Yu-Sung Cheng1, Zih-Ten Chen2, Tai-Yan Liao2, Chen Lin2, Howard C-H Shen2, Ya-Han Wang2,3, Chi-Wei Chang4, Ren-Shyan Liu4,5, Rita P-Y Chen6,3, Pang-Hsien Tu7. 1. Institute of Biomedical Sciences, Academia Sinica, Taipei, Taiwan. 2. Institute of Biological Chemistry, Academia Sinica, Taipei, Taiwan. 3. Institute of Biochemical Sciences, National Taiwan University, Taipei, Taiwan. 4. Biomedical Imaging Research Center, Department of Nuclear Medicine, National Yang-Ming University and Taipei Veterans General Hospital, Taipei, Taiwan. 5. Molecular and Genetic Imaging Core, Taiwan Mouse Clinic, Academia Sinica, Taipei, Taiwan. 6. Institute of Biological Chemistry, Academia Sinica, Taipei, Taiwan pyc@gate.sinica.edu.tw benrosetu@yahoo.com. 7. Institute of Biomedical Sciences, Academia Sinica, Taipei, Taiwan pyc@gate.sinica.edu.tw benrosetu@yahoo.com.
Abstract
Alzheimer's disease (AD) is the most common neurodegenerative disease. Imbalance between the production and clearance of amyloid β (Aβ) peptides is considered to be the primary mechanism of AD pathogenesis. This amyloid hypothesis is supported by the recent success of the human anti-amyloid antibody aducanumab, in clearing plaque and slowing clinical impairment in prodromal or mild patients in a phase Ib trial. Here, a peptide combining polyarginines (polyR) (for charge repulsion) and a segment derived from the core region of Aβ amyloid (for sequence recognition) was designed. The efficacy of the designed peptide, R8-Aβ(25-35), on amyloid reduction and the improvement of cognitive functions were evaluated using APP/PS1 double transgenic mice. Daily intranasal administration of PEI-conjugated R8-Aβ(25-35) peptide significantly reduced Aβ amyloid accumulation and ameliorated the memory deficits of the transgenic mice. Intranasal administration is a feasible route for peptide delivery. The modular design combining polyR and aggregate-forming segments produced a desirable therapeutic effect and could be easily adopted to design therapeutic peptides for other proteinaceous aggregate-associated diseases.
Alzheimer's disease (AD) is the most common neurodegenerative disease. Imbalance between the production and clearance of amyloid β (Aβ) peptides is considered to be the primary mechanism of AD pathogenesis. This amyloid hypothesis is supported by the recent success of the human anti-amyloid antibody aducanumab, in clearing plaque and slowing clinical impairment in prodromal or mild patients in a phase Ib trial. Here, a peptide combining polyarginines (polyR) (for charge repulsion) and a segment derived from the core region of Aβ amyloid (for sequence recognition) was designed. The efficacy of the designed peptide, R8-Aβ(25-35), on amyloid reduction and the improvement of cognitive functions were evaluated using APP/PS1 double transgenic mice. Daily intranasal administration of PEI-conjugated R8-Aβ(25-35) peptide significantly reduced Aβ amyloid accumulation and ameliorated the memory deficits of the transgenic mice. Intranasal administration is a feasible route for peptide delivery. The modular design combining polyR and aggregate-forming segments produced a desirable therapeutic effect and could be easily adopted to design therapeutic peptides for other proteinaceous aggregate-associated diseases.
Alzheimer's disease (AD) is the most common neurodegenerative disease that causes dementia across multiple cognitive domains. Its incidence increases significantly with age and doubles every 5 years among the geriatric population ≧ 65 years of age. Despite remarkable scientific advancement and the vast resources invested in drug development, no effective therapy is currently available for AD. Thus, it is listed as one of the major unmet medical needs worldwide.Although the etiology of AD remains unclear, the amyloid cascade hypothesis is the most supported explanation to date and is recently further strengthened by the finding of a protective APP mutation near the β‐cleavage site against the development of late‐onset dementia (Jonsson et al, 2012). Unfortunately, a series of clinical trials based on amyloid reduction therapy (ART) failed to deliver anticipated clinical improvement on mild‐to‐moderate patients with AD (Ross & Imbimbo, 2010; Aisen et al, 2011; Roher et al, 2011; Grundman et al, 2013; Khorassani & Hilas, 2013), raising legitimate concerns for the accuracy of amyloid cascade hypothesis and the future of ART (Extance, 2010). However, given that alternative strategies aimed at reducing neuroinflammation, cholesterol level, or oxidative stress have similarly failed to improve the clinical outcome of AD, it is fair to say that the jury is still out on finding the culprit for the failures of these clinical trials. Previous data reveal that a substantial percentage (~50%) of neurons have already disappeared in even the mild cognitive impairment or very mild AD (Gomez‐Isla et al, 1996; Mufson et al, 2000; Price et al, 2001). Consistent with these, more recent findings show that alterations in amyloid biology represent the earliest detectable changes in the brain in familial AD and start in the brain more than 20 years prior to the onset of AD (Bateman et al, 2012). It is likely that the ART trials (and other alternatives) fail because they miss the most opportune “therapeutic window” of AD. Thus, ART still remains a vital and important choice when given earlier. In fact, clinical trials with very early or pre‐symptomatic intervention using ART are currently being conducted or have been planned (Miller, 2012; Wadman, 2012; Moulder et al, 2013). The preliminary success of ART with aducanumab immunotherapy in decreasing cognitive decline further strengthens this hypothesis (Moreth et al, 2013; Lannfelt et al, 2014; Ratner, 2015; Underwood, 2015; Selkoe & Hardy, 2016; Sevigny et al, 2016).Peptide drugs have been used with consistent benefits for many years and have advantages over small molecules, such as higher potency and fewer off‐target side effects (Craik et al, 2013). In addition, the properties of easy customization and synthesis under a well‐controlled environment make peptides excellent candidates for AD drug development. Neurodegenerative diseases encompass a heterogeneous group of neurological diseases characterized by synoptic and neuronal losses caused by multiple factors. Misfolded proteinaceous aggregates which exist in a variety of these diseases besides AD, including Parkinson's disease, Huntington's disease, amyotrophic lateral sclerosis, are considered one of them, and may cause or contribute to these diseases through their prionlike property (Kim & Holtzman, 2010; de Calignon et al, 2012; Luk et al, 2012; Smethurst et al, 2016). In spite of the difference in the constituent proteins and complexity of assembly mechanism, the proteinaceous aggregates across these diseases share common structural conformations such as a β‐sheet conformation in the backbone (Funke & Willbold, 2012). This provides the basis for a rational design of therapeutic peptides for these misfolded aggregate‐associated diseases by applying a universal principle to reverse the process of formation. In this study, we propose a novel modular approach to design an ART peptide drug and test its efficacy using the APP/PS1transgenicmouse model.
Results
Design of the inhibitor peptide
Amyloid in AD is an insoluble β‐sheet structure formed by Aβ peptides. Thus, in order to inhibit amyloid propagation, the inhibitor should be equipped with the following characteristics: (i) the ability to interact with Aβ monomer/aggregates and (ii) the ability to prevent Aβ from association into higher order polymers and fibrils. Here, we proposed a rational approach based on the concept of modularity to design bipartite inhibitor peptides comprising two different modules, each possessing one of the aforementioned characteristics, as a prototype of potential therapeutic agents. The concept of our design was schematically presented in Fig 1A. The first module was a partial sequence derived from Aβ peptide which, because of its known propensity to self‐aggregate, was anticipated to bestow on the inhibitor peptide an ability to bind to Aβ with high specificity. The second module was a charged moiety which, through the repulsion force exerted by these charges, could prevent not only self‐aggregation of the inhibitor peptide, but also the propagation of amyloid after the inhibitor peptide bound to its Aβ target.
Figure 1
The inhibition model of R8‐Aβ(25–35) and the dose‐dependent effect of R8‐Aβ(25–35) on inhibition of Aβ40 fibrillization
Aβ40 was mixed with R8‐Aβ(25–35) in different mixing ratios (Aβ40:R8‐Aβ(25–35) = 1:0.1, 1:0.2, 1:1). The Aβ40 concentration is 30 μM. The peptides were dissolved in 20 mM sodium phosphate buffer with 150 mM KCl (pH 7) and incubated at 25°C.
Proposed working mechanism.
CD spectra of Aβ40 alone (B) and three Aβ40/R8‐Aβ(25–35) mixtures (C, 1:0.1; D, 1:0.2; E, 1:1) were recorded at the indicated incubation times.
TEM images of the samples in (B), (C), (D), and (E) taken at the indicated incubation times are shown in (F), (G), (H), and (I), respectively.
The inhibition model of R8‐Aβ(25–35) and the dose‐dependent effect of R8‐Aβ(25–35) on inhibition of Aβ40 fibrillization
Aβ40 was mixed with R8‐Aβ(25–35) in different mixing ratios (Aβ40:R8‐Aβ(25–35) = 1:0.1, 1:0.2, 1:1). The Aβ40 concentration is 30 μM. The peptides were dissolved in 20 mM sodium phosphate buffer with 150 mM KCl (pH 7) and incubated at 25°C.Proposed working mechanism.CD spectra of Aβ40 alone (B) and three Aβ40/R8‐Aβ(25–35) mixtures (C, 1:0.1; D, 1:0.2; E, 1:1) were recorded at the indicated incubation times.TEM images of the samples in (B), (C), (D), and (E) taken at the indicated incubation times are shown in (F), (G), (H), and (I), respectively.It has been reported that the sequence of residues 25–35 of Aβ is important for Aβ aggregation and toxicity (Hughes et al, 2000; Ban et al, 2004; Liu et al, 2004). In this study, we designed an L‐form inhibitor peptide, R8‐Aβ(25–35), and its D‐form counterpart, DR8‐Aβ(25–35), by combining Aβ(25–35) (the Aβ‐binding module) with a segment of consecutive eight L‐form or D‐form Arg residues (R8 or DR8) (the charge repulsion module). The conformational properties of these two bipartitepeptides and their effects on the inhibition of Aβ amyloidogenesis and toxicity were examined. Intranasal delivery has been shown to be an effective way to deliver insulin into brain to alleviate memory deficit in patients with amnestic mild cognitive impairment or AD (Craft et al, 2012; Claxton et al, 2015). It has been reported that PEI cationization facilitates protein transduction across the cell membrane and has been used in drug design to bypass blood–brain barrier into the brain parenchyma via intranasal delivery (Futami et al, 2005, 2007; Kitazoe et al, 2005, 2010; Loftus et al, 2006; Murata et al, 2008a,b; Lin et al, 2016). Thus, to facilitate entry of our peptide into the mouse brain, polyethylenimine (PEI) was conjugated with R8‐Aβ(25–35), which contained the poly‐R segment that could also enhance peptide penetration (Herve et al, 2008; Patel et al, 2009). We synthesized PEI‐conjugated R8‐Aβ(25–35) and tested its therapeutic effect in the APP/PS1transgenic mice via intranasal administration.
Conformational study of Aβ40, R8‐Aβ(25–35), and DR8‐Aβ(25–35)
To investigate the biophysical property of our designed peptides concerning amyloid formation, Aβ40, R8‐Aβ(25–35), and DR8‐Aβ(25–35) dissolved in 20 mM sodium phosphate buffer with 150 mM KCl (pH 7) were individually incubated at 25°C. The circular dichroism (CD) spectra were recorded at various time points as indicated. In Aβ40 spectra, as expected, the intensity of the negative ellipticity at 218 nm increased and the intensity at 200 nm decreased with time (Fig 1B and Appendix Fig S1A), consistent with its known ability to form amyloid fibrils as shown by transmission electron microscopy (TEM) (Fig 1F and Appendix Fig S1D). In contrast, the CD spectra of R8‐Aβ(25–35) showed negative ellipticity at 200 nm, indicative of random coil structure (Appendix Fig S1B). Similarly, the DR8‐Aβ(25–35) also had CD spectra consistent with random coil structure, which lacked strong negative ellipticity at 200 nm due to the presence of eight D‐form arginines in the peptide (Appendix Fig S1C). The CD spectra of both peptides remained largely unchanged with the incubation time. Under the same incubation condition, R8‐Aβ(25–35) and DR8‐Aβ(25–35) did not form amyloid fibrils at all except for small blobs of amorphous aggregates under transmission electron microscopy after incubation for 168 h (Appendix Fig S1E and F).
Inhibition effect of our designed bipartite peptides on the fibrillization of Aβ40
To examine whether R8‐Aβ(25–35) could interfere with the amyloidogenesis of Aβ40, the CD spectra of Aβ40 mixed with R8‐Aβ(25–35) at 1:0.1, 1:0.2, or 1:1 molar ratios were measured. As shown in Fig 1C–E, the change in the CD spectrum of Aβ40 (an increase in the negative ellipticity at 218 nm and a decrease at 200 nm) clearly decreased by R8‐Aβ(25–35) in a dose‐dependent manner. Notably, the inhibition effect of R8‐Aβ(25–35) on Aβ40 fibrillization was observed even when its concentration was ten times lower than Aβ40 (Fig 1C and E). Consistent with these CD studies, TEM revealed a clear reduction in both thickness and abundance of the amyloid fibrils at all time points we observed (Fig 1G–I). These results showed that R8‐Aβ(25–35) interacted with Aβ40, interfered with its self‐aggregation, and thereby significantly delayed or decreased the formation of Aβ40 amyloid fibrils.Interestingly, the inhibition effect was also observed with DR8‐Aβ(25–35) (Appendix Fig S2), suggesting that it was the charge, rather than the steric structure, of the R8 moiety that prevented Aβ40 from aggregation.
Attenuation of Aβ40 cytotoxicity by R8‐Aβ(25–35) and DR8‐Aβ(25–35)
Because our designed bipartitepeptides interfered with Aβ40 self‐aggregation, we tested whether these peptides could decrease the toxicity of Aβ40 by measuring the viability of Neuro2a, a mouseneuroblastoma cell line with the MTT assay. Cells were treated with peptides as indicated. Aβ40 (30 μM) exerted significant cytotoxicity to Neuro2a cells; only 30% of the cells survived the treatment. In contrast, R8‐Aβ(25–35) or DR8‐Aβ(25–35) had no detectable toxicity to the N2a cells (Fig 2A). Interestingly, R8‐Aβ(25–35) or DR8‐Aβ(25–35) each decreased Aβ40 toxicity, as evidenced by an increase in cell viability from 30% to 70–75% (Fig 2B). For comparison, when Aβ40 was mixed with Aβ(25–35), very small change in cell viability was observed. Our data indicated that our designed bipartitepeptides might have therapeutic potential in amyloid‐induced toxicity.
Figure 2
Cell viability measurement by MTT assays
Data information: Peptide concentration is 30 μM for each peptide. Standard deviations of the mean are shown as bars for each sample (N = 6 for pure peptide and N = 12 for mixture). The statistics were done by Student's t‐test.
Neuro2a cells treated with DMSO (control), Aβ40, R8‐Aβ(25–35), or DR8‐Aβ(25–35).
Neuro2a cells treated with DMSO (control), Aβ40, and Aβ40 with equal molar R8‐Aβ(25–35), DR8‐Aβ(25–35), or Aβ(25–35).
Cell viability measurement by MTT assays
Data information: Peptide concentration is 30 μM for each peptide. Standard deviations of the mean are shown as bars for each sample (N = 6 for pure peptide and N = 12 for mixture). The statistics were done by Student's t‐test.Neuro2a cells treated with DMSO (control), Aβ40, R8‐Aβ(25–35), or DR8‐Aβ(25–35).Neuro2a cells treated with DMSO (control), Aβ40, and Aβ40 with equal molar R8‐Aβ(25–35), DR8‐Aβ(25–35), or Aβ(25–35).
Therapeutic effect of R8‐Aβ(25–35)‐PEI in APP/PS1 transgenic mice
To test whether R8‐Aβ(25–35) could prevent the deterioration of memory in vivo, PEI or PEI‐coupled R8‐Aβ(25–35), denoted as R8‐Aβ(25–35)‐PEI, was given intranasally for 4 months to APP/PS1mice when they were 4 months of age (experimental sets 1 and 2, Appendix Fig S3). The water maze assay was performed when the mice reached 8 months of age. As shown in Fig 3A, the wild‐type mice treated with PEI or R8‐Aβ(25–35)‐PEI showed no clear difference in the learning curve of finding the hidden platform. In contrast, the peptide‐treated APP/PS1mice exhibited a significant improvement in learning compared to the control transgenic mice treated with PEI. In addition, peptide‐treated APP/PS1mice performed better at the probe test, as evidenced by their higher crossing number (Fig 3B) and longer time spent in the quadrant where the probe used to be compared to PEI‐treated control transgenics (Fig 3C).
Figure 3
Effect of intranasally delivered R8‐Aβ(25–35)‐PEI on transgenic mice after 4‐month treatment
Wild‐type (WT) and APP/PS1 mice were treated with either PEI or R8‐Aβ(25–35)‐PEI from the age of 4 months to 8 months.
Data information: The data were expressed in mean ± SD, and the statistics were done by Student's t‐test for panels (D–F).
Morris water maze. (A) The plot of the escape latency. (B) The times of the indicated mice crossing the target quadrant. (C) Percentage of time the indicated mice spent swimming in the target quadrant where the hidden platform used to be. The behavior data were expressed in mean ± SEM. The statistics of the escape trend were done with two‐way ANOVA. Others were done by Student's t‐test.
ELISA of total Aβ40 and Aβ42 in hippocampus (D) and cortex (E) (N = 3 per group).
Level of IL‐6 and IL‐1β in the cortex (N = 3 per group).
Effect of intranasally delivered R8‐Aβ(25–35)‐PEI on transgenic mice after 4‐month treatment
Wild‐type (WT) and APP/PS1mice were treated with either PEI or R8‐Aβ(25–35)‐PEI from the age of 4 months to 8 months.
Data information: The data were expressed in mean ± SD, and the statistics were done by Student's t‐test for panels (D–F).Morris water maze. (A) The plot of the escape latency. (B) The times of the indicated mice crossing the target quadrant. (C) Percentage of time the indicated mice spent swimming in the target quadrant where the hidden platform used to be. The behavior data were expressed in mean ± SEM. The statistics of the escape trend were done with two‐way ANOVA. Others were done by Student's t‐test.ELISA of total Aβ40 and Aβ42 in hippocampus (D) and cortex (E) (N = 3 per group).Level of IL‐6 and IL‐1β in the cortex (N = 3 per group).We next assessed the changes in the level of Aβ peptide in the experimental set 1 animals by ELISA. As shown in Fig 3D and E, at the age of 8 months, the level of Aβ40 and Aβ42 decreased by 73% and 60%, respectively, in the hippocampus of peptide‐treated APP/PS1mice compared with those of PEI‐treated transgenic mice (Fig 3D). Similarly, the level of Aβ40 and Aβ42 decreased by 86% and 32%, respectively, in the cortex of the former group compared with the latter (Fig 3E). Our data indicate that the peptide treatment effectively reduced Aβ accumulation and slowed down the clinical impairment of memory. Amyloid deposition is known to induce neuroinflammation, which contributes to disease pathogenesis in these mice. We therefore conducted cytokine assays. R8‐Aβ(25–35)‐PEI effectively decreased the level of pro‐inflammatory cytokines interleukin (IL)‐6 and IL‐1β in the cortex (Fig 3F) in parallel with the changes in the level of Aβ peptides.
Continuous therapeutic effect of R8‐Aβ(25–35)‐PEI after a suspension for 4 weeks
During the water maze tests, the treatment was adjourned for about 4 weeks. To examine whether the therapeutic effect could be maintained after a suspension of treatment, administration of PEI or peptide was resumed and continued for 4 more months (experimental set 2, Appendix Fig S3). The accumulation of amyloid plaques was quantified with microPET using the tracer Pittsburg compound B (PiB). As shown in Fig 4A and B, the peptide‐treated APP/PS1mice had a much lower signal in the cortex, hippocampus, amygdala, and olfactory bulb compared with the PEI‐treated mice, consistent with a beneficial therapeutic effect at this age. ELISA analyses revealed a significant decrease in SDS‐insoluble Aβ40 and Aβ42 by 25–30% in the cortex or hippocampus of the peptide‐treated APP/PS1mice compared with those in PEI‐treated mice (Fig 4C and D), consistent with the microPET results (18–33% reduction). Correspondingly, SDS‐soluble Aβ40 and Aβ42 levels significantly increased after peptide treatment (Fig 4E and F). One important biomarker in AD diagnosis is the decrease in Aβ42 level in the cerebral spinal fluid due to Aβ aggregation; a reversion of this process is expected to increase soluble Aβ concentration. Thus, these results demonstrated that our inhibitor peptide was able to inhibit Aβ from self‐associating into amyloid fibrils/plaques.
Figure 4
Effect of intranasally delivered R8‐Aβ(25–35)‐PEI on mice from 4 months to 13 months of age with a 1‐month break within this period
Data information: Data were expressed in mean ± SD, and the statistics were conducted with the Student's t‐test.
Representative MicroPET image of the transgenic mouse brains co‐registered with mouse T2‐weighted MRI brain template. CTX, cortex; HIP, hippocampus; AMY, amygdala.
Quantitation of [11C]PiB uptake in the cortex, hippocampus, amygdala, and olfactory bulb (N = 6 per group).
ELISA of SDS‐insoluble Aβ40 and Aβ42 in the cortex (C) and hippocampus (D) and SDS‐soluble Aβ40 and Aβ42 in the cortex (E) and hippocampus (F) (N = 5 per group).
Effect of intranasally delivered R8‐Aβ(25–35)‐PEI on mice from 4 months to 13 months of age with a 1‐month break within this period
Data information: Data were expressed in mean ± SD, and the statistics were conducted with the Student's t‐test.Representative MicroPET image of the transgenicmouse brains co‐registered with mouse T2‐weighted MRI brain template. CTX, cortex; HIP, hippocampus; AMY, amygdala.Quantitation of [11C]PiB uptake in the cortex, hippocampus, amygdala, and olfactory bulb (N = 6 per group).ELISA of SDS‐insoluble Aβ40 and Aβ42 in the cortex (C) and hippocampus (D) and SDS‐soluble Aβ40 and Aβ42 in the cortex (E) and hippocampus (F) (N = 5 per group).
Inhibition effect of R8‐Aβ(25–35)‐PEI on performed amyloid plaques in older mice
To test whether R8‐Aβ(25–35)‐PEI could prevent Aβ accumulation when amyloid plaques had already formed, we started peptide treatment with higher dosage (4 nmole/mouse/day) in another set of mice from the age of 8 months for 2 months until they were 10 months of age (experimental set 3 in Appendix Fig S3). As shown in Appendix Fig S4, treatment with R8‐Aβ(25–35)‐PEI did not decrease the number of amyloid plaques, but significantly decreased several parameters, including the size of individual plaques, the percentage of the cortex covered by plaques, and the total area of amyloid plaques per cortex, by 20%, 22%, and 24%, respectively. These data confirmed the therapeutic effect of this peptide even when administrated for a short time in mice with pre‐existing amyloid plaques.To investigate whether the therapeutic effect of R8‐Aβ(25–35)‐PEI was possible with the Arg‐rich segment alone, without needing Aβ(25–35), we also conducted experiments with R8‐YS‐PEIpeptide in the set 3 mice. No therapeutic benefit was observed (Appendix Fig S4). The results confirmed that R8‐Aβ(25–35)‐PEI required the Aβ(25–35) segment for target recognition to reduce the amyloid accumulation.
Entrance of R8‐Aβ(25–35)‐PEI peptide into brains
To determine whether the intranasally given peptide inhibitor entered brains, we synthesized fluorescence‐conjugated peptide, FITC‐(Ahx)‐CR8‐Aβ(25–35)‐PEI. A higher dosage (5 μl of 1,800 μM peptide; 9 nmole/mouse/day) was given daily to one 10‐week‐old female C57BL/6JNarl mouse for three consecutive days in these tests in order to enhance the success rate of detection (experimental set 4 in Appendix Fig S3). Brains were collected and processed at 0.5, 2, 6, 12, and 24 h after the completion of the 3rd peptide treatment. The amount of the intracerebralpeptide was quantified by the FITC emission spectra between 500 and 600 nm of the brain filtrates excited at 446 nm (Fig 5A) against a calibration curve (Appendix Fig S5). The peptide was indeed detectable in the brains, which reached the peak (5.16 nmole) 6 h after the treatment, and then decreased at a rate about 0.086 nmole per hour (Fig 5B). In addition, the amounts of the peptide at the time points of 0.5 and 12 h were higher than that of 24 h. These data indicated that the peptide entered brain efficiently and was maintained at higher level for more than 12 h.
Figure 5
Brain penetration of FITC‐(Ahx)‐CR
8‐Aβ(25–35)‐PEI after the third dosing via intranasal route
The mice were treated intranasally with FITC‐(Ahx)‐CR8‐Aβ(25–35)‐PEI (9 nmole/mouse/24 h) for three times. The mice were sacrificed, and their brains were perfused at 0.5, 2, 6, 12, and 24 h after the third treatment.
Fluorescence spectra of the filtrates of mouse brain homogenates after passing through a 100‐kDa filter. The unbroken, dashed, and dotted lines represent three different mice.
The amount of FITC‐(Ahx)‐CR8‐Aβ(25–35)‐PEI per brain at different times after the third peptide treatment. Data were expressed in mean ± SD (n = 3).
Brain penetration of FITC‐(Ahx)‐CR
8‐Aβ(25–35)‐PEI after the third dosing via intranasal route
The mice were treated intranasally with FITC‐(Ahx)‐CR8‐Aβ(25–35)‐PEI (9 nmole/mouse/24 h) for three times. The mice were sacrificed, and their brains were perfused at 0.5, 2, 6, 12, and 24 h after the third treatment.Fluorescence spectra of the filtrates of mouse brain homogenates after passing through a 100‐kDa filter. The unbroken, dashed, and dotted lines represent three different mice.The amount of FITC‐(Ahx)‐CR8‐Aβ(25–35)‐PEI per brain at different times after the third peptide treatment. Data were expressed in mean ± SD (n = 3).
Discussion
In this study, we demonstrated that the peptide R8‐Aβ(25–35) reduced the formation of amyloid fibrils by Aβ40
in vitro, as well as amyloid plaques and disease manifestation in vivo. In a companion study, therapeutic peptides designed by the same modular principle also delayed disease in the R6/2 transgenic mice, a widely used mouse model for Huntington's disease (unpublished data). Thus, our data illustrated the possibility that this principle may be extended to design therapeutic peptides for other neurodegenerative diseases.A variety of therapeutic peptides to decrease the formation of amyloid fibrils has been proposed (Funke & Willbold, 2012); our bipartite design works by attaching a polyR stretch to the peptide sequence derived from the disease‐specific pathogenic peptide/protein prone to aggregation. This approach possessed several unique features and advantages. First, the sequence directly taken from the pathogenic peptide/protein not only significantly reduced the labors of finding and optimizing a suitable peptide sequence, but also guaranteed high affinity with the target through its self‐aggregating property. Second, the multi‐charges in polyR rendered the designed therapeutic peptide (i) soluble in an aqueous environment and therefore simplifying the processes of synthesis and subsequent application, (ii) cell‐penetrable (Mitchell et al, 2000), making it suitable for both extracellular and intracellular peptide/protein aggregation, and (iii) able to slow down oligomer/amyloid formation by charge repulsion after its binding to the pathogenic peptide/protein. Third, combination of the polyR with the sequence from disease‐specific pathogenic protein/peptide provided great feasibility and flexibility in applying this design across different misfolded aggregate‐associated diseases.Although many therapeutic peptides have been designed, only a few of them were tested in vivo (Permanne et al, 2002; van Groen et al, 2008; Frydman‐Marom et al, 2009; Funke et al, 2010; Shukla et al, 2013; Lin et al, 2016). In this study, we have demonstrated the feasibility of intranasal administration of therapeutic peptidic prodrugs. When combined with technology in delivery, our study showed a proof of therapeutic principle for neurodegenerative diseases through intranasal delivery. The dose used in this study was only 2 nmoles (6 μg) per day, which was quite low compared with previous studies (Permanne et al, 2002; van Groen et al, 2008; Frydman‐Marom et al, 2009; Funke et al, 2010). Using this dosage, we attempted to investigate the level of the therapeutic peptide in the brain during consecutive intranasal treatment (experimental set 5 in Appendix Figs S3 and S6). However, the peptide concentration was low and could not be reliably detected. As shown in Fig 5, after three consecutive treatments at higher amount (9 nmoles), there was 5.16 nmole of the peptide in the brain at 6 h after the final treatment and 3.62 nmole of the peptide in the brain 24 h after the final treatment. Although the current method was geared toward maximizing our ability to detect the intracerebralpeptide rather than producing an accurate number in its efficiency in brain entrance, an estimated value was still achievable. Since the treatment continued for 3 days, the amount of intracerebralpeptide before the 3rd dose was expected not to be more than 3.62 nmole observed 24 h after the 3rd treatment. Thus, at least 1.54 nmole (5.16 minus 3.62) or 17% of the daily dose of 9 nmole peptide entered brain. These results indicate that this peptide had a reasonably high therapeutic efficacy. Future studies will be conducted for optimal dosage.The peptide treatment did not significantly decrease the numbers of the ThS‐positive amyloid plaques, but reduced the size of the individual plaques and the total area of these plaques. One possibility is that most of the Aβ reduction is diffusely deposited Aβ. Alternatively, when we started treatment, the cores of plaques might have already formed at 4 months, but our peptide slowed down the speed of the accumulation of the transgenic Aβ of these plaques. Moreover, when we quantified SDS‐soluble Aβ and SDS‐insoluble Aβ separately (Fig 4C–F), we found that SDS‐insoluble Aβ reduced after peptide treatment whereas SDS‐soluble Aβ increased. Aβ accumulation is due to the imbalance of Aβ production and Aβ degradation. Our peptide treatment likely functions to inhibit Aβ from self‐association, but may not directly impact on the Aβ degradation rate. The clearance of excessive Aβ depends on several Aβ‐degrading enzymes, such as neprilysin (the most important one) and insulin‐degrading enzyme, which were found to be downregulated in old mice (Caccamo et al, 2005). However, by preventing Aβ from aggregation, our peptide could render it more accessible to these Aβ‐degrading enzymes and/or other degradation machinery in the brain. Recently, it has been reported that polyhydroxycurcuminoids upregulate neprilysin in the brain (Chen et al, 2016). Combining the peptide inhibitor and the neprilysin activator might additively enhance Aβ clearance.Comparing peptide therapy and antibody therapy, the cost of peptide synthesis is much lower than the cost of producing monoclonal antibody. Moreover, as the peptide worked in vivo without incorporating non‐natural or D‐form amino acid, there was no worry for the toxicity caused by non‐natural amino acids. Consistent with this, the preliminary tests for liver and kidney function indicated no clear toxicity in the mice receiving the peptide for 8 months (Appendix Fig S7).Lastly, to determine whether the peptide treatment induced an antibody response against Aβ peptide, the serum of the mice treated for 15 days was tested and showed no evidence of immunoreactivity against the peptide (experimental set 6 in Appendix Figs S3 and S8). In summary, intranasal administration of our bipartitepeptide designed on the principle of modular combination may serve as an effective and user‐friendly disease‐modifying therapy for Alzheimer's disease and a template for developing effective therapy against other protein aggregation‐associated diseases.
Materials and Methods
Peptide synthesis
The peptides were prepared by the batch fluorenylmethoxycarbonyl (fmoc)‐polyamide method (Lin et al, 2014). The sequence of Aβ40: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV. The sequence of R8‐Aβ(25–35): RRRRRRRRGSNKGAIIGLM; DR8‐Aβ(25–35) had the same sequence as R8‐Aβ(25–35), but L‐form arginines were replaced by D‐form arginines. The sequence of R8‐YS: RRRRRRRRYS. The C‐terminal ends of R8‐Aβ(25–35) and DR8‐Aβ(25–35) were amidated by using Rink Amide AM resin (Novabiochem, Billerica, MA, USA) as the solid support. The synthesized peptides were cleaved from resin according to literature (Lin et al, 2014), purified by high‐performance liquid chromatography (HPLC) using a Vydac C18 column, identified by matrix‐assisted laser desorption ionization (MALDI) mass spectroscopy, and then lyophilized and stored at −20°C. To synthesize PEI‐conjugated peptides R8‐Aβ(25–35)‐PEI and R8‐YS‐PEI, PEI was conjugated to the C‐terminal carboxyl group of the peptides. Therefore, Fmoc‐Met‐Wang resin and Fmoc‐Ser‐Wang resin (Anaspec, USA) were used as the solid support during peptide synthesis. To prevent exopeptidase digestion in vivo, the N‐terminal end of all the peptides in this study was acetylated.
Circular dichroism spectroscopy
The 1.4 mM stock solution of each peptide in 75% trifluoroethanol was diluted to a final concentration of 30 μM in 20 mM sodium phosphate buffer with 150 mM KCl (PBS, pH 7). Each was incubated at 25°C for designated time points and placed in a 1‐mm cell to record the CD spectra between 200 and 250 nm on a J‐715 CD spectrometer (JASCO, Japan). The band width was set to 2 nm, and the step resolution was 0.05 nm. Each sample was scanned twice and the average of these two measurements was smoothed by the Savitzky–Golay method to get the final CD spectrum.
Transmission electron microscopy
The samples were deposited on carbon‐coated 300‐mesh copper grids, incubated for 3 min for absorption, and then washed by water. Negative staining was carried out by staining with 2% uranyl acetate for 1.5 min. After air drying, the samples were viewed using a Hitachi H‐7000 electron microscope (Hitachi, Japan).
Cell viability assay
MouseN2aneuroblastoma cells (ATCC) were cultured in Dulbecco's modified Eagle's medium (DMEM) (HyClone, USA) supplemented with 10% fetal bovine serum (HyClone, USA). Cells were harvested with DMEM and suspended at a density of 3.5 × 105 cells/ml. 100 μl from each sample was plated in one well of a 96‐well CellBIND microplate (Corning, USA) and then incubated at 37°C under 5% CO2 for 24 h. Five microliters from each stock peptide (6 mM) in DMSO was diluted with 95 μl of PBS (pH 7.0) and then 900 μl of DMEM to a final concentration of 30 μM. For testing efficacy of peptide inhibitor, Aβ40 was premixed with equal volume of PBS or peptide as indicated, and incubated for 24 h at room temperature with shaking (50 rpm) before being added to the cultures. Viability was determined using the MTT (3‐[4,5‐dimethylthiazol‐2‐yl]‐2,5‐diphenyltetrazolium bromide) assay (Shearman et al, 1995) 48 h later as described in the literature (Chang et al, 2009).
Synthesis of PEI‐conjugated peptide
Three milligrams acetylated R8‐Aβ(25–35) was dissolved in 2.5 ml DMSO and slowly mixed with 150 μl 1‐ethyl‐3‐(3‐dimethylaminopropyl)carbodiimide (EDC) (600 mM in 0.1 M MES/0.5 M NaCl, pH 6) and 150 μl N‐hydroxysuccinimide (NHS) (1.2 M in 0.1 M MES/0.5 M NaCl, pH 6). The mixture reacted at room temperature for 30 min with gentle shaking (70 rpm); then, 180 μl polyethylenimine (PEI) was added and reacted under the same conditions overnight. The PEI‐conjugated peptide was purified by HPLC, lyophilized, and stored at −20°C.
Intranasal administration
The animal experiments were approved by the Institutional Animal Care and Use Committee of the Academia Sinica. The methods were carried out in accordance with the approved guidelines.APP/PS1 (B6C3‐Tg(APPswe,PSEN1dE9)85Dbo/Mmjax) transgenic mice were purchased from Jackson Laboratories (Bar Harbor, Maine, USA) and maintained as described (Borchelt et al, 1996; Jankowsky et al, 2001). PEI, R8‐Aβ(25–35)‐PEI, and R8‐YS‐PEI were dissolved in 100 mM NaH2PO4/138 mM KCl (pH 5). The animal experimental designs are shown in Appendix Fig S3. In experiment 1, 2.5 μl PEI or R8‐Aβ(25–35)‐PEI (400 μM) was given daily to each nostril of 4‐month‐old APP/PS1mice (eight female mice per group; 2 nmole/mouse/day) for 6 days per week until they were 8 months of age.In experiment 2, 2.5 μl PEI or R8‐Aβ(25–35)‐PEI (400 μM) was given daily to each nostril of 4‐month‐old APP/PS1mice (10 or 11 male mice per group; 2 nmole/mouse/day) for 6 days per week for a total of 8 months, with a suspension of 4 weeks for the Morris water maze test at 8 months of age. The same treatment was applied to non‐transgenic littermates (10 male mice for PEI treatment and seven male mice for R8‐Aβ(25–35)‐PEI treatment).In experiment 3, 2.5 μl R8‐Aβ(25–35)‐PEI (800 μM) was given daily to each nostril of three female APP/PS1mice (4 nmole/mouse/day) for 6 days per week from 8 to 10 months of age. To test the effect of R8 peptide, three female APP/PS1mice were given R8‐YS‐PEI (800 μM), and three male APP/PS1mice were given buffer with the same intranasal method from 3 to 10 months of age (4 nmole/mouse/day; 6 days per week).In experiment 4, 2.5 μl FITC‐(Ahx)‐CR8‐Aβ(25–35)‐PEI (1,800 μM) was given daily to each nostril of 15 female C57BL/6JNarl mice (10 weeks old) for 3 days (9 nmole/mouse/day). In experiment 5, 2.5 μl FITC‐(Ahx)‐CR8‐Aβ(25–35)‐PEI (400 μM) was given daily to each nostril of 33 female C57BL/6JNarl mice (12 weeks old) at day 1, day 2, and day 4 (2 nmole/mouse/day).In experiment 6, 2.5 μl FITC‐(Ahx)‐CR8‐Aβ(25–35)‐PEI (800 μM) or buffer was given daily to each nostril of six male non‐transgenic littermates (1‐year‐old) for 15 days (three mice per group; 4 nmole/mouse/day).
ELISAs for Aβ40 and Aβ42
The total levels of Aβ40 and Aβ42 in the brain homogenate of 8‐month‐old mice were detected using ELISA kits (Invitrogen, MD, USA) according to the manufacturer's instructions. Briefly, the cortical or hippocampal tissue was homogenized in ice‐cold cell extraction buffer provided in the kit with protease inhibitor cocktail (Sigma, St. Louis, MO, USA) and centrifuged at 15,000 g at 4°C for 10 min. In the protocol, 5 M GdnHCl was used in Aβ extraction buffer.Because senile plaques started to form in mice older than 8 months of age, Aβ in these plaques might not be extracted by SDS or GdnHCl (Kawarabayashi et al, 2001). Aβ was separated into the SDS‐soluble and SDS‐insoluble fractions. Formic acid (FA) was used instead to extract SDS‐insoluble Aβ40 and Aβ42 in plaques from the brain homogenate of the 13‐month‐old mice (van Groen et al, 2013). The brain tissues were first homogenized in the Aβ extraction buffer containing 20 mM Tris–HCl (pH 7.6), 137 mM NaCl, 1% Triton X‐100, 2% SDS, and protease inhibitor cocktail and centrifuged at 20,000 g for 20 min at 4°C. The supernatant was the SDS‐soluble fraction for ELISA measurement of soluble Aβ. The pellet was then dissolved in 70% FA, sonicated for 1 min, and then centrifuged at 20,000 g for 20 min at 4°C. The resultant supernatant was the SDS‐insoluble fraction. This fraction was neutralized with 20 volumes of 1 M Tris base before ELISA measurement. Total protein concentrations of the SDS‐soluble and SDS‐insoluble fractions were quantified using the Bradford protein assay (Bio‐Rad, Hercules, CA, USA). Aβ amount of each fraction was normalized to the total protein concentration of that fraction for comparison.
Cytometric bead array
The levels of IL‐6 and IL‐1β in cortical and hippocampal lysates were detected using Cytometric Bead Array (BD Biosciences, San Jose, CA, USA) according to the manufacturer's instructions and analyzed on the FACS Calibur (BD Biosciences, USA). The levels were calculated using CBA software (Soldan et al, 2004).
Thioflavin S staining
Paraformaldehyde‐fixed brain sections were applied with 1% (w/v) thioflavin S (ThS) solution for 10 min at room temperature protected from light, and then washed with 80% ethanol and water to remove excessive dye. ThS‐positive signals were visualized under an epifluorescence microscope; the plaque number, plaque area, and plaque size were analyzed by ImageJ (NIH, Bethesda, MD, USA).
Morris water maze
The maze was conducted with visual cues on the wall and a hidden platform 1 cm beneath the water. The acquisition trial phase consisted of five training days (days 1–5) and four trials per day with a 15‐min inter‐trial interval. Mice were put into the maze from a different point in each trial. The path length and escape latency were recorded (n = 7–11 per group) and analyzed by two‐way repeated‐measures ANOVA. To assess their spatial memory, the platform was removed after three trials on day 5 and animals were allowed to swim freely for 90 s. The swimming path was recorded and analyzed.
In vivo small‐animal positron emission tomography imaging
All PET scans were performed using the Triumph pre‐clinical tri‐modality (LabPET/X‐SPECT/X‐O CT) imaging system (TriFoil Imaging, USA), which provides 31 transaxial slices 1.175 mm (center‐to‐center) apart, a 100‐mm transaxial FOV, and a 37‐mm axial FOV for the LabPET sub‐system. The digital APD detector technology delivers high spatial resolution better than 1 mm and high recovery coefficient. Before the scans, all of the mice were kept warm with a heating lamp. After induction with 2.0% isoflurane, the mice were placed with their heads in the center of the field of view and were fixed in prone position. A 20‐min static data acquisition was performed in 3D list mode with an energy window of 350–650 keV at 20 min following a [11C]PiB (36.7 ± 2.6 MBq; volume < 0.25 ml) injection via the tail vein. The emission data were normalized and corrected for the tracer decay time. All list mode data were sorted into 3D sinograms, which were then single‐slice Fourier rebinned into 2D sinograms. Summation images from 20 to 40 min after [11C]PiB injection were reconstructed using a MLEM algorithm, resulting in the image volume consisted of 240 × 240 × 31 voxels, each voxel with a size of 0.25 × 0.25 × 1,175 mm3.
Radiosynthesis of [11C]PiB
The radiosynthesis of [11C]PiB was performed using [11C]methyl triflate according to the method described previously with minimal modification (Manook et al, 2012). Briefly, [11C]methyl bromide was produced by the multi‐pass bromination of [11C]methane. Subsequently, [11C]methyl bromide was eluted from a trap and converted to [11C]methyl triflate by passing a preheated silver triflate column. [11C]methyl triflate was carried by a helium stream (20 ml/min) into 350 μl of anhydrous methylethylketone containing 1.5 mg of 2‐(4′‐aminophenyl)‐6‐hydroxybenzothiazole. After the trapping, the reaction mixture was heated to 75°C for 2 min, and then, 0.4 ml of HPLC mobile phase was added to the reaction mixture for HPLC purification. HPLC purification was performed on a Waters Bondapak column (10 μm, 7.8 mm ID × 300 mm) using a mobile phase of acetonitrile/0.01 M H3PO4 (40/60) at a flow rate of 5.0 ml/min. The radioactive fraction corresponding to [11C]PiB was collected in a bottle containing 30 ml of pure water and passed through a C18 Sep‐Pak Plus cartridge, then washed with 10 ml of pure water and eluted with 1 ml of ethanol and 10 ml of sterile normal saline, and passed through a 0.22‐μm sterile filter for quality analysis and animal experiments. Radiochemical purity was > 99% as determined by analytical HPLC. The specific activity was 152 ± 52 GBq/μmol at the end of synthesis.
PET data analysis
All imaging data were processed and analyzed with PMOD 3.5 software package (Pmod Technologies, Zürich, Switzerland). The PET image dataset was converted to an absolute measure of radioactivity concentration (kBq/cc) using a phantom‐derived calibration factor before being normalized to the injected dose (ID) of [11C]PiB and the body mass of the animal. This normalization enables the comparison of brain radioactivity concentration of animals of different weights. Static PET images were co‐registered with mouse T2‐weighted MRI brain atlas based on PMOD as anatomic reference. Image origins were set to Bregma (0, 0) according to the MRI atlas and used the atlas for VOI definition. [11C]PiB uptake was evaluated in the four volumes of interest, namely the cortex, the hippocampus, the amygdala, and the olfactory bulb. Standardized uptake values (SUV) were obtained for each VOI by dividing the mean [11C]PiB activity by the injection dose and the body weight (gram). Thereafter, regional [11C]PiB uptake in the target region was normalized by [11C]PiB uptake in the cerebellum, which was taken as the reference region (ratio to cerebellum) (Manook et al, 2012; Poisnel et al, 2012).
Detection of intracerebral peptide inhibitor
FITC‐(Ahx)‐CR8‐Aβ(25–35)‐PEIpeptide having fluorescein isothiocyanate (FITC) incorporated at the N‐terminus and PEI at the C‐terminus of the peptide inhibitor and aminohexanoic acid (Ahx) inserted as a spacer between FITC and peptide was synthesized.Fifteen 10‐week‐old female wild‐type C57BL/6JNarl mice were treated intranasally with 5 μl of 1,800 μM FITC‐(Ahx)‐CR8‐Aβ(25–35)‐PEIpeptide, dissolved in 100 mM NaH2PO4/138 mM KCl (pH 5), for three consecutive days (9 nmole/mouse/day). Another three mice without receiving peptide treatment were used as negative controls. These mice were perfused with PBS at 0.5, 2, 6, 12, 24 h after the last treatment (n = 3 per group), and their brains were collected and homogenized in the buffer containing 10 mM HEPES, 1.5 mM MgCl2, 10 mM KCl, 100 mM DTT, and 1 mM PMSF (pH 7.9) (5 ml/gram of brain) by sonication on ice (one pulse of 0.75 s for 2 min, UP200H, Hielscher, USA). The homogenate was centrifuged at 21,000 g for 20 min. After centrifugation, the supernatant was passed through a microconcentrator (100K cutoff, Pall Gelman, USA). Each filtrate was adjusted with the homogenization buffer to make a final volume of 1.5 ml, and then, their fluorescence emission spectra (500–600 nm) were recorded on a fluorescence spectrophotometer (FP‐750, Jasco, Japan) with excitation at 446 nm. The pathlength was 1 cm, and slit width was set to 5 nm for both excitation and emission. To generate the concentration calibration curve, another two mice without treatment were perfused, and their brains were collected and cut into two hemispheres. The left hemisphere was mixed with 20 μl of 1,800 μM FITC‐(Ahx)‐CR8‐Aβ(25–35)‐PEIpeptide, but the right one, with 20 μl of buffer (100 mM NaH2PO4/138 mM KCl, pH 5). They were homogenized, centrifuged, and filtered as described above. The filtrates were diluted to a final volume of 1.5 ml. The filtrate containing the peptide was mixed with the peptide‐free filtrate at different ratios. Then, the fluorescence emission spectra of these mixtures were recorded to build the standard calibration curve.
Author contributions
Y‐SC, Z‐tC, T‐YL, CL, HC‐HS, Y‐HW, and C‐WC conducted the study and analyzed the data; R‐SL contributed analytical tools and analyzed data; RP‐YC and P‐hT designed research study, analyzed data, and wrote the manuscript.
Conflict of interest
A PCT patent application (PCT/US15/41785) has been filed.
Problem
Alzheimer's disease is an incurable neurodegenerative disorder. Disease progression usually extends over a period of 4–20 years. There is currently no effective treatment to delay its progression.We propose a modular approach to design peptide inhibitor against amyloid propagation. The peptide inhibitor can be delivered conveniently via intranasal administration and is shown to reduce brain amyloid deposition and ameliorate cognitive decline in Alzheimertransgenic mice.
Impact
The peptide nasal spray can be used as an efficient and clinically amenable treatment to delay the onset of Alzheimer's disease. Furthermore, our peptide design concept can extended to other protein aggregate‐associated diseases.AppendixClick here for additional data file.Review Process FileClick here for additional data file.
Authors: Alix de Calignon; Manuela Polydoro; Marc Suárez-Calvet; Christopher William; David H Adamowicz; Kathy J Kopeikina; Rose Pitstick; Naruhiko Sahara; Karen H Ashe; George A Carlson; Tara L Spires-Jones; Bradley T Hyman Journal: Neuron Date: 2012-02-23 Impact factor: 17.173
Authors: André Manook; Behrooz H Yousefi; Antje Willuweit; Stefan Platzer; Sybille Reder; Andreas Voss; Marc Huisman; Markus Settles; Frauke Neff; Joachim Velden; Michael Schoor; Heinz von der Kammer; Hans-Jürgen Wester; Markus Schwaiger; Gjermund Henriksen; Alexander Drzezga Journal: PLoS One Date: 2012-03-09 Impact factor: 3.240
Authors: Leonor C Fonseca; João A Lopes; João Vieira; Cláudia Viegas; Cláudia S Oliveira; Rafael P Hartmann; Pedro Fonte Journal: Drug Deliv Transl Res Date: 2021-02-26 Impact factor: 4.617