear
VSDVDKLVCRDKL
GGGG
45–57
M4
Linear
SSHPLREPV
GGGG
195–203
Conf-1
Conformational-mucin
CTPVYKLDISCCENTNTSKGTC
GGGG
391–399_433–441
Conf-2
Conformational-mucin
CTPVYKLDISCCAGPPKAENTC
GGGG
91–399_427–435
Figure 4.
EBOV GP structural modeling. A surface model representation of the EBOV GP trimer is shown in white. The 3D representation omits the mucin-like domain in GP, which is considered unstructured. Smooth regions of the surface highlight the parts of the structure that were determined through X-ray crystallography. Other portions of the structure that were not resolved experimentally have been modeled “de novo” and are shown as collections of dots to indicate the approximate location of the missing fragments. Epitopes M1 to M4 identified in the CLIPS study and included in the multi-epitope constructs described in Table 1 are highlighted in purple, blue, magenta and red, respectively.
Predicted features and amino acid compositions of expression products encoded by the Mep1 and Mep2 DNA vaccines.EBOV GP structural modeling. A surface model representation of the EBOV GP trimer is shown in white. The 3D representation omits the mucin-like domain in GP, which is considered unstructured. Smooth regions of the surface highlight the parts of the structure that were determined through X-ray crystallography. Other portions of the structure that were not resolved experimentally have been modeled “de novo” and are shown as collections of dots to indicate the approximate location of the missing fragments. Epitopes M1 to M4 identified in the CLIPS study and included in the multi-epitope constructs described in Table 1 are highlighted in purple, blue, magenta and red, respectively.Like Mep1, Mep2 contained the EBOV signal peptide, but differed from Mep1 in that it also encoded the first 7 amino acids of the N-terminus of GP1 (Table 1). These 7 amino acids were included to potentially enhance signal peptide removal before a glycine linker, which was inserted before each epitope. Mep2 was intended to generate a secretion product as it did not have a transmembrane domain. The same 3 immunodominant epitopes as in Mep1 were included in Mep2, which were followed by 2 linear epitopes that were predicted to be surface accessible on EBOV virions (M3 & M4, Fig. 4), but did not appear to be immunodominant in mice vaccinated with the WT EBOV GP DNA vaccine. One of these (M3) is the epitope that was bound by antibodies in sera from mice vaccinated with the 2 glycosylation mutants and one of the guinea pig pools (45VSDVDKLVCRDKL57), but not by sera from mice vaccinated with the WT EBOV GP DNA vaccine (Table 1 and Fig. 3). The other (M4, Fig. 4) is an epitope recognized by both guinea pig sera and one of the rhesus macaque sera in the CLIPS screen (195SSHPLREPV203), but was not strongly bound by any of the mouse samples (Fig. 3). Mep2 also included 2 putative conformational epitopes which were the strongest binders identified by CLIPS screening with the pooled sera from mice vaccinated with the WT GP DNA vaccine (Figure S2, Group-13). These CLIPs both consisted of simple double-loop structures with the linear, protective, neutralizing epitope of mAb 6D8 followed by 2 C residues to allow disulfide bonding and one of 2 overlapping regions from the mucin-like domain (433ENTNTSKG441 or 427AGPPKAENT435).Both Mep constructs produced polypeptides recognized by mAb 6D8 when assayed by immunofluourescent antibody staining of transfected cells (Fig. 5A). As expected, ELISA of cell culture supernatants from transfected cells demonstrated that Mep2, but not Mep1 produced a secreted expression product (Fig. 5B). Western blots of a Mep1 cell lysate with mAb 6E3 or Mep2 cell supernatant with mAb 6D8 showed expression products of the expected sizes (data not shown).
Figure 5.
Mep 1 and Mep2 expression. (A) Cells were transfected with the Mep1 or Mep2 DNA vaccine constructs or with the WT GP DNA vaccine and stained with DAPI (top panels). Immunofluorescent antibody staining was performed with EBOV mouse mAb 6D8 (middle panels). Lower panels show a merge of the top and middle panels. (B) ELISA was performed on cell supernatants of mock-transfected cells or cells transfected with the Mep1 or Mep2 constructs. (C) Groups of mice (N = 10) were vaccinated 3 times with empty plasmid vector, the WT GP DNA vaccine, or the Mep1 or Mep2 constructs. ELISA was performed on serum samples obtained 3 weeks after each vaccination using inactivated EBOV virions as antigen.
Mep 1 and Mep2 expression. (A) Cells were transfected with the Mep1 or Mep2 DNA vaccine constructs or with the WT GP DNA vaccine and stained with DAPI (top panels). Immunofluorescent antibody staining was performed with EBOVmouse mAb 6D8 (middle panels). Lower panels show a merge of the top and middle panels. (B) ELISA was performed on cell supernatants of mock-transfected cells or cells transfected with the Mep1 or Mep2 constructs. (C) Groups of mice (N = 10) were vaccinated 3 times with empty plasmid vector, the WT GP DNA vaccine, or the Mep1 or Mep2 constructs. ELISA was performed on serum samples obtained 3 weeks after each vaccination using inactivated EBOV virions as antigen.
Mouse immunogenicity and immune focusing
To evaluate the immunogenicity of the epitope constructs, we vaccinated groups of 10 mice with the Mep1 or Mep2 DNA vaccines 3 times at 3-week intervals using intramuscular electroporation. Blood samples collected at day 0 and 3 weeks after each vaccination were analyzed by ELISA using whole EBOV antigen. Mep1 elicited no detectable antibody response after 2 vaccinations and only a low response after 3 vaccinations (Fig. 5C). Mep2 elicited a detectable response after 2 vaccinations with a rise in ELISA antibody titer after 3 vaccinations (Fig. 5C). Consequently, to determine if the multi-epitope constructs could influence immunodominance, we used Mep2 to vaccinate mice either alone or as a boost to WT GP. We assessed antibody responses by ELISA using peptides that contained the epitopes of interest (Table S1).Sera from mice vaccinated once with the WT GP DNA vaccine had low antibody responses to peptides corresponding to epitope M4 as well as those recognized by mAbs 6D8 and 13F6 (Fig. 6A). After 3 vaccinations with WT GP, additional responses to the other peptides excluding those representing epitope M3 were also detected, with antibodies raised to WT GP showing the strongest responses to peptides 65, which includes the 394YKLDI398 epitope identified by positional scanning with mAb 6D8, and peptide 67, which includes the 406QHHRRTC412 epitope identified by positional scanning with mAbs 13F6 and 6E3 (Fig. 6B). In contrast, 3 vaccinations with Mep2 elicited strong responses to the subdominant epitopes M3 and M4 represented by peptides 7, 8, and 32, 33, respectively (Fig. 6C). Mep2 elicited weak to no responses to the immunodominant epitopes identified for mAbs 6D8, 6E3 and 13F6, which were represented by peptides 65, 66, 67, 68, and 69. When mice were vaccinated once with the WT GP DNA vaccine followed by 2 booster vaccinations with Mep2, strong responses to peptides representing M3 and M4 were observed, as well as a moderate response to peptides representing epitopes for mAbs 6D8, 13F6 and 12B5 (Fig. 6D). These data suggest that the Mep2 construct is able to skew the immune response of the WT GP DNA vaccine toward subdominant epitopes found in the WT GP construct.
Figure 6.
ELISA using linear peptides containing epitopes included in Mep2. Linear peptides are as defined in Table 1 and Table S1. The epitopes contained in part or in whole in each of the peptides are identified beneath the peptide numbers. (A) Samples from mice vaccinated once with the WT GP DNA vaccine followed by 2 vaccinations with an empty plasmid vector control; (B) samples from mice vaccinated 3 times with the WT GP DNA vaccine; (C) samples from mice vaccinated 3 times with the Mep2 DNA vaccine; and, (D) samples from mice vaccinated once with the WT GP DNA vaccine followed by 2 vaccinations with the Mep2 DNA vaccine.
ELISA using linear peptides containing epitopes included in Mep2. Linear peptides are as defined in Table 1 and Table S1. The epitopes contained in part or in whole in each of the peptides are identified beneath the peptide numbers. (A) Samples from mice vaccinated once with the WT GP DNA vaccine followed by 2 vaccinations with an empty plasmid vector control; (B) samples from mice vaccinated 3 times with the WT GP DNA vaccine; (C) samples from mice vaccinated 3 times with the Mep2 DNA vaccine; and, (D) samples from mice vaccinated once with the WT GP DNA vaccine followed by 2 vaccinations with the Mep2 DNA vaccine.To investigate the possibility that antibody focusing toward M3 and M4 was due to inclusion of strong T-helper epitopes in Mep2, we searched for potential T-cell epitopes using the Immune Epitope Database and Analysis Resource (http://www.iedb.org/). The Mep1 and Mep2 constructs both had very poor overall scores, with the best score observed for the 6D8 epitope (score ≥5.54). For comparison, the M3 and M4 epitopes have much poorer scores (>32 and >42, respectively). Consequently, the reason for the immune focusing toward the subdominant epitopes M3 and M4 when Mep2 was used to boost GP primed mice is not likely to be due to the inclusion of strong Th epitopes in Mep2, within the predictive bounds of the capability of the epitope search programs.
Discussion
In this study, we evaluated epitope-specific antibody responses to EBOV GP using CLIPS libraries probed with mouse mAbs, which were previously found to provide protection against EBOV challenge in mice, and with polyclonal antibody samples from experimentally vaccinated or infected animals. The neutralizing mAbs, 13C6 and 6D8 represent different competition groups whereas the non-neutralizing mAbs 13F6 and 6E3 were in the same competition group but had different isotypes. These mAbs, therefore, allowed for the possible selection of distinct epitopes that could be involved in protection from EBOV by differing mechanisms. In a recent study of EBOV mAbs, including 13C6, cooperativity between non-neutralizing and neutralizing mAbs was observed. For example, mAb 13C6, which neutralizes EBOV and also binds weakly to Sudan virus (SUDV) GP, was found to show increased binding to SUDV GP in the presence of the non-neutralizing mAb FVM20. In that study, it was postulated that mAb cooperativities might be related to “induced epitopes' formed or exposed by the binding of another antibody. Thus, it is possible that a construct containing both neutralizing and non-neutralizing epitopes would be superior to constructs with only neutralizing epitopes.For the mouse mAb 13F6, the residues 406QXXRXT411 were found to be crucial to the core of the epitope, which is in agreement with a recent alanine scanning study that implicated Q406, R409, T411, and D412 as crucial to epitope binding. Likewise, CLIPS screening with mAb 6E3 defined the crucial residues for binding to be 406QXHRR410. This slight difference in the critical binding residues defined for mAbs 6E3 and 13F6 augment earlier findings indicating that they also differ in isotype (IgG1 vs. IgG2a, respectively) and ability to confer passive protection in mice. CLIPS screening and positional mapping of the mAb 6D8 epitope, which identified residues 395KLD397 as critical for binding, agrees with other studies, but further delineates this epitope. In contrast, our results with mAb 13C6 do not correlate with those from earlier structural studies, which clearly show that mAb 13C6 binds to the glycan cap region of EBOV GP. In our studies, both CLIPS libraries identified a binding region for mab 13C6 just outside the mucin-like domain and before the furin cleavage site for GP1 and GP2 and in the same region bound by mAbs 12B5 and 14G76. Panning of a phage display library identified the same binding region as the CLIPS libraries, and full mutagenesis scanning corroborated these results and indicated that substitutions to 487GxAGLIT494 negatively correlate with binding. Although we have not determined the reason for the discrepancies between our results and the structural data, of note is that our work was performed using the original mouse mAb 13C6, whereas the structural studies used a chimeric human/mouse mAb produced in plants. Differences in the heavy chains of mouse mAb 4G7 and the analogous chimeric mAb c4G7 were postulated to explain differences in binding observed in structural studies. Alternatively, what we observed could be due to promiscuous binding of mAb 13C6. One possibility is that the CLIPS studies are detecting the peptide 475SSGKL479 rather than 270TTGKL273 in the glycan cap as in the electron microscopy (EM) studies. The T residues in the epitope identified in the EM structure form a tight loop that goes deep in the antibody binding pocket of mAb 13C6. On the other hand, our positional scanning (Fig. 2) shows that T residues replacing both S residues in 475SSGKL479 are the most unfavorable of the amino acid changes possible. In other words, the conformation of the 270TTGKL273 fragment found in the GP/sGP structure is not a favorable one on the oligopeptides, and the loop in the X-ray structure is probably forced during the folding process of GP. It would be interesting to perform a structural study with mAb 13C6 and these linear epitopes, similar to the study already reported for mAb 14G711 and its linear peptide epitope, which resides in the same region of the mucin-like domain that we identified for mAb 13C6.Other interesting, but unsurprising findings from our CLIPS screenings were the differing epitopes recognized by antibodies in polyclonal sera of vaccinated or infected mice, guinea pigs and rhesus macaques. Clearly, the small number of samples that we screened prevent generalizations about immunodominant epitope differences, but they do hint that there are both highly immunodominant epitopes on GP that are frequently recognized by all species tested as well as epitopes that might be more commonly recognized by specific species or when comparing vaccinated versus infected animal samples.For the purposes of our work, we chose epitopes recognized by mouse mAbs 6D8, 13F6 and 12B5, but did not include that of mAb 13C6 due to the discordant mapping results, as the immunodominant portions of our constructs. We also selected 4 accessible but subdominant epitopes to combine with these to determine if the immunodominant epitopes would obstruct the generation of broad immunity. Although both the Mep1 and Mep2 constructs produced intracellular oligopeptides recognized by IFA with EBOV mAbs, the Mep2 expression appeared to be stronger. More importantly, Mep1 was poorly immunogenic in mice. We suspect the poor immunogenicity of Mep 1 was related to the transmembrane domain, which was intended to allow cell surface presentation of the epitopes. It is possible that this anchoring did not provide adequate presentation to the mouse immune system or that the oligopeptide did not assume a favorable conformational structure to elicit strong antibody responses in mice. Alternatively, cleavage of the signal peptide or intracellular trafficking might have been suboptimal due to the amino acids of the first epitope, which are different from those of authentic EBOV GP. To eliminate these potentially negative impacts on immunogenicity, we designed our second construct, Mep2, to encode the signal peptide followed by the first 7 N-terminal residues of GP1 and a 4 glycine linker before the first epitope. We also eliminated the transmembrane coding region to promote secretion of the expression product. Mep2 was found not only to have better intracellular expression than Mep1, but also was secreted and elicited a much better antibody response than Mep1 in vaccinated mice.When Mep-2 was used as a boost to WT GP, the responses skewed to the subdominant epitopes in Mep2. We did not detect antibody responses to 2 peptides designed as simple double-loop structures including the linear protective epitope of mAb 6D8; however, we do not know if these epitopes folded correctly or were presented effectively to elicit an antibody response. Currently, we do not have a mechanistic explanation for the immune-focusing that we observed with Mep2. One possibility would be that strong T-helper epitopes were present in the construct that were capable of promoting a robust response to these epitopes. However, this is apparently not the reason, as T-cell epitopes predicted within the sub-dominant M3 and M4 domains were very weak whereas the class II-restricted epitopes in the dominant 6D8 epitope were much stronger. Another possibility is that the prediction programs do not adequately identify all strong T-cell epitopes. Clearly, additional studies would be required to determine how Mep2 is able to refocus the antibody response toward these subdominant epitopes.In conclusion, our data suggest that it is possible to use a multi-epitope DNA vaccine construct to focus the immune response toward desired, accessible epitopes, even in the presence of normally immunodominant epitopes. This has implications for filovirus DNA vaccines that contain epitopes conserved among several viruses, which could be used to boost otherwise subdominant antibody responses. Clearly, our study is limited by the small number of antibodies that we screened and the evaluation of only one multi-epitope construct. To gain a true appreciation of the utility of the screening methods that we used for designing a tailored DNA vaccine, it would be interesting to evaluate antibodies from studies in which animals were vaccinated with multiple filoviruses, monoclonal antibodies that are cross reactive among filoviruses, and combinations of antibodies.
Methods
Cell lines and virus propagation
COS-7 or Vero E6 cells were cultured in DMEM supplemented with 10% FBS and antibiotics (Penicillin/Streptomycin, 50 U/mL) at 37°C with 5% CO2. EBOV strain Mayinga was propagated in Vero E6 cells. When cells reached 90% confluency, the culture medium was removed and cells were infected under BSL4 conditions at an MOI of 0.01. After 1 hour, the inoculum was removed and fresh medium was added. The infected cultures were incubated at 37°C with 5% CO2. Cells were monitored daily for cytopathogenic effects (CPE) and when > 90% of the infected cells had detached from the culture vessel surface, the culture fluids were harvested, clarified by centrifugation and frozen at −80°C.
Antibodies
The mouse mAbs used to screen the CLIPS libraries have been described in detail. Briefly, all of the mAbs used in our studies were previously shown to provide partial protection against EBOV challenge when passively transferred to BALB/c mice. mAbs 13F6 and 6E3 are in the same competitive binding group (Group 1), but have different isotypes (IgG1 or IgG2a, respectively). Neither of these mAbs neutralized EBOV in cell culture assays. mAbs 6D8 and 13C6 are in different competitive binding groups (2 and 4, respectively) and both were shown to neutralize EBOV in cell culture assays in the presence of complement. Control sera included in the screenings came from naïve mice or mice vaccinated with the empty plasmid as indicated in the text. Polyclonal sera tested included archived samples from previous studies. Guinea pig sera (107 and 130) came from animals vaccinated by gene gun with the EBOV GP DNA vaccine and boosted with recombinant baculovirus GP expression products. This vaccine regimen provided partial protection against challenge with EBOV, but was not superior to vaccination with the DNA vaccine alone. The mouse sera MUTC and MUTD came from animals vaccinated with DNA constructs in which one or the other of the 2 GP2N-linked glycosylation sites were mutated as described previously and as described in the text of this manuscript.
Plasmids
All plasmid constructs in this study used the pWRG7077 vector described previously. Constructs expressing WT GP or a selection of epitopes from the GP gene were codon-optimized for Homo sapiens and synthesized by GeneArt. Large-scale preparations of purified, research-grade plasmids were produced by Aldevron.
CLIPS peptide libraries
CLIPS libraries were synthesized by Pepscan Systems (The Netherlands). The first library consisted of a total of 7,286 different CLIPS peptides divided into 14 groups to include: (1) All overlapping looped 15-mers, 1–662; (2) All overlapping linear 15-mers, 663–1324; (3) Combi double-looped 21-mers on T3 CLIPS, 1325–1580; (4) Combi triple-looped 32-mers on P2T3 CLIPS, 1581–2309; (5) Combi triple-looped 32-mers on P2T3 CLIPS, 2310–3038; (6) Combi triple-looped 32-mers on P2T3 CLIPS, 3039–3767; (7) Combi triple-looped 32-mers on P2T3 CLIPS, 3768–4279; (8) Combi triple-looped 32-mers on P2T3 CLIPS, 4280–4404; (9) Combi triple-looped 32-mers on P2T3 CLIPS, 4405–4620; (10) Combi triple-looped 32-mers on P2T3 CLIPS, 4621–5132; (11) Combi triple-looped 21-mers on P2T3 CLIPS, 5133–5757; (12) Combi triple-looped 21-mers on P2T3 CLIPS, 5758–6118; (13) Combi triple-looped 21-mers on P2T3 CLIPS, 6119–7142; (14) Combi triple-looped 21-mers on P2T3 CLIPS, 7143–7286 (Figure S1A). The second library was synthesized for fine mapping and included 3,750 34-mer CLIPS peptides to include: single-looped peptides on T2 scaffold, double-looped peptides on T3 scaffold, double-looped peptides on T2+T2 scaffold, triple-looped peptides on T2+T3 scaffold and sheet or helix-like peptides on T2+T2 scaffold (Figure S1B).To probe the individual contributions of amino acids at certain positions, full substitution mutagenesis arrays were designed based on the initially retrieved leads. All peptides were synthesized on solid support and screened with varying concentrations of antibody and blocking buffer to optimize signal-to-noise ratios in each experiment.
Mouse vaccinations with epitope-based DNA vaccines
Plasmid DNA was prepared at 25 μg/20 μl in PBS. Groups of 6–8 week-old female BALB/c mice (N = 10) were vaccinated 3 times at 3-week intervals with 20 μl of DNA by intramuscular electroporation. Anesthetized mice were vaccinated in the tibialis anterior muscle using the Ichor Medical Systems Tri-Grid Delivery System. Prior to each vaccination and at week 9, blood was collected and serum was isolated by centrifugation for ELISA.
Immunofluorescence microscopy
COS-7 cells were cultured on 12 mm coverslips in 24-well plates under conditions described above. When cells reached 80% confluency, they were transfected with 1 μg of purified plasmid DNA using Lipofectamine (Life Technologies). Twenty-four hours after transfection, medium was removed and the cells were washed with PBS and then fixed with 10% formalin. Cells were then permeabilized with PBS + 0.1% Triton-X for 5 minutes, washed with PBS, and blocked with PBS + 1% Tween 20 + 5% nonfat dried milk (NFDM). Next, cells were washed and incubated with mAb 6D8 (generously provided by John Dye, Jr.) for 1 hr. Finally, cells were washed, incubated with Alexa Fluor 488goat anti-mouse IgG for 30 minutes, washed again, mounted onto slides with ProLong Gold Antifade reagent (Life Technologies) and imaged by fluorescence microscopy.
Immunoblotting
COS-7 cells were transfected with plasmid DNA encoding WT GP, the multi-epitope construct, or empty vector. Cells were harvested, lysed in RIPA buffer and resolved on SDS-PAGE followed by transfer to PVDF for western blot. Western blotting was performed as per manufacturer's instructions using the Novex WesternBreeze Immunodetection kit. Primary antibody for these blots was mAb 6D8. Blots were blocked with 5% NFDM for 30 minutes, followed by 4 5-minute washes with PBST.
ELISA
Gamma-irradiated, sucrose-purified EBOV virions were coated onto 96-well, flat-bottom plates at an optimized dilution of 1:1,000. Plates were then washed and blocked with PBST + 5% NFDM. Cell lysate or serum samples were initially diluted 1:100 in PBS and subsequently diluted 2-fold then applied to coated wells and incubated for 1 hr. Plates were then washed and incubated with HRP-conjugated goat anti-mouse secondary antibody (Promega). Next, plates were washed and ABTS substrate was added as per manufacturer's instructions (Pierce). Plates were then read on a microplate reader (Molecular Devices) and data was subsequently analyzed using Softmax pro software (Molecular Devices). Endpoint titers were determined for each sample using a cutoff of 2 standard deviations above the signal observed in the negative control wells.
Peptide ELISA
A library of biotinylated 18-mer peptides with a 6 amino acid overlap spanning the entire EBOV GP was constructed by Mimotopes (Raleigh, NC). These peptides served as coating antigens in our peptide ELISA. Each well of flat-bottom, 96-well assay plates was coated with a single peptide at a concentration of 2 mg/mL. Plates were then washed with PBST followed by blocking with PBST + 5% NFDM. Plates were washed again and serum samples were applied at a 1:1,000 dilution. After incubation for 1 hr, plates were washed with PBS and HRP-conjugated goat anti-mouse secondary antibody (Promega) was applied and incubated for 1 hr. Finally, plates were washed with PBST, developed using ABTS substrate as per manufacturer's instructions (Pierce), and read on a microplate reader (Molecular Devices).
Authors: Edgar Davidson; Christopher Bryan; Rachel H Fong; Trevor Barnes; Jennifer M Pfaff; Manu Mabila; Joseph B Rucker; Benjamin J Doranz Journal: J Virol Date: 2015-08-26 Impact factor: 5.103
Authors: Rebecca J Grant-Klein; Louis A Altamura; Catherine V Badger; Callie E Bounds; Nicole M Van Deusen; Steven A Kwilas; Hong A Vu; Kelly L Warfield; Jay W Hooper; Drew Hannaman; Lesley C Dupuy; Connie S Schmaljohn Journal: Hum Vaccin Immunother Date: 2015 Impact factor: 3.452
Authors: Erin E H Tran; Elizabeth A Nelson; Pranay Bonagiri; James A Simmons; Charles J Shoemaker; Connie S Schmaljohn; Gary P Kobinger; Larry Zeitlin; Sriram Subramaniam; Judith M White Journal: J Virol Date: 2016-08-12 Impact factor: 5.103
Authors: William Dowling; Elizabeth Thompson; Catherine Badger; Jenny L Mellquist; Aura R Garrison; Jeffery M Smith; Jason Paragas; Robert J Hogan; Connie Schmaljohn Journal: J Virol Date: 2006-12-06 Impact factor: 5.103
Authors: Thomas W Geisbert; Lisa E Hensley; Peter B Jahrling; Tom Larsen; Joan B Geisbert; Jason Paragas; Howard A Young; Terry M Fredeking; William E Rote; George P Vlasuk Journal: Lancet Date: 2003-12-13 Impact factor: 79.321
Authors: Jeffrey E Lee; Marnie L Fusco; Ann J Hessell; Wendelien B Oswald; Dennis R Burton; Erica Ollmann Saphire Journal: Nature Date: 2008-07-10 Impact factor: 49.962
Authors: L Vanderzanden; M Bray; D Fuller; T Roberts; D Custer; K Spik; P Jahrling; J Huggins; A Schmaljohn; C Schmaljohn Journal: Virology Date: 1998-06-20 Impact factor: 3.616
Authors: Jesper Pallesen; Charles D Murin; Natalia de Val; Christopher A Cottrell; Kathryn M Hastie; Hannah L Turner; Marnie L Fusco; Andrew I Flyak; Larry Zeitlin; James E Crowe; Kristian G Andersen; Erica Ollmann Saphire; Andrew B Ward Journal: Nat Microbiol Date: 2016-08-08 Impact factor: 17.745
Authors: Daniel R Ripoll; Daniel A J Mitchell; Lesley C Dupuy; Anders Wallqvist; Connie Schmaljohn; Sidhartha Chaudhury Journal: Hum Vaccin Immunother Date: 2017-09-18 Impact factor: 3.452
Authors: Catherine J Mitran; Angie Mena; Sedami Gnidehou; Shanna Banman; Eliana Arango; Barbara A S Lima; Hazel Lugo; Aravindhan Ganesan; Ali Salanti; Anthony K Mbonye; Francis Ntumngia; Khaled Barakat; John H Adams; Flora S Kano; Luzia H Carvalho; Amanda E Maestre; Michael F Good; Stephanie K Yanow Journal: mBio Date: 2019-10-08 Impact factor: 7.867
Authors: Michelle Meyer; Bronwyn M Gunn; Delphine C Malherbe; Karthik Gangavarapu; Asuka Yoshida; Colette Pietzsch; Natalia A Kuzmina; Erica Ollmann Saphire; Peter L Collins; James E Crowe; James J Zhu; Marc A Suchard; Douglas L Brining; Chad E Mire; Robert W Cross; Joan B Geisbert; Siba K Samal; Kristian G Andersen; Galit Alter; Thomas W Geisbert; Alexander Bukreyev Journal: Sci Transl Med Date: 2021-07-14 Impact factor: 17.956