Shao-Jun Zhao1, De-Hua Wang1, Yan-Wei Li1, Lei Han1, Xing Xiao1, Min Ma2, David Chi-Cheong Wan3, An Hong1, Yi Ma1. 1. Institute of Biomedicine, Department of Cellular Biology, Jinan University; National Engineering Research Center of Genetic Medicine, Key Laboratory of Bioengineering Medicine of Guangdong Province, Jinan University. 2. College of traditional Chinese Medicine, Institute of Integrated Traditional Chinese and Western Medicine, Jinan University, Guangdong. 3. School of Biomedical Sciences, Faculty of Medicine, The Chinese University of Hong Kong, Shatin, Hong Kong SAR, People's Republic of China.
Abstract
A novel neuroendocrine peptide, pituitary adenylate cyclase activating peptide (PACAP), was found to have an important role in carbohydrate or lipid metabolism and was susceptible to dipeptidyl peptidase IV degradation. It can not only mediate glucose-dependent insulin secretion and lower blood glucose by activating VPAC2 receptor, but also raise blood glucose by promoting glucagon production by VPAC1 receptor activation. Therefore, its therapeutic application is restricted by the exceedingly short-acting half-life and the stimulatory function for glycogenolysis. Herein, we generated novel peptide-conjugated selenium nanoparticles (SeNPs; named as SCD), comprising a 32-amino acid PACAP-derived peptide DBAYL that selectively binds to VPAC2, and chitosan-modified SeNPs (SeNPs-CTS, SC) as slow-release carrier. The circulating half-life of SCD is 14.12 h in mice, which is 168.4-and 7.1-fold longer than wild PACAP (~5 min) and DBAYL (~1.98 h), respectively. SCD (10 nmol/L) significantly promotes INS-1 cell proliferation, glucose uptake, insulin secretion, insulin receptor expression and also obviously reduces intracellular reactive oxygen species levels in H2O2-injured INS-1 cells. Furthermore, the biological effects of SCD are stronger than Exendin-4 (a clinically approved drug through its insulinotropic effect), DBAYL, SeNPs or SC. A single injection of SCD (20 nmol/kg) into db/db mice with type 2 diabetes leads to enhanced insulin secretion and sustained hypoglycemic effect, and the effectiveness and duration of SCD in enhancing insulin secretion and reducing blood glucose levels are much stronger than Exendin-4, SeNPs or SC. In db/db mice, chronic administration of SCD by daily injection for 12 weeks markedly improved glucose and lipid profiles, insulin sensitivity and the structures of pancreatic and adipose tissue. The results indicate that SC can play a role as a carrier for the slow release of bioactive peptides and SCD could be a hopeful therapeutic against type 2 diabetes through the synergy effects of DBAYL and SeNPs.
A novel neuroendocrine peptide, pituitary adenylate cyclase activating peptide (PACAP), was found to have an important role in carbohydrate or lipid metabolism and was susceptible to dipeptidyl peptidase IV degradation. It can not only mediate glucose-dependent insulin secretion and lower blood glucose by activating VPAC2 receptor, but also raise blood glucose by promoting glucagon production by VPAC1 receptor activation. Therefore, its therapeutic application is restricted by the exceedingly short-acting half-life and the stimulatory function for glycogenolysis. Herein, we generated novel peptide-conjugated selenium nanoparticles (SeNPs; named as SCD), comprising a 32-amino acid PACAP-derived peptide DBAYL that selectively binds to VPAC2, and chitosan-modified SeNPs (SeNPs-CTS, SC) as slow-releasecarrier. Thecirculating half-life of SCD is 14.12 h in mice, which is 168.4-and 7.1-fold longer than wild PACAP (~5 min) and DBAYL (~1.98 h), respectively. SCD (10 nmol/L) significantly promotes INS-1cell proliferation, glucose uptake, insulin secretion, insulin receptor expression and also obviously reduces intracellular reactive oxygen species levels in H2O2-injured INS-1cells. Furthermore, the biological effects of SCD are stronger than Exendin-4 (a clinically approved drug through its insulinotropic effect), DBAYL, SeNPs or SC. A single injection of SCD (20 nmol/kg) into db/db mice with type 2 diabetes leads to enhanced insulin secretion and sustained hypoglycemic effect, and the effectiveness and duration of SCD in enhancing insulin secretion and reducing blood glucose levels are much stronger than Exendin-4, SeNPs or SC. In db/db mice, chronic administration of SCD by daily injection for 12 weeks markedly improved glucose and lipid profiles, insulinsensitivity and the structures of pancreatic and adipose tissue. The results indicate that SCcan play a role as a carrier for the slow release of bioactive peptides and SCDcould be a hopeful therapeutic against type 2 diabetes through the synergy effects of DBAYL and SeNPs.
Pituitary adenylate cyclase activating peptide (PACAP) is a new member of theglucagon, secretin and vasoactive intestinal peptide (VIP) family, and its structure is highly conservative in all mammals.1,2 PACAP and its receptors are located in the gastrointestinal organs, pancreas, adipose or muscle tissues. Current research indicates that PACAP has a significant role in carbohydrate and lipid metabolism,3–6 demonstrating PACAP may be a latent antidiabetic agent. By activating VPAC2, glucose-dependent insulin secretion was obviously improved whenPACAP was overexpressed in transgenic mice.7–9 However, PACAP-knockout mice exhibit hypoinsulinemia.6,10 Injection of PACAP increased glucose tolerance and decreased blood glucose levels in high-fat diet-fed type 2 diabetes (T2D) model mice and Goto-Kakizaki rats.11 But wild PACAPcan activate the receptors VPAC1 and VPAC2, and VPAC1-mediated hepatic glucose increase counteracts the increased insulinsecretion by VPAC2 activation. Thus, PACAP derivatives as VPAC2-specific agonists can effectively promote glucose-dependent insulin secretion, control circulating glucose and protect islet beta cells without causing glucagonsecretion and glycogenolysis, and have been proposed as potential T2D therapeutics.12–14BAY55-9837 is a reported specificVPAC2 agonist constructed through site-directed mutagenesis, and it can increase plasma insulin levels in a dose-dependent manner, but not leading to any hypoglycemia in rats.15,16 Nevertheless, its therapeutic application has been hampered by its short half-life (~5 min) and limited bioavailability in vivo.17 Mainly, dipeptidyl peptidase IV-mediated enzymolysis leads to the H-S lack of BAY55-9837 at the N-terminus, which may cause it cannot activate VPAC2.13 Moreover, deamidation occurring in the ninth and 28th amino acid Asn (N) results in destabilization and its small molecular size causes rapid renal clearance.In recent years, a variety of drug delivery systems or strategies have been studied and explored to address the problem of low bioavailability of peptide drugs, for example, thePEGylation techniques.12,18,19 Pan et al explored thecoupling of dipeptidyl peptidase IV-resistant VPAC2 analog peptides with 22 or 44 kDa polyethylene glycol (PEG) through specificcysteine moieties to improve the pharmacokinetics of these peptides in vivo.13 But the large polymers formed by PEG or other modifications often decrease the biological activity of the peptides or interfere with the biological function of the peptides. Therefore, to maintain the activity and function of the peptide drugs in vivo, appropriate slow-releasecarriers may be used to liberate the active peptides in order.Nanocarrier, a kind of nanoscale drug delivery system, may not only help to deliver drugs across the blood–brain barrier, but also possess many advantages such as targeted sustained release, high efficiency and low toxicity. Nano-selenium (SeNP) is a nanosize selenium (Se) particle with high biological activity.20 As an essential trace element, Se or selenoproteins are biological antioxidants, which can efficiently inhibit lipid peroxidation by removing excess free radicals. Secan prevent the development of diabetes or cardiovascular diseases through maintaining the normal redox status in organisms.21,22 Kumar et al have shown that SeNPs can effectively delay the process of diabetes in rats.23 SeNPs serve as slow-release drug carrier to extend the half-life of peptide drug and synergistically enhance the drug efficacy.24,25In order to overcome the lack of therapeutic efficacy of BAY55-9837, we first optimized its amino acid composition by gene recombination technology to obtain a 32-amino acid recombinant peptide DBAYL (MHSDAVFTDQYTRLRKQLAAKKYLQSLKQKRY, molecular weight: 3,916.0 Da). By comparing with BAY55-9837, five mutations (an extra M was added to the N-terminus, N9Q, V17L, I26L and N28Q) were introduced into DBAYL to enhance theVPAC2 receptor potency and stability in vivo. The half-life of DBAYL in mice was 1.98 h, ~23.8-fold more than that of BAY55-9837 due to improved stability. In order to further improve the bioavailability of recombinant peptide DBAYL and reduce the high renal clearance caused by small molecular weight, we constructed stable chitosan-modified SeNP (SeNPs-CTS, SC) as a slow-releasecarrier to conjugate the recombinant peptide DBAYL through amido bond formation between amido of SC and tyrosine carboxyl in DBAYL. Thus, DBAYL-conjugated, chitosan-modified SeNPs (SeNPs-CTS-DBAYL, SCD) were prepared, and thecoupled bioactive peptide, DBAYL, could be gradually released because theamido bond formed by chitosanamido and tyrosine carboxyl was scissile to chymotrypsin and cathepsin D hydrolysis. In vitro, SCDcan significantly promote INS-1cell proliferation, insulin expression and secretion, insulin receptor expression and glucose uptake in INS-1cells. SCD also significantly reduces the level of reactive oxygen species (ROS) that causeoxidative damage in H2O2-injured INS-1cells. The in vivo results indicated that DBAYL may be released slowly from SCD in thecirculation due to thecarrying ability of SC. SCD potently relieved hyperglycemia and T2D through the synergy effects of theSCcarrier possessing both slow-release and therapeutic action and theselective VPAC2 agonist peptide DBAYL.
Materials and methods
Preparation and identification of peptide DBAYL-conjugated, chitosan-modified SeNPs, SeNPs-CTS-DBAYL
According to the bias of Escherichia coli for thecodons, DBAYL gene was designed and synthesized through polymerasechain reaction (PCR) previously described using three oligonucleotide primers.26 The purified PCR products and plasmid pKYB-MCS (NEB, Ipswich, MA, USA) vector were digested by NdeI and SapI and ligated to yield the expression plasmid pKY-DBAYL. DBAYL gene in plasmid pKY-DBAYL was confirmed by DNA sequencing. The vector pKY-DBAYL was transformed into E. coliER2566 (NEB), and the fusion proteins were expressed and purified by the optimized procedure previously described.26 After chitin beads (NEB) affinity chromatography purification was carried out for thecell lysate, the preparation, purity assay and identification were performed by reverse-phase high-performance liquid chromatography (HPLC) and electrospray ionization mass spectrometry methods as previously described.26,27At room temperature, 100 μL chitosan (CTS, 0.8 mg/mL) was added to 1 mL of sodium selenite solution (5 mM) and mixed well by stirring, while 1 mL ascorbic acid solution (Vitamin C, 20 mM) was added to the solution. After it was allowed to stand for 30 min at 4°C, the mixture was dialyzed overnight (8 h) at 4°C, and thus, chitosan-modified SeNPs (SC) were obtained. Two milligrams of DBAYL was dissolved in 1 mL phosphate-buffered saline (PBS) to obtain DBAYL solution, which was then mixed with the previously prepared SC solution. After the volume of the solution was adjusted to 5 mL, thecoupling reaction was carried out using EDC/NHS as a catalyst by stirring for 12 h at room temperature. Then the solution was dialyzed overnight (12 h) at 4°C and peptide DBAYL-conjugated, chitosan-modified SeNPs, SeNPs-CTS-DBAYL (SCD), were prepared.The particle size and the surface zeta potential of SCD were measured by the nanoparticle and zeta potential analyzer, respectively. In stability assay, the particle size of SCD was measured continuously for 48 days. Fourier transform infrared spectroscopy was used to determine the absorption peak in the wave number range of 400–4,000 cm−1. The morphology of SCD was observed by transmission electron microscopy after the samples were freeze-dried. Elemental composition assay of SCD was performed by energy-dispersive X-ray spectrometry.
Determination of entrapment efficiency, drug loading and stability of the prepared SCD
The ultrafiltration–centrifugation technique was used for measuring the amount of free DBAYL. Briefly, 100 μL of SCDcoupling reaction solution before dialysis was taken in a 1 mL 10 kDa ultrafiltration tube (EMD Millipore, Billerica, MA, USA) and centrifuged at 4,000 rpm for 30 min. The filtrate was collected and thecontent of DBAYL peptide was determined by HPLC. Theentrapment efficiency (EE) was calculated using the following formula: EE = ([total DBAYL quantity-free DBAYL quantity in filtrate]/total DBAYL quantity) ×100%. TheSCD solution after dialysis was dried by lyophilization, and drug loading (DL) of SCD for DBAYL peptide was calculated using the following formula: DL = ([total DBAYL quantity-free DBAYL quantity in filtrate]/SCD mass) ×100%. The stability of SCD over 48 days was evaluated with the Zetasizer Nano and its size distribution changes were determined.
Assay of SCD release process in vitro and its half-life in db/db mice
In order to assay peptide release of SCD, SCD (60 μg/mL) was incubated in Roswell Park Memorial Institute 1640 medium (pH 7.4) supplemented with 10% fetal bovineserum at 37°C under constant shaking at 200 rpm. Sixty microliters of the sample was taken out from Eppendorf tube at appropriate intervals (0, 3, 6, 12, 18, 24, 30, 36, 42 and 48 h). The quantity of DBAYL was measured by HPLC method at 280 nm.Male db/db mice with T2D (BKS·Cg-m +/+ Leprdb/J; they were purchased from Model Animal Research Center of Nanjing University, Nanjing, People’s Republic of China) were intravenously injected SCD dissolved in sterile normal saline (NS, vehicle of SCD or peptides) at a dose of 1.0 mg/kg through the tail vein. Orbital blood was collected at each time point before dosing and from 0.5 to 24 h post dosing, and theconcentration of SCD was assayed by LC/MS/MS method described previously.28 Then the half-life of SCD in mice was measured with one-compartment elimination model and Win-Nonlin version 5.1 (Pharsight Inc., Mountain View, CA, USA). BAY55-9837, DBAYL and Exendin-4 (Ex-4) were used for control.
Competitive binding assay for SCD to VPAC2 receptor
SCD was dissolved in 1 mL PBS (pH 7.4) to a final concentration of 200 μM, and chymotrypsin was added to the mixture at a final concentration of 1 μM. SCD was digested for 24 h by chymotrypsin. Then 20 μM chymostatin (chymotrypsin inhibitor; Abcam, Burlingame, CA, USA) was added to terminate the digestion reaction, and DBAYL released from SCD was obtained. HumanVPAC2-transfected CHOcells (VPAC2-CHO), [125I]PACAP38, [125I]VIP and Apec-Series γ-counter (ICN Biomedicals Inc., Costa Mesa, CA, USA) were used to measure the half-maximal inhibitory concentrations (IC50 values) of SCD, BAY55-9837, PACAP38 and VIP with the method described previously.29
Assay of the effect of DBAYL on cyclic adenosine monophosphate accumulation
HumanVPAC2, VPAC1 or PAC1-transfected CHOcells (VPAC2-CHO, VPAC1-CHO or PAC1-CHO) were cultured in Dulbecco’s Modified Eagle’s Medium at 37°C. DBAYL, PACAP38 and thecyclic adenosine monophosphate (cAMP) enzyme immunoassay kit were used for measuring thecAMP accumulation induced by them, and the half-maximal stimulatory concentrations (EC50 values) for the three receptors were determined with the method described previously.29
Effect of SCD on the proliferation of INS-1 cells
INS-1cells were cultured in Roswell Park Memorial Institute 1640 medium supplemented with 10% fetal bovineserum, 0.11 mg/mL L-glutamine, sodium pyruvate and 50 μM β-mercaptoethanol at 37°C with 5% CO2. INS-1cells in logarithmic growth phase were inoculated with 1×104 cells/well in a 96-well plate and were treated with different gradient concentrations of SC (using the final concentration of SeNPs as the quantitative index, 0, 0.2, 2, 20, 40, 50, 60, 70, 80 and 90 μM) or SCD (using the final concentration of DBAYL as the quantitative index, 0, 2.5, 5, 10 and 20 nM) for 24 h. Thecell survival in different groups was determined with tetrazolium-based colorimetric assay (MTT; Sigma-Aldrich, St Louis, MO, USA). For SCD (10 nM) treatment, the same doses of SeNPs, SC (210 nM, using the final concentration of SeNPs as the quantitative index, SeNPs content is same as that of 10 nM SCD), BAY55-9837, Ex-4 and DBAYL (10 nM) were used for controls.For the receptor VPAC2 blocking experiments, cells were preincubated for 30 min at 37°C with 50 nM of a VPAC2-selective inhibitor PG99-465 (it was custom synthesized by GL Biochem, Shanghai, People’s Republic of China) prior to 10 nM SCD treatment.
Effect of SCD on ROS levels in H2O2-injured INS-1 cells
The oxidative injury INS-1cell model was established with H2O2 as described previously.30 Briefly, INS-1cells were inoculated with 1.5×104 cells/well in 96-well plates and were cultured for 72 h at 37°C with 5% CO2. H2O2 was added to the wells at a final concentration of 400 μM and thecells were incubated for 1 h. Then thecells were treated for 24 h in fresh media containing 10 nM of SCD (using the final concentration of DBAYL as the quantitative index). Thecell proliferation rates were determined with MTT. Intracellular ROS levels were determined with fluorometric intracellular ROS kit (Sigma-Aldrich) using the method described previously.31 For SCD (10 nM) treatment, the same doses of SeNPs, SC (210 nM, using the final concentration of SeNPs as the quantitative index), BAY55-9837, Ex-4, DBAYL (10 nM) or the same volume of PBS were used for controls.For the receptor VPAC2 blocking experiments, cells were preincubated for 30 min at 37°C with 50 nM of a VPAC2-selective inhibitor PG99-465 prior to 10 nM SCD treatment.
Effect of SCD on the proinsulin mRNA expression and insulin secretion of INS-1 cells
INS-1cells in logarithmic growth phase were inoculated with 1×106 cells/well in six-well plates. Thecells were incubated in theculture medium containing gradient concentrations of SCD (using the final concentration of DBAYL as the quantitative index, 0, 2.5, 5, 10 and 20 nM) for 48 h. Total RNA was extracted using trizol and reverse transcribed into complementary DNA using RevertAid (Thermo Fisher Scientific, Waltham, MA, USA). The primers (forward primer: GTGTGGGGAACGTGGTTTCT; reverse primer: CCAGTGCCAAGGTCTGAAGAT) were used for quantitative real-time PCR, and amplification was performed as follows: 94°C for 5 min; 35 cycles of 94°C for 15 s, annealing at 60°C for 15 s and extension at 72°C for 15 s; final extension at 72°C for 5 min. The effects of SCD on theproinsulin mRNA levels were analyzed. For SCD (10 nM) treatment, the same doses of SeNPs, SC (210 nM), BAY55-9837, Ex-4, DBAYL (10 nM) or the same volume of PBS were used for controls.INS-1cells in logarithmic growth phase were inoculated with 1×106 cells/well in six-well plates and thecells were cultured for 48 h. After washing twice with PBS and once with sugar-free Krebs-Ringer bicarbonateHEPES (KRBH) buffer, thecells were starved in sugar-free KRBH buffer for 2 h. Thesugar-free KRBH buffer was removed and replaced by KRBH buffer supplemented with 16.7 mmol/L glucose (G-KRBH). Thecells were incubated in G-KRBH buffercontaining gradient concentrations of SCD (using the final concentration of DBAYL as the quantitative index, 0, 2.5, 5, 10 and 20 nM) for 1 h in different experimental groups, and the supernatant in each experimental group was collected for insulincontent analysis with rat/mouseinsulin enzyme-linked immunosorbent assay kit (EMD Millipore). Insulin secretion of SCD (10 nM)-treated INS-1cells in KRBH buffer respectively supplemented with 5.5, 11, 16.7 or 25 mmol/L glucose was also determined. For SCD (10 nM) treatment in KRBH buffercontaining 16.7 mmol/L glucose, the same doses of SeNPs, SC (210 nM), BAY55-9837, Ex-4, DBAYL (10 nM) or the same volume of PBS were used for controls.For the receptor VPAC2 blocking experiments, cells were preincubated for 30 min at 37°C with 50 nM of a VPAC2-selective inhibitor PG99-465 prior to 10 nM SCD treatment.
Effect of SCD on the insulin receptor expression and glucose uptake of INS-1 cells
INS-1cells in logarithmic growth phase were inoculated with 1×106 cells/well in six-well plates and thecells were incubated in theculture medium containing gradient concentrations of SCD (using the final concentration of DBAYL as the quantitative index, 0, 2.5, 5, 10 and 20 nM) for 48 h in different experimental groups. The total protein in each experimental group was separated by 12% SDS-PAGE. Insulin Receptor β Mouse mAb (Cell Signaling Technology Inc., Boston, MA, USA) was used to perform the Western blot assay with the method described previously.26INS-1cells in logarithmic growth phase were inoculated with 1×106 cells/well in six-well plates and cultured for 48 h. After washing twice with PBS and once with sugar-free KRBH buffer, thecells were starved in sugar-free KRBH buffer for 2 h. Thensugar-free KRBH buffer was removed and replaced by KRBH buffer respectively supplemented with 5.5, 11, 16.7 or 25 mmol/L glucose in different experimental groups. Thecells were incubated in different glucose KRBH buffer containing 10 nM of SCD (using the final concentration of DBAYL as the quantitative index) for 20 min, and the supernatant in each experimental group was collected for glucosecontent analysis with glucose assay kit (Abcam). For SCD (10 nM) treatment in KRBH buffercontaining 16.7 mmol/L glucose, the same doses of SeNPs, SC (210 nM), BAY55-9837, Ex-4, DBAYL (10 nM) or the same volume of PBS were used for controls. Glucose consumption = (the initial glucosecontent − the measured glucosecontent).For the receptor VPAC2 blocking experiments, cells were preincubated for 30 min at 37°C with 50 nM of a VPAC2-selective inhibitor PG99-465 prior to 10 nM SCD treatment.
Acute pharmacodynamic action of SCD for lowering blood glucose and promoting insulin secretion in db/db mice
Forty-eight male 10-week-old db/db mice with T2D were divided into six groups (eight per group) and the blood glucose levels of mice were detected prior to treatments. SCD (using the final concentration of DBAYL as the quantitative index, 20 nmol/kg) diluted in sterile NS was injected intraperitoneally into mice. At 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 and 15 h after SCD injection, blood glucose levels were determined. The same doses of SC (42.1 μg/kg, SeNPs content is same as that of 20 nmol/kg SCD), Ex-4, DBAYL, BAY55-9837 (20 nmol/kg) or the same volume of NS acted as controls.Forty-eight male db/db mice and grouping were same as above. Intraperitoneal glucose tolerance tests (IPGTTs) were performed using the same doses of SC (42.1 μg/kg, SeNPs content is same as that of 20 nmol/kg SCD), SCD, BAY55-9837, Ex-4, DBAYL (20 nmol/kg, peptides was a quantitative index) or the same volume of NS (blank control) with the method described previously.32 Insulin levels at each time point during IPGTTs were measured, and the first-phase (5–15 min) insulin secretion (FPIS) and second-phase (15–120 min) insulin secretion were respectively calculated by the method described previously.32
Chronic pharmacodynamic action of SCD on food consumption, body weight, glucose and insulin levels, lipid profile and structure of pancreas, liver and adipose tissue in db/db mice
Forty-eight male, 6-week-old db/db mice were divided into six groups (eight per group), and eight male db/m mice of the same line (purchased from Model Animal Research Center of Nanjing University) acted as controls. Db/db mice were treated respectively with SCD, BAY55-9837, Ex-4, DBAYL (20 nmol/kg), SC (42.1 μg/kg) or the same volume of NS once a day and treated continuously for 12 weeks. At baseline (before treatment) and 3, 6, 9 and 12 weeks after treatment, food or waterconsumption, body weight, fast glucose and insulin, whole white fat, free fatty acid, triglyceride, total cholesterol, low-density lipoprotein cholesterol and high-density lipoprotein cholesterol were determined, and insulin tolerance tests were performed at 12 weeks after treatment with the method described previously.32,33 The structures of pancreas and adipose tissue in db/db mice and db/m mice after 12 weeks of treatment were examined with hematoxylin and eosin stain as described previously.34
Statistical analysis
Results are presented as mean ± standard error of the mean of at least three independent experiments. Differences between groups were assayed by variance analysis with Statistical Package for the Social Sciences (SPSS) version 17.0. Post hoc analysis was used if variance analysis was significant. A value of P<0.05 was considered significant statistically.
Ethics statement
The animal experiments were performed after getting approval from the Laboratory Animal Ethics Committee of JiNan University. Animal welfare and experimental procedures were carried out in accordance with the Guide for theCare and Use of Laboratory Animals (Ministry of Science and Technology of China, 2006) and related ethical regulations of JiNan University.
Results
Preparation and identification of peptide DBAYL-conjugated, chitosan-modified SeNPs (SCD)
The DNA fragment encoding 32 amino acids of DBAYL was ligated to the NdeI/SapI-digested plasmid pKYB-MCS to obtain the recombinant plasmid pKY-DBAY. The fusion proteins including chitin-binding domain, intein and DBAYL were expressed by the plasmid pKY-DBAYL transformed into E. coliER2566. Target peptide, DBAYL, was released by intein cleavage induced by β-mercaptoethanol and was further purified and prepared by HPLC. About 33.7 mg DBAYL may be gained from 1 L of bacterial culture, and HPLC assay showed the purity of the prepared DBAYL reached 98% (Figure 1A). Electrospray ionization mass spectrometry analysis indicated that the molecular weight of the prepared DBAYL was 3,916.0 Da, which corresponded to the theoretically calculated result (Figure 1B).
Figure 1
Identification and analysis of the prepared recombinant DBAYL or SeNPs-CTS-DBAYL (SCD).
Notes: (A) The prepared recombinant DBAYL was analyzed by HPLC. (B) DBAYL was identified by ESI-MS. (C) SeNPs-CTS, SC and (D) SCD were assayed by TEM. Size distribution of (E) SC and (F) SCD. (G) Zeta potential of SeNPs, SC and SCD. (H) FTIR of SC, DBAYL and SCD. (I) EDX spectrometry and (J) stability analysis of SCD.
Abbreviations: EDX, Energy dispersive X-ray; ESI-MS, electrospray ionization mass spectrometry; FTIR, Fourier transform infrared spectroscopy; HPLC, high-performance liquid chromatography; SC, chitosan-modified selenium nanoparticles; SCD, DBAYL-conjugated, chitosan-modified selenium nanoparticles; SeNPs, selenium nanoparticles; TEM, transmission electron microscopy.
The stable and homogenous peptide DBAYL-conjugated SeNPs (SCD) were prepared by redox reaction. As shown in Figure 1C and D, in the absence and presence of DBAYL, the morphologiccharacteristics as observed by transmission electron microscopy for SC showed obvious changes. SeNPs modified by chitosan were well dispersed, and their average diameter was about 72.6 nm. Compared with SC, the average particle sizes of SCD increased by nearly 78.4 nm (Figure 1E and F) and the surface zeta potential increased to 36.4 mV from 27.3 mV (Figure 1G). Fourier transform infrared spectroscopy assays showed that in the spectrum of SC, the strong absorption band present at 3,425.29 cm−1 is attributed to N–H stretching vibration or thecontribution of O–H torsional stretching vibration. The absorption at 1,383.42 cm−1 is derived from an in-plane bending vibrational mode of CH3. The peak at 1,083.19 cm−1 is assigned to the stretching vibration of C–O–C bonds. Thecharacteristic peaks of SC are in perfect accordance with the results of a previous study.35 The peak of DBAYL at 3,302.24 cm−1 is attributed to O–H groups. The strong absorption of DBAYL at 1,654.78 cm−1 is attributed to C=O stretching of amide I, and the presence of the band at 1,544.68 cm−1 may be due to amide II vibrational mode. An absorption band at 1,246.57 cm−1 is assigned to an amide III vibrational mode absorption band. The peak at 1,402.41 cm−1 may result from COO– stretching of ionized amino acid chains (Figure 1H). Thecharacteristic peaks of SCD resemble those of SC and DBAYL; meanwhile, blue shift was observed for the groups of O–H and COO– in SCD, which are attributed to theconjugation of DBAYL to SCD surface. Furthermore, elemental composition analysis confirmed the presence of a sharp peak of SeNPs (32.28%), together with a peak from a C atom (39.31%), O atom (17.66%) and an N atom (10.75%) from SCD (Figure 1I), and no other element peaks were detected. These results demonstrated peptide DBAYL was successfully conjugated to SC surface by thecondensation of DBAYLtyrosine carboxyl (−COOH) with the amino group (−NH) of SCcarrier surface.As shown in Figure 1J, the average diameter of SCD was about 150 nm. Stability tests showed the particle size of SCD remained unchanged during the first 9 days and then displayed a slight and gradual decrease, which may be caused by the release of DBAYL from SC. SCD remained stable at least for 42 days at 4°C; after the 42nd day, aggregation and precipitation began to occur. The high stability of SCDcan provide support for its future therapeutic application. The EE and DL of SCD to peptide DBYAL were determined by HPLC, and the results indicated that the EE and DL were 40.6%±4.62% and 65.04%±3.95%, respectively, which displayed the high loading rate of SC for DBAYL.
SCD has good slow-release effect in vitro and extended in vivo half-life
TheDBAYL-releaserates were assayed with HPLC. Figure 2A shows the release profiles of DBAYL from SC into theculture media. During the first 12 h, the release of DBAYL from SCD is displayed distinctly and was up to 62.6%. Followed by gradual release, thecumulative releaserate reached 81.9% after 48 h, which displayed a good slow-release effect of SCD for DBAYL. The rapid release of DBAYL from SCD during the first 12 h may provide enough DBAYL to execute its biological functions such as promoting postmeal insulin secretion.
Figure 2
Assay of prepared SCD for in vitro release, in vivo half-life and receptor specificity and potency.
Notes: (A) In vitro release process of DBAYL from SCD in RPMI 1640 cell culture medium supplemented with fetal bovine serum at 37°C. (B) The half-life of BAY55-9837, DBAYL, Exendin-4 and SCD in db/db mice. Displacement of (C) [125I]PACAP38 and (D) [125I]VIP by SCD, PACAP38, VIP, BAY55-9837 and VIP(1–7)/GRF(8–27) in membranes purified from CHO cells expressing human VPAC2. (E) cAMP accumulation induced by DBAYL or PACAP38 in CHO-VPAC2, CHO-VPAC1 and CHO-PAC1 cells. Results in (C) and (D) are expressed as the percentage of maximum binding to [125I]PACAP38 or [125I]VIP. Results in (E) are expressed as the percentage of maximum cAMP accumulation by PACAP38. **P<0.01, SCD, DBAYL or Exendin-4 vs BAY55-9837; ##P<0.01, SCD vs DBAYL or Exendin-4, data are the mean of three independent experiments.
In vivo circulating half-life of SCD was found with LC/MS/MS method. As shown in Figure 2B, the half-life of SCD in db/db mice was 14.12 h, which was about 7.1-fold higher than unconjugated peptide DBAYL (1.98 h) and 168.4-fold higher than BAY55-9837. The half-life of SCD was also significantly longer than Ex-4 which has been clinically used, indicating its potential in clinical application.
DBAYL released from SCD may activate specifically and potently VPAC2 receptor
Competition receptor binding assays were performed with VPAC2-CHOcells, [125I]PACAP38 and [125I]VIP, which helped identify DBAYL as a peptide selectively binding with VPAC2. DBAYL may displace [125I]PACAP38 from VPAC2competitively with an IC50 of 47.1±2.2 nM, and the IC50 values of BAY55-9837, PACAP38 and VIP were 69.5±4.3, 19.3±2.4 and 21.2±1.9 nM, respectively (Figure 2C). DBAYL displaced [125I]VIP from VPAC2competitively with an IC50 of 45.3±2.7 nM (Figure 2D). The results showed DBAYL released from SCD may selectively bind to VPAC2, and its IC50 of displacing [125I]PACAP38 or [125I]VIPcompetitively was lesser than BAY55-9837.cAMP accumulation in the three cell lines given above acted as an indicator of agonist potency at the three receptors. DBAYLcould potently activate VPAC2 with an EC50 of 0.61 nM, whereas the EC50 of DBAYL at VPAC1 was 804 nM and DBAYL had no agonist potency for PAC1 (Figure 2E). The EC50 values of PACAP38 for VPAC2, VPAC1 and PAC1 were 1.02, 0.93 and 0.55 nM, respectively (Figure 2E). The results indicated PACAP38 may potently activate the three receptors, whereas DBAYLcan activate VPAC2 specifically and potently.
SCD at low concentration significantly promotes proliferation of INS-1 cells
INS-1cells were treated with various concentrations of SC for 24 h, and MTT method was employed to measure thecell proliferation rates. The results showed that SeNPs at a concentration below 40 μM (using the final concentration of SeNPs as the quantitative index) had no effects on INS-1cell proliferation. SC showed dose-dependent inhibitory effects at concentrations >40 μM. Also, the IC50 of SC for INS-1cells was 66.10 μM, which indicates high concentrations (>40 μM) of SeNPs on theINS-1cells are cytotoxic, but not low concentrations (≤40 μM, Figure 3A).
Figure 3
Effects of SCD on normal or H2O2-injured INS-1 cell proliferation and ROS levels in H2O2-injured INS-1 cells.
Notes: (A) The survival of the normal INS-1 cells treated with different gradient concentrations of SC (using the final concentration of SeNPs as the quantitative index, 0, 10, 20, 30, 40, 50, 60, 70, 80 and 90 μM) was determined by the tetrazolium-based colorimetric assay (MTT assay). (B) Effects of different gradient concentrations of SCD (using the final concentration of DBAYL as the quantitative index, 0, 2.5, 5, 10 and 20 nM) on normal INS-1 cell proliferation. (C) Effects of the same doses of SeNPs, SC (210 nM, using the final concentration of SeNPs as the quantitative index), BAY55-9837, Exendin-4, DBAYL and SCD (10 nM, using the final concentration of peptides as the quantitative index) on normal INS-1 cell proliferation. (D) Effects of the same doses of SeNPs, SC (210 nM), BAY55-9837, Exendin-4, DBAYL and SCD (10 nM) on H2O2-injured INS-1 cell proliferation. (E) Effects of the same doses of SeNPs, SC (210 nM), BAY55-9837, Exendin-4, DBAYL and SCD (10 nM) on the ROS levels in H2O2-injured INS-1 cells. In the VPAC2 receptor blocking experiments, cells were preincubated with 50 nM of PG99-465 for 30 min at 37°C before adding 10 nM SCD in (C–E). (B) **P<0.01, different gradient concentrations of SCD (2.5, 5, 10 and 20 nM) vs blank control (0 nM). (C–E) **P<0.01, SeNPs, SC, BAY55-9837, Exendin-4, DBAYL or SCD vs PBS. (C) ##P<0.01, SCD vs Exendin-4 or BAY55-9837. (D) and (E) ##P<0.01, SCD vs DBAYL or Exendin-4 (Scheffé test, n=3).
TheINS-1cell proliferation-promoting effects of SCD at low SeNP concentrations (0, 105, 210 and 420 nM) were analyzed. As shown in Figure 3B, SCDcould promote normal INS-1cell proliferation below 10 nM (using the final concentration of DBAYL as the quantitative index) in a dose-dependent manner, and the proliferation rate was up to 15.59% after 10 nM SCD treatment for 24 h, which was similar to that of DBAYL and obviously higher than that for Ex-4, BAY55-9837, SeNPs and SC (Figure 3C). However, thecell proliferation-promoting effects basically disappeared (similar to that of SC) in INS-1cells preincubated with 50 nM of theVPAC2-selective inhibitor, PG99-465, for 30 min prior to 10 nM SCD treatment (Figure 3C). These results indicate that SCD mainly depends on theVPAC2-activation effect of the peptide DBAYL to promote the proliferation of INS-1cells.
SCD dramatically reduced ROS levels in H2O2-injured INS-1 cells
ROS level was used as an indicator, and the effect of SCD in protecting INS-1cells from oxidative damagecaused by H2O2 was explored. INS-1cells were cultured in the presence of 400 μM H2O2 for 1 h at 37°C. After being washed, thecells were treated with 10 nM of SCD in fresh media for 24 h, and the same doses of SC, SeNPs, BAY55-9837, Ex-4, DBAYL or the same volume of PBS were used for positive control or blank control. Cell viability was determined using theMTT assay. As shown in Figure 3D, the addition of H2O2 significantly decreased INS-1cell viability, while thecell survival rates were increased by 27.37%, 20.41%, 17.89%, 3.41%, 5.56% and 8.78% in SCD-, SC-, SeNPs-, BAY55-9837-, DBAYL- and Ex-4-treated, H2O2-injured INS-1cells, compared to PBS-treated, H2O2-injured INS-1cell control, respectively. The intracellular ROS levels of each treatment group are shown in Figure 3E. TheROS level was significantly increased in H2O2-injured INS-1cells; however, theROS levels were decreased by 36.84%, 33.11%, 31.35%, 3.46%, 8.34% and 12.69% in SCD-, SC-, SeNPs-, BAY55-9837-, DBAYL- and Ex-4-treated, H2O2-injured INS-1cells, respectively, compared to PBS-treated, H2O2-injured INS-1cell control. In contrast, the effects of SCD on promoting survival and decreasing ROS were reduced in INS-1cells preincubated with 50 nM of PG99-465 for 30 min prior to 10 nM SCD treatment. Thecell survival rates and ROS levels in (SCD + PG99-465)-treated, H2O2-injured INS-1cells were similar to those of SC-treated groups (Figure 3D and E). These results showed that SCDcould obviously increase the survival rates of H2O2-injured INS-1cells by eliminating intracellular ROS, and the biological effect was significantly stronger than that of DBAYL or Ex-4. In H2O2-injured INS-1cells, theoxidative damagecould be effectively inhibited by SCD eliminating ROS, which mainly depends on the antioxygenation effect of SeNPs or SC.
SCD significantly enhances insulin expression and secretion in INS-1 cells
To detect the effect of SCD on theinsulin expression in INS-1cells, quantitative PCR was used to measure proinsulin mRNA expression levels in INS-1cells treated with SCD, SC, SeNPs, BAY55-9837, DBAYL, Ex-4 and PBS for 24 h, respectively. The results showed that SCDcan increaseproinsulin mRNA levels <10 nM in a dose-dependent manner (Figure 4A). Theproinsulin mRNA level in 10 nM SCD-treated INS-1cells was 2.14-fold higher than PBS group. SCD was more potent in promoting proinsulin mRNA expression than DBAYL, Ex-4, BAY55-9837, SC and SeNPs, while SC and SeNPs had no obvious effect on proinsulin mRNA expression (Figure 4B).
Figure 4
Effects of SCD on the proinsulin mRNA expression and insulin secretion of INS-1 cells.
Notes: (A) SCD may significantly promote proinsulin mRNA expression. (B) Effects of the same doses of SeNPs, SC (210 nM), BAY55-9837, Exendin-4, DBAYL and SCD (10 nM) on proinsulin mRNA expression. (C) SCD may significantly promote insulin secretion of INS-1 cells. (D) Insulin secretion of INS-1 cells treated with SCD (10 nM) in KRBH buffer supplemented with 5.5, 11, 16.7 or 25 mmol/L glucose, respectively, was determined by ELISA method. (E) Effects of the same doses of SeNPs, SC (210 nM), BAY55-9837, Exendin-4, DBAYL and SCD (10 nM) on insulin secretion of INS-1 cells treated with SCD (10 nM) in KRBH buffer supplemented with 16.7 mmol/L glucose. In the VPAC2 receptor blocking experiments, cells were preincubated with 50 nM of PG99-465 for 30 min at 37°C before adding 10 nM SCD in B and E. (A) and (C) *P<0.05, **P<0.01, different gradient concentrations of SCD (2.5, 5, 10 and 20 nM) vs blank control (0 nM). (D) **P<0.01, glucose +10 nM SCD vs glucose. (B) and (E) **P<0.01, SeNPs, SC, BAY55-9837, Exendin-4, DBAYL or SCD vs PBS; ##P<0.01, SCD vs BAY55-9837, DBAYL or Exendin-4 (Scheffé test, n=3).
Enzyme-linked immunosorbent assay was used to determine the effects of SCD on INS-1 cell insulin secretion. As shown in Figure 4C, SCD possessed potent insulinotropic effect on INS-1cells in a dose-dependent manner in KRBH buffer supplemented with 16.7 mmol/L glucose (Figure 4C). Furthermore, theinsulinotropic effects of SCD increased gradually with KRBH bufferglucoseconcentration increase from 5.5 to 16.7 mM (Figure 4D), and in INS-1cells treated with 10 nM SCD in KRBH buffercontaining 16.7 mM glucose, thesecreted insulin level was about 2.23-fold as compared with that of glucose stimulation alone, which reached 45.97 nIU/mL/h (Figure 4E). Ex-4 and BAY55-9837 could also effectively promote insulin secretion in INS-1cells, but their insulinotropic effects were obviously weaker than that of SCD or DBAYL, while SC or SeNPs only possessed slight insulinotropic effects in INS-1cells (Figure 4E). In theVPAC2 receptor blocking experiments, SCD promoting proinsulin mRNA expression and insulinotropic effects largely disappeared, and the effects were similar to that of SC (Figure 4B and E). In addition, theinsulinotropic effect of SCD in INS-1cells was stronger than that of DBAYL or SCcarrier, indicating that DBAYL and SC in SCDcould synergistically promote theinsulin secretion of INS-1cells.
INS-1cells were treated with 0, 2.5, 5, 10 or 20 nM SCD, respectively, for 48 h, and the expression of insulin receptor β subunit was determined by Western blot test. The results showed that SCDcan increaseinsulin receptor expression at a concentration <10 nM in a dose-dependent manner (Figure 5A and B). In 10 nM SCD-treated INS-1cells, theinsulin receptor expression level was 1.72-fold that of PBS group, which was significantly higher than that of Ex-4 (1.35-fold), DBAYL (1.56-fold), BAY55-9837 (1.25-fold), SeNPs (1.17-fold) and SC (1.18-fold; Figure 5C and D). But promotion of insulin receptor expression effects largely reduced in INS-1cells preincubated with 50 nM of PG99-465 prior to 10 nM SCD treatment. The results showed that SCDcould potently promote theinsulin receptor expression in INS-1cells, and the biological effect is stronger than DBAYL, SC or Ex-4 due to the synergy effects of DBAYL and SC.
Figure 5
SCD significantly promoted insulin receptor expression and glucose uptake of INS-1 cells.
Notes: (A) Effects of different gradient concentrations of SCD on IR-β expression. (B) Relative expression assay for IR-β in A. (C) Effects of the same doses of SeNPs, SC (210 nM), BAY55-9837, Exendin-4, DBAYL and SCD (10 nM) on IR-β expression. (D) Relative expression assay for IR-β in (C). (E) Glucose uptake of INS-1 cells treated with SCD (10 nM) in KRBH buffer supplemented with 5.5, 11, 16.7 or 25 mmol/L glucose, respectively. (F) Glucose uptake of INS-1 cells treated with the same doses of SeNPs, SC (210 nM), BAY55-9837, Exendin-4, DBAYL and SCD (10 nM) in KRBH buffer supplemented with 16.7 mmol/L glucose. (B) **P<0.01, different gradient concentrations of SCD (2.5, 5, 10 and 20 nM) vs blank control (0 nM). (E) **P<0.01, glucose +10 nM SCD vs glucose. (D) and (F) **P<0.01, SeNPs, SC, BAY55-9837, Exendin-4, DBAYL or SCD vs PBS; ##P<0.01, SCD vs DBAYL or Exendin-4 (Scheffé test, n=3).
The effect of 10 nM SCD on INS-1cells’ glucose uptake from theculture buffer was determined, and the same doses of SeNPs, SC, BAY55-9837, Ex-4, DBAYL or PBS were used for controls. As shown in Figure 5E, compared with glucose stimulation alone and PBS, 10 nM SCDcould significantly enhance theglucose uptake of INS-1cells from theculture buffer containing 5.5, 11.0, 16.7 or 25.0 mM glucose in varying degrees, respectively. Theglucose uptake of INS-1cells cultured in KRBH buffercontaining 16.7 mM glucose was the highest and 1.95-fold that of glucose alone, and reached 2.31 mM (Figure 5F), which was higher than that of Ex-4 (1.81 mM), DBAYL (2.06 mM), BAY55-9837 (1.44 mM), SeNPs (1.05 mM) and SC (1.06 mM). However, in theVPAC2 receptor blocking experiments, the effects of SCD in promoting glucose uptake largely disappeared (similar to that of SC). Thus, these results indicate that SCDcan promote theglucose uptake of INS-1cells more effectively by the synergy effects of DBAYL and SC.
A single intraperitoneal dosing of SCD for db/db mice effectively promotes insulin secretion and lowers blood glucose
In order to determine the acute pharmacodynamic action of SCD, 10-week-old db/db mice were treated with SCD, Ex-4, BAY55-5837 and NS, respectively, by a single intraperitoneal dosing. The results showed that SCDcould lower the blood glucose levels in a dose-dependent manner, and its hypoglycemic effect was found as early as 30 min postdosing. Furthermore, the hypoglycemic activity significantly lasted for at least 13 h. Glucose levels were 52.1% and 78.4%, respectively, lesser than the baseline glucose levels at 30 min and 13 h postdosing in 20 nmol/kg SCD-treated db/db mice (Figure 6A). The hypoglycemic effect of Ex-4 was nearly the same as that of SCD within 30 min, whereas the effects of Ex-4 at 6 and 13 h postdosing were significantly lesser than SCD. BAY55-5837 only had momentary hypoglycemic effect within 30 min (Figure 6A).
Figure 6
Acute effect of SCD on hyperglycemia, glucose tolerance, first-phase (5–15 min) and second-phase (15–120 min) insulin secretion in db/db mice.
Notes: (A) The effect of SCD on blood glucose in 10-week-old male db/db mice. Food was removed 1 h before the experiment (−60 min). After the plasma samples were collected (time 0), SCD, Exendin-4, BAY55-9837 (20 nmol/kg) or NS was immediately intraperitoneally injected into the db/db mice. Glucose levels in db/db mice were measured at 1–15 h after administration. The mice were regularly fed (marked by arrows). (B) Intraperitoneal glucose tolerance tests in 10-week-old male db/db mice. (C) Insulin levels in IPGTT. (D) AUC for the first phase (5–15 min) and second phase (15–120 min) of insulin secretion during IPGTT. Data are the mean of eight independent experiments. Data presented as mean ± SEM. #P<0.05, SCD-treated mice vs BAY55-9837- or NS-treated mice, BAY55-9837- or SC-treated mice vs NS-treated mice; ##P<0.01, SCD-, Exendin-4-, DBAYL- or BAY55-9837-treated mice vs NS-treated mice, SCD-treated mice vs BAY55-9837- or NS-treated mice.
Abbreviations: AUC, area under the curve; IPGTT, intraperitoneal glucose tolerance test; NS, normal saline; SC, chitosan-modified selenium nanoparticles; SCD, DBAYL-conjugated, chitosan-modified selenium nanoparticles; SEM, standard error of the mean; SeNPs, selenium nanoparticles.
IPGTTs and insulin levels at different time points in IPGTTs were used to determine the effects of SCD on glucose tolerance and insulin secretion. Db/db mice were injected intraperitoneally with SC (42.1 μg/kg), SCD, BAY55-9837, Ex-4, DBAYL (20 nmol/kg) or the same volume of NS at 15 min prior to a glucosechallenge, and the blood glucose and insulin levels at different time points were measured. The results indicated NS-treated db/db mice displayed significant glucose intolerance and obvious FPIS (5–15 min) deficiency, whereas glucose tolerance was markedly improved in SCD-treated db/db mice, as characterized by rapid decrease in blood glucose and significantly lesser area under thecurve, compared to other treatments (Figure 6B and C). Furthermore, SCD-treated db/db mice exhibited obvious glucose-stimulated insulin secretion restoration. The area under thecurve for glucose-stimulated FPIS was 3.69-fold higher than NS, while there was only a 0.57-, 1.78-, 1.64- and 0.82-fold increase in glucose-stimulated FPIS in SC-, DBAYL-, Ex-4- and BAY55-9837-treated mice, respectively (Figure 6D). Glucose-stimulated second-phaseinsulin secretion (15–120 min) in SC-, DBAYL-, Ex-4-, BAY55-9837- and SCD-treated mice was 0.33-, 2.17-, 2.39-, 0.51- and 3.55-fold, respectively, higher than NS (Figure 6D). Consistent with these results, SC-, DBAYL-, Ex-4- and BAY55-9837-mediated alleviation of glucose intolerance was obviously weaker than SCD.
Chronic administration of SCD effectively improves fasting glucose levels, insulin resistance, lipid profiles and related tissue structures in db/db mice
For exploring thechronic pharmacodynamic action of SCD, 6-week-old db/db mice were injected intraperitoneally once per day with SC (42.1 μg/kg), DBAYL, Ex-4, BAY55-9837 or SCD (20 nmol/kg) or the same volume of NS for a period of 12 weeks. In SCD-treated db/db mice, food or waterconsumption, body weight and whole white fat were obviously decreased (Figure 7A and B; Table 1). As shown in Figure 7C and D, NS-treated db/db mice exhibited a gradual development of fasting hyperinsulinemia and hyperglycemia, whereas fasting insulin and glucose were markedly decreased in SCD-treated db/db mice. Especially, insulin tolerance tests showed SCD-treated db/db mice had obviously higher insulinsensitivity (Figure 7E). Compared with SC-, BAY55-9837-or NS-treated db/db mice, thelipid profiles were significantly improved, as characterized by reduced levels of free fatty acids, triglyceride, total cholesterol and low-density lipoprotein cholesterol in SCD-treated db/db mice, and thechronic pharmacodynamic benefits of SCD were much stronger than DBAYL and Ex-4. SC and BAY55-5837 only had slight or unobvious therapeutic effects.
Figure 7
Effect of chronic administration of SCD on db/db mice treated for 12 weeks.
Notes: Effect of SC (42.1 μg/kg, SeNPs content is same to that of 20 nmol/kg SCD), SCD, Exendin-4, BAY55-9837 (20 nmol/kg, using the final concentration of peptides as the quantitative index) or the same volume of NS on (A) food intake, (B) body weight, (C) fasting glucose, (D) fasting insulin levels during 12-week treatment and (E) ITT of db/db mice after 12-week treatment. Data are the mean of eight independent experiments. Data presented as mean ± SEM. ##P<0.01, SCD or Exendin-4-treated mice vs BAY55-9837- or NS-treated mice.
Abbreviations: ITT, insulin tolerance test; NS, normal saline; SC, chitosan-modified selenium nanoparticles; SCD, DBAYL-conjugated, chitosan-modified selenium nanoparticles; SEM, standard error of the mean; SeNPs, selenium nanoparticles.
Table 1
The effect of SCD on lipid profile and physiologic parameters of 6-week-old db/db mice that were treated by daily intraperitoneal injection for a period of 12 weeks
Parameters
db/m
db/db+
NS
SC
BAY55-9837
DBAYL
Exendin-4
SCD
CHOL (mmol/L)
1.84±0.15
2.53±0.26**
2.39±0.17**
2.55±0.25**
2.15±0.22#
2.48±0.21
1.94±0.13##
TG (mmol/L)
0.86±0.09
2.18±0.16**
2.02±0.13**
1.93±0.14**
1.60±011##
1.33±0.12##
1.14±0.08##
LDL-C (mmol/L)
0.31±0.03
0.70±0.08**
0.68±0.04**
0.63±0.12**
0.55±0.08#
0.69±0.06
0.40±0.04##
HDL-C (mmol/L)
1.23±0.13
1.41±0.16**
1.43±0.12**
1.46±0.20**
1.57±0.44#
1.62±0.21#
1.74±0.16##
Water consumption (g/d)
5.3±1.41
27.1±1.79**
25.9±1.23**
27.2±1.90**
16.8±1.25##
16.1±1.25##
10.6±1.64##
Free fatty acid (mEq/L)
0.70±0.22
1.32±0.35**
1.34±0.31**
1.30±0.19**
1.06±0.29##
0.84±0.27##
0.75±0.26##
Whole white fat (g)
0.6±0.09
16.7±1.95**
15.9±1.72**
15.3±1.28**
10.6±1.29##
10.9±1.29##
7.20±1.09##
Notes:
P<0.01, BAY55-9837-, SC- or NS-treated db/db mice vs normal control db/m mice;
P<0.05,
P<0.01, SCD, DBAYL or Exendin-4-treated db/db mice vs BAY55-9837-, SC- or NS-treated db/db mice. Data are the mean of eight independent experiments. Data presented as mean ± SEM.
Abbreviations: CHOL, cholesterol; HDL-C, high-density lipoprotein cholesterol; LDL-C, low-density lipoprotein cholesterol; NS, normal saline; SC, chitosan-modified selenium nanoparticles; SCD, DBAYL-conjugated, chitosan-modified selenium nanoparticles; SEM, standard error of the mean; TG, triglyceride.
After 12-week treatment with NS, SC, BAY55-9837, DBAYL, Ex-4 or SCD, the structural changes of pancreatic and adipose tissue in db/db mice were examined with hematoxylin and eosin stain. As shown in Figure 8, in NS-treated db/db mice, the distribution of pancreas cells was scattered and vacuolar degeneration was significant; furthermore, numerous exocrine acinar cells invaded pancreatic islets accompanied by infiltration of inflammatory cells, while the volume and number of adipose tissue cells were significantly increased compared with the normal db/m mice (Figure 8A and B). Conversely, in SCD-treated db/db mice, the distribution and shape of thepancreatic islet cells were regular without vacuolar degeneration and inflammatory infiltration, and the size and shape of the adipocytes were small and basically uniform, which indicated pancreatic islet and adipose tissue structures tended to be normal (Figure 8A and B). Notably, SCD did not cause observable inflammatory and abnormal pathologicchanges in pancreatic and adipose tissue in db/db mice after intraperitoneal injection of SCD once per day for 12 weeks.
Figure 8
HE staining for determination of pancreas (A) and adipose tissue (B) in 6-week-old male db/m mice and db/db mice respectively treated with SCD, BAY55-9837, Exendin-4, DBAYL (20 nmol/kg), SC (42.1 μg/kg) or the same volume of NS for 12 weeks.
Abbreviations: HE, hematoxylin and eosin; NS, normal saline; SC, chitosan-modified selenium nanoparticles; SCD, DBAYL-conjugated, chitosan-modified selenium nanoparticles.
Discussion
T2D is a chronicmetabolic disease, and its main pathogenesis is pancreatic islet beta cell dysfunction including the reduction in thecell number or functional decline, and insulin resistance.1 In medium- and long-term patients with T2D, the number of pancreatic islet beta cells significantly decreases,36 and insulin resistance induced by insulinsensitivity decline leads to the interference in glucose uptake and utilization. Current therapies for T2D mainly include insulinsensitizers, exogenous supply of insulin, α-glucosidase inhibitors and sulfonylureas, but have limitations of therapeutic function and side effectscaused by prolonged use, including theislet beta cell dysfunction or insulin signal transduction disorder.37 Therefore, a therapeuticconsensus on protecting the beta cells efficiently, improving theinsulinsensibility and drug combination has been recognized and accepted by more and more researchers.Compared with antibodies and small molecule therapeutics, peptides possess lower size and higher specificity, respectively. Peptide-based drug development has shown a steady increase over the past years.38,39 Ex-4 (Exanatide) is a GLP1 derivative and is used for T2D treatment, but the risks of pancreatitis and common gastrointestinal side effects including vomiting or nausea were found in nearly 50% of the users, which limits its wide clinical applications. Several VPAC1/2 agonists such as BAY55-9837, Ro25-1392 and Ro25-1553 have been studied, and Ro25-1392 and Ro25-1553 can activate both VPAC1 and VPAC2 effectively.40,41 BAY55-9837 produced by chemical synthesis is a specificVPAC2 agonist and possesses glucose-dependent hypoglycemic and insulinotropic actions without gastrointestinal side effects. But the development of BAY55-9837 for T2D treatment has been hampered due to its in vivo limited bioavailability and short half-life. PEGylation, fusion expression of bioactive peptides and humanserum albumin or Fc portion of an antibody, and combination therapy of peptide drugs and protease inhibitor have been explored to prolong the half-life and improve bioavailability.42–45 Although the fusion expression strategy may effectively extend the half-life of bioactive peptide, for maintaining high bioactivity, the bioactive peptides ought to be released in an orderly manner from the fusion protein or delivery carrier.SCDconsists of a highly selective VPAC2 agonist DBAYL with optimized structure based on the amino acid mutation of BAY55-9837 peptide and chitosan-modified SeNPs. DBAYL may promote effectively the proliferation of islet beta cells, insulin expression or secretion, insulin receptor expression, glucose uptake and utilization through selective activation of VPAC2 receptor. Chitosan-modified SeNP (SC) is both a drug delivery carrier and an auxiliary therapeutic agent becauseSCcould not only slowly release the bioactive peptide DBAYL in an orderly manner through specificchymotrypsin and cathepsin Dcleavage, but also significantly resist oxidative damage, moderately promote insulin receptor expression and slightly promote insulin secretion or glucose uptake. The high loading rate of SCcan reduce SC dose, and a low dose of SeNPs may enhance thecell antioxidant activity and prevent islet beta cells apoptosis.22,23 Oxidative damage may be the important inducing factor during diabetes progression.46 In diabeticpatients with persistent high blood glucose level, the body produces excessive ROS and reactive nitrogen; also, compared with other tissue cells, in the islet beta cells, the expression levels of superoxide dismutase, glutathione peroxidase and other antioxidases are low. Furthermore, the expression levels do not increase with increased oxidative stress levels. Also, the islet beta cells lack ROSclear proteins such as thioredoxin, which makes them more sensitive to ROS and reactive nitrogen.47 ROScan not only inhibit glucose-stimulated insulin secretion from pancreatic islet beta cells, but also obviously increase thecell cycle regulatory protein p21 expression, reduce insulin expression and diminish both mitochondrial and cytoplasmiccalcium flux, causing oxidative damage and apoptosis of pancreatic islet beta cells.48,49The in vitro results show that SeNPs, SC and SCDcan all significantly reduce theROS level in H2O2-injured INS-1 model cells mainly by SeNPs antioxygenation, and SCDcan also obviously promote cell proliferation, insulin expression and secretion, glucose uptake and insulin receptor expression by DBAYLselectively activating VPAC2 receptor in INS-1cells. Furthermore, SCDcan slowly releaseDBAYL peptide in vitro; more importantly, the relatively rapid DBAYL release (about 63%) from SCD during the first 12 h may provide enough DBAYL to execute its biological functions such as promoting postmeal insulin secretion. In agreement with this, in db/db mice, thecirculating half-life of SCD was about 169-, 7- and 3.5-fold longer than BAY55-9837, DBAYL and Ex-4, respectively, and the hypoglycemic activity of SCD (converting into the dosage of DBAYL and SC, they are 20 nmol/kg body weight and 42.1 μg/kg body weight, respectively) lasted for nearly 14 h. These results indicated the structural defects from BAY55-9837 or DBAYL have been overcome, as characterized by long half-life, high bioavailability and long-lasting hypoglycemic activity. In IPGTT experiment, theSCD-treated db/db mice displayed robust glucose-stimulated FPIS (5–15 min) and remarkably increased plasma insulin levels throughout IPGTT. Moreover, chronic administration of SCD also effectively improves fasting glucose levels, insulin resistance, lipid profiles, food or waterconsumption and body weight. Histopathologic study after chronic administration of SCD showed that in vivo, the novel SCDcan also effectively improve the structure of pancreatic and adipose tissue; after all, thepancreatic islet disorder and the adipocyte volume increase are closely related with the indicators of the risk for developing T2D, systemicinsulin resistance and dyslipidemia.50,51
Conclusion
In short, this study displays a novel peptide-conjugated, chitosan-modified SeNPs (SCD), consisting of a recombinant PACAP-derived peptide DBAYLcapable of specifically activating VPAC2 receptor, and chitosan-modified SeNPs (SC) with slow release and therapeutic action. SCD displayed enhanced effects in improving insulinsensitivity, hyperglycemia and lipid profiles, but did not causehypoglycemia, mainly through selectively activating VPAC2 receptor and resisting oxidative damage. Compared with Ex-4, a clinical drug needed to be injected twice per day, SCD has the potential to become a long-acting anti-T2D therapeutic owing to the synergy effects of SC and DBAYL.
Authors: Carmen Martínez; Yasmina Juarranz; Irene Gutiérrez-Cañas; Mar Carrión; Selene Pérez-García; Raúl Villanueva-Romero; David Castro; Amalia Lamana; Mario Mellado; Isidoro González-Álvaro; Rosa P Gomariz Journal: Int J Mol Sci Date: 2019-12-20 Impact factor: 5.923