Literature DB >> 28091549

Urinary proteomics can define distinct diagnostic inflammatory arthritis subgroups.

Stefan Siebert1, Duncan Porter2, Caron Paterson1, Rosie Hampson2, Daniel Gaya3, Agnieszka Latosinska4, Harald Mischak4,5, Joost Schanstra6,7, William Mullen5, Iain McInnes1.   

Abstract

Current diagnostic tests applied to inflammatory arthritis lack the necessary specificity to appropriately categorise patients. There is a need for novel approaches to classify patients with these conditions. Herein we explored whether urinary proteomic biomarkers specific for different forms of arthritis (rheumatoid arthritis (RA), psoriatic arthritis (PsA), osteoarthritis (OA)) or chronic inflammatory conditions (inflammatory bowel disease (IBD)) can be identified. Fifty subjects per group with RA, PsA, OA or IBD and 50 healthy controls were included in the study. Two-thirds of these populations were randomly selected to serve as a training set, while the remaining one-third was reserved for validation. Sequential comparison of one group to the other four enabled identification of multiple urinary peptides significantly associated with discrete pathological conditions. Classifiers for the five groups were developed and subsequently tested blind in the validation test set. Upon unblinding, the classifiers demonstrated excellent performance, with an area under the curve between 0.90 and 0.97 per group. Identification of the peptide markers pointed to dysregulation of collagen synthesis and inflammation, but also novel inflammatory markers. We conclude that urinary peptide signatures can reliably differentiate between chronic arthropathies and inflammatory conditions with discrete pathogenesis.

Entities:  

Mesh:

Substances:

Year:  2017        PMID: 28091549      PMCID: PMC5320079          DOI: 10.1038/srep40473

Source DB:  PubMed          Journal:  Sci Rep        ISSN: 2045-2322            Impact factor:   4.379


Early diagnosis of inflammatory arthritis offers a window of opportunity for effective treatment and is associated with improved patient outcomes12. However, in the initial stages of the disease, accurate diagnosis can be challenging because of the lack of sufficiently sensitive and specific diagnostic tests. Rheumatoid factor and anti-citrullinated protein antibodies used to support the diagnosis of rheumatoid arthritis (RA) have limited selectivity3. Moreover, there are no specific diagnostic tests available for conditions like psoriatic arthritis (PsA). Similarly, inflammatory markers such as C-reactive protein (CRP) and erythrocyte sedimentation rate (ESR) can be affected by a large number of variables, including age and obesity, and as such offer limited specificity in patient identification. Therefore, there is a need for novel diagnostic biomarkers to assist accurate, early diagnosis, particularly in primary care settings where specialist expertise and imaging may not be readily available. We previously described the application of capillary electrophoresis coupled to mass spectrometry to identify urinary biomarkers for the diagnosis of several diseases such as acute and chronic kidney disease4, left ventricular dysfunction5, preeclampsia6 and cardiovascular diseases7, allowing accurate classification of case versus control groups. The use of urine for the identification of biomarkers has several advantages, including the non-invasive method of sample collection, the low dynamic range of analytes which facilitates the detection and analysis of biomarkers, and high stability due to absence of proteolytic agents89. Stability of urine and interference of different agents has been investigated recently10, demonstrating good reproducibility and stability. The latter allows a urine sample to be posted to a laboratory for testing rather than a patient being required to attend a primary care location for diagnosis by a specialist. Although concentration of compounds in urine differs substantially depending on the fluid intake, this can be compensated based on a set of urinary “housekeeping” peptides11. Furthermore, identification of proteomic biomarkers may be useful in understanding the molecular mechanisms involved in the onset and progression of a disease12. Disadvantages of urine may be a bias towards diseases of the kidney and urogenital tract (proteins and peptides derived thereof represent about 70% of the urine proteome), and frequently a lack of a direct connection between the biomarkers identified in urine, and the molecular changes in the tissue (not applicable for kidney disease). In a pilot study we defined peptide biomarkers in urine that distinguished RA from healthy controls13. It is possible that the biomarkers identified reflected the presence of systemic inflammation, synovial inflammation, joint damage, or a combination of these. As such, they could be markers of articular insult/damage in general (conferring no diagnostic specificity), inflammatory arthritis, systemic inflammation or they could be disease specific. In this further pilot study, we sought to identify novel urinary biomarkers that distinguish different forms of chronic arthropathy including RA, PsA, osteoarthritis (OA) from a discrete inflammatory disease, namely inflammatory bowel disease (IBD). We hypothesized that specific peptides could be detected in urine samples of patients that could be combined into a classifier, which may be developed into a tool enabling early and differential diagnosis. In order to eliminate non-specific biomarkers of classical systemic inflammation and/or joint damage, we selected diagnostic groups that over-lapped for each of these domains – i.e. OA, PsA and RA are associated with joint damage (but IBD is not); RA, PsA and IBD are chronic inflammatory diseases (but OA is not); and PsA usually involves the skin whereas RA, IBD and OA usually do not.

Results

The demographic and applicable clinical characteristics of the cohort are shown in Table 1. All urine samples could be successfully analyzed and passed quality control10. As a first step we aimed at assessing the performance of the previously identified biomarker panel for RA13 in this independent cohort. For this purpose, the previously defined classifier was applied blinded to 100 samples from patients with RA (n = 50) and healthy controls (n = 50). Upon unblinding, the data revealed a significant association of the previously developed classifier with RA in comparison to healthy controls, with an area under the curve (AUC) of 0.83 (p < 0.01, Fig. 1A). While this confirmed the validity of the previously developed classifier for RA, it also indicated that further improvement would be beneficial for future clinical implementation.
Table 1

Clinical and demographic data for the disease groups.

Diagnosis (n = 50 for each group)Age mean (±SD) yearsFemales number (%)
Healthy Controls48.3 (±13.3)33 (66%)
Inflammatory Bowel Disease (IBD): - Crohn’s (n = 42), ulcerative colitis (n = 8)48.1 (±18.0)28 (56%)
Osteoarthritis (OA)64.6 (±10.3)31 (62%)
Rheumatoid Arthritis (RA)56.1 (±13.8)33 (66%)
Psoriatic Arthritis (PsA)53.8 (±11.7)30 (60%)
Figure 1

(A) Receiver operating characteristics (ROC) curve for the performance of the previously published biomarker model13 in patients with RA compared to healthy controls. The dotted lines represent the upper and lower limits of the 95% CI. (B) Box-whisker blots of the scoring of the 5 different groups with the previously developed “RA” classifier. IBD – inflammatory bowel disease; OA – osteoarthritis; PsA – psoriatic arthritis; RA – rheumatoid arthritis.

The previously described biomarker classifier was not developed for differential diagnosis of RA, OA, IBD, and PsA. This is also evident from the scoring using the previously developed RA classifier for these groups of patients. As shown in Fig. 1B, the scoring for the other conditions was distributed between healthy controls and RA. Differential diagnosis would require employing different classifiers, one for each disease. As a next step, we therefore investigated if the different diseases represented here can be distinguished from each other, based on the urine proteome by a de novo analysis. To identify biomarkers that may enable differential diagnosis, and to assess the value of such biomarkers and any classifiers developed, we employed a study design based on an initial discovery cohort employed as training set for the classifier, and another test cohort to assess the performance of the biomarkers. As depicted in Fig. 2, the cohort was separated into a training set which included a random selection of 2 thirds of the entire cohort (33 samples from each of the four disease and the healthy control groups), and a validation test set, containing 1/3 of the samples (n = 17 per group).
Figure 2

Schematic of the study design.

The available samples from each of the 5 groups were randomly assigned, using an automated algorithm, to the training (discovery) or the validation test set. Samples in the training set were used to identify potential biomarkers by comparing each group with all the others to identify peptides significantly associated with each group. In order to avoid introducing bias and to give similar weighting to each group, the 50 most significant peptides in each group were then used to generate a 45 peptide classifier specific for the respective group. Performance of this classifier was tested in the remaining blinded independent samples in the validation set to give an assessment of the performance of the classifiers for each disease (shown in Fig. 4).

As a first step we aimed at identifying urinary biomarkers specific for the 5 different clinical groups. To this end, we compared each group (PsA, RA, OA, IBD, healthy controls) with all others. In each case we could identify peptides significantly associated with the respective group being tested, ranging between 89 (healthy controls) and 566 (RA) peptides. The results are presented in Supplementary Table 1. Since potential peptide biomarkers specific for each of the 5 groups could be identified, we developed classifiers for each of the 5 groups. To avoid introducing bias, and to give similar “weight” to each group, we employed the same number of potential biomarkers (i.e. the 50 most significant peptides) as biomarkers in each group. This number was chosen based on of the number of potentially significant biomarkers available in all groups and the previous observation that more biomarkers confer higher stability to the classifier. There was very little overlap in the biomarkers between the five groups, with >80% of the biomarkers for each group being unique for that respective disease group only, as evident from the Venn diagram (Fig. 3). The 50 most significant biomarkers per group are listed in the Supplementary Table 2, including the average abundance of the peptide in each of the 5 groups separately, and the p-value. All 50 potential biomarkers were initially included in each of the high-dimensional classifiers, which were subsequently trained in the discovery cohort. Using a bootstrapping approach based on take-one-out cross-validation, the number of biomarkers employed was reduced to 45 in each classifier. This is based on past experience where a 10% reduction of the number of biomarkers was found to be the optimum between improving the classifier, and overfitting (Mischak, unpublished, and ref. 14).
Figure 3

Venn diagram of the overlap between the 50 most significant peptides per group.

Only minor overlap can be detected between the five groups, with 80% or more of the peptides being significant for one specific group only. OA – osteoarthritis; IBD – inflammatory bowel disease; PsA – psoriatic arthritis; RA – rheumatoid arthritis

The five classifiers were subsequently applied to the validation set in a blinded manner. After unblinding, the results were evaluated using Receiver Operating Characteristics (ROC) analysis. As presented in Fig. 4, the classifiers enabled detection of the respective disease with very good accuracy, with the AUC being between 0.90 and 0.97, depending on the group. The scoring of each of the samples with all five classifiers is also presented in Supplementary Table 3. When examining the misclassified samples, no obvious association of the misclassification with a specific pathology could be observed, suggesting the errors are random.
Figure 4

Receiver operating characteristics (ROC) curve for the performance of the five classifiers (as identified in the discovery (training) test set (n = 33 for each cohort) in the blinded independent validation test set (n = 75 in total, 17 for each cohort).

The dotted lines represent the upper and lower limits of the 95% CI. AUC – area under the curve; OA – osteoarthritis; PsA – psoriatic arthritis; IBD – inflammatory bowel disease; RA – rheumatoid arthritis.

To examine if the results can be linked to molecular pathophysiology, we investigated the biomarkers on a single peptide level. The ten most significant sequenced peptides for each of the five groups are presented in Table 2. This number was chosen for pragmatic reason, to allow for some coverage, while at the same time avoid investigating a very large list of peptides.
Table 2

Most significant sequenced peptides associated with RA, PsA OA, IBD, or healthy controls.

OA
IBD
RA
PsA
Healthy control
SequenceProtein SymbolProtein Name
p-valuefold-changep-valuefold-changep-valuefold-changep-valuefold-changep-valuefold-change
1.22E-060.12      1.16E-072.76GRYVPGSASmGTTMAGVDPFTGNSAYRSAASPLAAPhospholipase A-2-activating protein; PLAA
        3.97E-062.38SGSVIDQSRVLNLGPUMODUromodulin
        1.23E-051.75KEGGKGPRGETGPAGRpGEVGpPGPpGPCOL1A1Collagen alpha-1(I) chain
8.79E-060.64      1.51E-051.38TGSpGSpGPDGKTGPPGpAGCOL1A1Collagen alpha-1(I) chain
4.40E-060.47      2.19E-051.75DDGEAGKpGCOL1A1Collagen alpha-1(I) chain
        2.84E-051.73TTLSPSSSTTHEGEPTTFQSWPSSKDTSPAPSGMUC12Mucin-12
        3.55E-052.68TGLSmDGGGSPKGDVDPFXYD2Sodium/potassium-transporting ATPase subunit gamma
        4.36E-052.07ADGQPGAKGEpGDAGAKGDAGPpGPAGPAGPPGPIGCOL1A1Collagen alpha-1(I) chain
        4.74E-051.79TGEVGAVGppGFAGEKGPSGEAGTAGpPGTpGPQGCOL1A2Collagen alpha-2(I) chain
        9.63E-052.48QKGDEGPPGISIpGppGLDGQpGAPCOL4A5Collagen alpha-5(IV) chain; COL4A5
      7.70E-061.59  AGSEADHEGTHSTKRGFGAFibrinogen alpha chain; FGA
      9.72E-062.41  FVESQKDPENSPVCTSACathepsin A; CTSA
      2.30E-050.46  AGVANALAHKYHHBDHemoglobin subunit delta
      2.88E-050.34  NVGApGAKGARGSAGPpGATGFpGAAGRVGPpGPCOL1A1Collagen alpha-1(I) chain
      4.17E-057.55  LNAADADVPLDDLTFTFREM2FRAS1-related extracellular matrix protein 2; FREM2
      6.43E-050.22  AGGGAGGAAGAEGGPEAAGGAAESPAEGEICAM5Intercellular adhesion molecule 5
      8.18E-050.22  KLGHPDTLS100A9Protein S100-A9
      8.37E-051.54  LGPHAGDVEGHLSAPOA4Apolipoprotein A-IV
      9.58E-051.29  GppGPDGNKGEpGCOL1A2Collagen alpha-2(I) chain
      1.18E-041.46  DKGETGEQGDRGCOL1A1Collagen alpha-1(I) chain
    2.88E-095.37    PEPAKSAPAPKKGHIST1H2BKHistone H2B type 1-C/E/F/G/I
    1.97E-084.59    pGPQGPLGKPGAPGEPGPQGCOL8A1Collagen alpha-1(VIII) chain
    8.62E-081.44    NGApGNDGAKGDAGApGApGSQGApGCOL1A1Collagen alpha-1(I) chain
    1.63E-079.42    DGAKGDAGPAGPKGEpGSpGENGApGCOL1A1Collagen alpha-1(I) chain
    4.53E-072.72    DGQPGAKGEpGDAGCOL1A1Collagen alpha-1(I) chain
    7.21E-073.73    RVLNLGPITRUMODUromodulin; UMOD
    8.61E-072.28    PVQGQQQGPCUX1Homeobox protein cut-like 1; CUX1
    1.07E-062.04    NGEpGGKGERGApGEKGEGGppGCOL3A1Collagen alpha-1(III) chain; COL3A1
    1.09E-063.46    DEAGSEADHEGTHSTKFGAFibrinogen alpha chain
  9.99E-050.271.10E-062.47    PPPLPPPPPPPPPPRIMA1Isoform 2 of Proline-rich membrane anchor 1
  5.48E-080.25      GRAGEpGLQGpAGPPGEKGEpGDDGPSGAEGpPCOL2A1,Collagen alpha-1(II) chain
  7.74E-080.55      EpGSpGENGApGQmGPRCOL1A1Collagen alpha-1(I) chain
  4.79E-070.33      GADGQPGAKGEpGDAGAKGDAGPpGPAGPCOL1A1Collagen alpha-1(I) chain
  2.50E-060.41      GEVGPAGSpGSNGApGQRGEpGPQGHAGAQGpCOL3A1Collagen alpha-1(III) chain; COL3A1
  8.44E-060.43      PpGppGPpGVPGSDGIDGDNGPPGKCOL9A2Collagen alpha-2(IX) chain; COL9A2
  1.12E-052.13      GQDGRpGPpGPpGCOL1A1Collagen alpha-1(I) chain
  1.61E-050.26      PAPAPPPEPERPKEVEMYL3Myosin light chain 3; MYL3
  1.98E-050.16      SIAAGGEGLTDVSPEATG12Ubiquitin-like protein ATG12; ATG12
  2.29E-052.83      NTGAPGSpGVSGpKGDAGQPGEKGSpGAQGPPGAPGPLGCOL3A1Collagen alpha-1(III) chain
  3.56E-050.50      SVIDQSRVLNLGPITRUMODUromodulin
1.33E-072.29        ASTAQASSSAASNNHQVGSGNDPWSASNX9Sorting nexin-9
1.79E-061.39        FAERNPVEELTVDSPPVQPCDH12Protocadherin-12
1.69E-051.45        PpGEAGKpGEQGVpGDLGAPGPCOL1A1Collagen alpha-1(I) chain
2.26E-050.62        LTGPIGPPGpAGApGDKGESGPSGPAGPTGCOL1A1Collagen alpha-1(I) chain
3.78E-051.72        HQGPAGPpGPpGPpGPpGVSGGGCOL1A2Collagen alpha-2(I) chain
3.84E-051.55        VANEESEHNQGASEENGLPTRPC4APShort transient receptor potential channel 4-associated protein
3.84E-051.90        SGPpGPDGNKGEpGCOL1A2Collagen alpha-2(I) chain
Collagen fragments are abundant in urine. 50% of the peptide markers associated with the different arthritic disease groups were collagen fragments, with collagen alpha-1(I) chain being the most frequently found species. The OA group displayed the highest number of reduced urinary collagen alpha-1(I) chain fragments (3/10), while in the healthy control group the highest number of increased collagen alpha-1(I) chain fragments (4/10) was observed. Two collagen alpha-1(I) chain fragments overlapped between these two conditions. All other collagen fragments, including collagen alpha-2(I), collagen alpha-1(II), collagen alpha-1(III), collagen alpha-5(IV), collagen alpha-1(VIII) and collagen alpha-2(IX) chains, did not display specific enrichment in any one of the groups. Only a few fragments were derived from proteins generally known to be associated to inflammation, including protein S100-A9, fibrinogen and ICAM5. In addition, a number of other peptide fragments derived from functionally very different proteins not previously identified to be associated to arthritis were identified (Table 2).

Discussion

The identification of urinary biomarkers that distinguish between these discrete rheumatic and inflammatory diseases in this pilot study is encouraging, and suggests that further study of urinary peptidomics will be worthwhile to further explore the diagnostic potential of this approach for inflammatory arthritis. However, this study was small and will require validation in independent cohorts. If the utility of the classifiers is confirmed, it will also be necessary to establish whether changes in the sample collection protocols affect the accuracy of the various classifiers. Nevertheless, our study provides the first substantive data suggesting that inflammatory arthropathies could yield unique peptide profiles of this kind. Ultimately, the goal would be the development of a diagnostic kit that could be used in routine clinical practice. This may benefit from a reduced number of biomarkers. To investigate this issue, we reduced the classifiers to 10 biomarkers per condition. In each case the AUC dropped, although not significantly, and classification based on 10 biomarkers was consistently of slightly lower accuracy than classification based on 45 biomarkers. This was expected based on our previous experience; similar approaches in chronic kidney disease4 or cardiovascular disease7 also demonstrated that a reduction of the number of biomarkers leads to a reduction in the diagnostic accuracy. Two issues may be responsible for this observation: 1) the complexity of these diseases cannot be displayed by a limited set of features, and 2) biological variability can to some degree be counteracted by assessment of multiple variables. Hence, a higher number of biomarkers will confer more stability and higher accuracy to the classifier. It was possible that we would detect non-specific biomarkers of joint damage, or chronic inflammation rather than disease-specific biomarkers. We used a range of chronic disease with different but overlapping characteristics to mitigate this pitfall – for example, RA and PsA are both classical chronic inflammatory arthropathies, whereas OA compromises articular compromise but is not associated with significant systemic inflammation. We were able to develop classifiers that identified and distinguished patients with each of the selected diseases, indicating that the peptides included in these classifiers are not simply non-specific markers of either chronic inflammation or joint damage. This is also supported by the fact that few commonly known inflammatory markers (eg fibrinogen, protein S100-A9 and ICAM5) were among the 10 most significant biomarker peptides per disease group (Table 2). In contrast, peptide fragments of proteins involved in specific inflammatory processes not previously identified in arthritic diseases were found to be associated with specific disease groups. As an example, homeobox protein cut-like 1 (CUX1) was found to be associated to the RA group and has previously been shown to be potentially involved in pro-inflammatory tumour necrosis factor alpha (TNFα) production following lipopolysaccharide administration15. Collagen remodelling is key in articular disease16 and 50% of the peptides were fragments of various collagens. In addition, CUX1 has been shown to inhibit high dose transforming growth factor β-induced collagen I production17. Although the in situ change in abundance of the different urinary peptide markers remain to be determined, examination of the nature of the peptides might thus led to confirmation of existing processes in arthritic diseases or uncover novel insight. It should be noted that several of the biomarker peptides identified are from highly abundant proteins. The most plausible hypothesis for their differential abundance is a significant difference in specific proteases. Hence, the peptide biomarkers observed likely do not reflect abundance of the parental protein, but activity of potentially disease-specific proteases. The results also suggest that this approach may have potential for the identification of patients with inflammatory arthritis in general when combining the disease classifiers (i.e. as screening test in primary care settings) as well as diagnostic test for the specific condition (i.e. in specialist secondary care settings). The latter may become increasingly important as the targeted biologic therapies for these conditions progressively diverge in response to increased understanding of the shared and distinct pathophysiologies between RA and PsA. While the patients with OA had end-stage disease requiring joint replacement, it would be interesting to evaluate the performance of the OA classifier in patients with early radiographic changes, particularly as the development of therapeutics in OA is severely hampered by the current absence of reliable diagnostic biomarkers. It is not possible to directly compare the peptides identified in this study with those in previously published studies for a number of reasons. Firstly, the vast majority of previous studies evaluated peptides in serum, synovial fluid or tissue (for example cartilage, skin, synovial biopsies)181920. Biomarkers present in these specimens would not be expected to be present in urine in an unmodified manner. These previous studies also focused largely on using proteomics to identify biomarkers of disease activity or treatment response rather than for diagnostic purposes18192021. Furthermore, the differentially expressed peptides identified will depend on which condition they are being compared to, and in our case this was a unique combination of four other conditions for each condition. Our study has several limitations: firstly, not all biomarkers could be identified. This is most likely a result of unknown post-translational modifications22. However, a large number of biomarkers could be sequenced, and shows good linkage to molecular pathophysiology. Another limitation is the relatively small size cohort employed for validation. However, the classification results obtained are of very high statistical significance, suggesting a high certainty in the validity of the findings. Before considering employing these classifiers in routine clinical assessment of patients, their value has to be demonstrated and validated in a separate longitudinal study in a larger, carefully phenotyped cohort of patients with early or undifferentiated disease. These larger studies would also allow the influence of other factors (such as gender, age, body mass index (BMI), medication, disease activity) to be assessed, which is not possible in a study of the current size. In summary, urine proteomics offers potential as a method for developing biomarkers in chronic rheumatic conditions. We have identified classifiers that can reliably differentiate between each of the five disease states. Furthermore, the differentially expressed peptides may suggest proteases differentially involved in, or affected by, the various conditions. While identifying the specific pathways is not required for the development of diagnostic biomarkers, further identification is likely to be useful for understanding the pathophysiology of these diseases and may have therapeutic implications. We plan to develop these aspects further in our future work.

Methods and Materials

Patients and sample collection

Patients with OA, PsA, RA or IBD attending hospital-based specialist outpatient clinics were invited to provide a sample for this study. The patients had a diagnosis made by their rheumatologist (RA and PsA), orthopaedic surgeon (OA) or gastroenterologist (IBD). Patients could be on any anti-rheumatic therapies excluding cyclosporine or biologic agents. Spot urine samples were collected, immediately filtered and chilled, and then stored frozen until processed as recommended by the European Kidney and Urine Proteomics, and the Human Kidney and Urine Proteome Project, and described previously23. All samples were analyzed with the investigator blinded to the patients’ diagnosis. The samples from the patients with RA were selected from patients in the Scottish Early RA (SERA) inception cohort biobank24 who fulfilled the 2010 ACR/EULAR diagnostic criteria for RA. Samples for OA patients were obtained from patients with OA, but no history of RA or PsA, attending orthopaedic pre-operative assessment clinics in advance of knee or hip replacement surgery. Samples for IBD were collected from patients with IBD but no joint disease. The SERA study (RA patients) was given study-specific approval by the West of Scotland Research Ethics Committee (REC reference number 10/S0704/20). The PsA, OA IBD and healthy control samples were collected using generic sample collection approval from the West of Scotland Research Ethics Committee (REC reference number 11/S0704/7). Our study was done according to the protocol approved by the research team in the Institute of Infection, Immunity and Inflammation, University of Glasgow, and in line with the Declaration of Helsinki and International Committee on Harmonisation good clinical practice. All patients provided written informed consent for their samples to be used for research.

Urinary proteome analysis and peptide identification

The urine samples were prepared and analyzed using a P/ACE MDQ capillary electrophoresis system (Beckman Coulter, Fullerton, USA) on line coupled to a MicroTOF MS (Bruker, Bremen, Germany) exactly as described previously10. Details on accuracy, precision, selectivity, sensitivity, reproducibility, and stability of the CE-MS method have been previously described1025. To ensure appropriate quality of the analytical platform, a standard urine sample23 is prepared and analyzed daily, and data are evaluated to fulfil the predefined quality control criteria, including appropriate reproducibility, as detailed previously (e.g. in Stalmach et al.26). MosaiquesVisu was used to analyse the CE-MS data27. Twenty nine collagen peptides that have been identified previously as being of high abundance and without apparent association to disease were used as internal standards11. Briefly, ion counts are employed as measure of relative abundance, and are calibrated based on the abundance of the 29 predefined internal standards, using linear regression analysis11. This approach has been tested extensively and used in over 100 studies and over 10000 samples28, and is being routinely employed in a number of large randomized controlled trials293031. All detected peptides were deposited, matched, and annotated in a MicrosoftSQL database26, allowing for further analysis and comparison between case and control groups. Sequencing of target peptides was performed as described32, using Dionex Ultimate 3000 RSLS nano flow system (Dionex, Camberly UK) and a Beckman CE, coupled to an Orbitrap Velos MS instrument (Thermo Scientific).

Statistical analysis and classifier development

After testing for normal distribution, continuous data were compared by Wilcoxon t-test, as this test has proven to be of superior statistical power in proteomics datasets14. A p-value of <0.05 was considered to be statistically significant. In order to control for the false discovery rate, the p-values were adjusted by the Benjamini and Hochberg method33. For the development of classifiers, the amplitudes of the single peptides that were selected as biomarkers were combined using a support vector machine (SVM), to result in a single variable (SVM score)14. The process of statistical analysis and subsequent classifier development has been previously optimized specifically for urinary peptide data from CE-MS analysis14 and has been applied as routine procedure in multiple studies, some also jointly with regulatory agencies34, and acknowledged as being of significant value by regulators35. We employed a study design based on an initial discovery cohort employed as training set for the classifier, and another test cohort to assess the performance of the biomarkers. Participants were randomly assigned, using an automated algorithm (the srand() function in C++), to either the training set (containing 2 thirds of the entire cohort; 33 samples from each of the four disease and the healthy control groups) or a validation test set (containing 1 third of the cohort; n = 17 per group).

Additional Information

How to cite this article: Siebert, S. et al. Urinary proteomics can define distinct diagnostic inflammatory arthritis subgroups. Sci. Rep. 7, 40473; doi: 10.1038/srep40473 (2017). Publisher's note: Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.
  33 in total

1.  Urinary proteomic diagnosis of coronary artery disease: identification and clinical validation in 623 individuals.

Authors:  Christian Delles; Eric Schiffer; Constantin von Zur Muhlen; Karlheinz Peter; Peter Rossing; Hans-Henrik Parving; Jane A Dymott; Ulf Neisius; Lukas U Zimmerli; Janet K Snell-Bergeon; David M Maahs; Roland E Schmieder; Harald Mischak; Anna F Dominiczak
Journal:  J Hypertens       Date:  2010-11       Impact factor: 4.844

2.  Identification and validation of urinary biomarkers for differential diagnosis and evaluation of therapeutic intervention in anti-neutrophil cytoplasmic antibody-associated vasculitis.

Authors:  Marion Haubitz; David M Good; Alexander Woywodt; Hermann Haller; Harald Rupprecht; Dan Theodorescu; Mohammed Dakna; Joshua J Coon; Harald Mischak
Journal:  Mol Cell Proteomics       Date:  2009-06-28       Impact factor: 5.911

Review 3.  CE-MS-based proteomics in biomarker discovery and clinical application.

Authors:  Claudia Pontillo; Szymon Filip; Daniel M Borràs; William Mullen; Antonia Vlahou; Harald Mischak
Journal:  Proteomics Clin Appl       Date:  2015-03-24       Impact factor: 3.494

Review 4.  Systematic review: accuracy of anti-citrullinated Peptide antibodies for diagnosing rheumatoid arthritis.

Authors:  Penny F Whiting; Nynke Smidt; Jonathan A C Sterne; Roger Harbord; Anya Burton; Margaret Burke; Rebecca Beynon; Yoav Ben-Shlomo; John Axford; Paul Dieppe
Journal:  Ann Intern Med       Date:  2010-04-06       Impact factor: 25.391

Review 5.  Psoriatic arthritis under a proteomic spotlight: application of novel technologies to advance diagnosis and management.

Authors:  Aisha Q Butt; Angela McArdle; David S Gibson; Oliver FitzGerald; Stephen R Pennington
Journal:  Curr Rheumatol Rep       Date:  2015-05       Impact factor: 4.592

6.  Comprehensive human urine standards for comparability and standardization in clinical proteome analysis.

Authors:  Harald Mischak; Walter Kolch; Michalis Aivaliotis; David Bouyssié; Magali Court; Hassan Dihazi; Gry H Dihazi; Julia Franke; Jérôme Garin; Anne Gonzalez de Peredo; Alexander Iphöfer; Lothar Jänsch; Chrystelle Lacroix; Manousos Makridakis; Christophe Masselon; Jochen Metzger; Bernard Monsarrat; Michal Mrug; Martin Norling; Jan Novak; Andreas Pich; Andrew Pitt; Erik Bongcam-Rudloff; Justyna Siwy; Hitoshi Suzuki; Visith Thongboonkerd; Li-Shun Wang; Jérôme Zoidakis; Petra Zürbig; Joost P Schanstra; Antonia Vlahou
Journal:  Proteomics Clin Appl       Date:  2010-02-03       Impact factor: 3.494

7.  Brief Report: Predicting Functional Disability: One-Year Results From the Scottish Early Rheumatoid Arthritis Inception Cohort.

Authors:  Caroline Kronisch; David J McLernon; James Dale; Caron Paterson; Stuart H Ralston; David M Reid; Ann Tierney; John Harvie; Neil McKay; Hilary E Wilson; Robin Munro; Sarah Saunders; Ruth Richmond; Derek Baxter; Mike McMahon; Vinod Kumar; John McLaren; Stefan Siebert; Iain B McInnes; Duncan Porter; Gary J Macfarlane; Neil Basu
Journal:  Arthritis Rheumatol       Date:  2016-07       Impact factor: 10.995

8.  Identification of ageing-associated naturally occurring peptides in human urine.

Authors:  Esther Nkuipou-Kenfack; Akshay Bhat; Julie Klein; Vera Jankowski; William Mullen; Antonia Vlahou; Mohammed Dakna; Thomas Koeck; Joost P Schanstra; Petra Zürbig; Karl L Rudolph; Björn Schumacher; Andreas Pich; Harald Mischak
Journal:  Oncotarget       Date:  2015-10-27

Review 9.  Proteomics in Rheumatoid Arthritis Research.

Authors:  Yune-Jung Park; Min Kyung Chung; Daehee Hwang; Wan-Uk Kim
Journal:  Immune Netw       Date:  2015-08-26       Impact factor: 6.303

10.  Proteomic peptide profiling for preemptive diagnosis of acute graft-versus-host disease after allogeneic stem cell transplantation.

Authors:  E M Weissinger; J Metzger; C Dobbelstein; D Wolff; M Schleuning; Z Kuzmina; H Greinix; A M Dickinson; W Mullen; H Kreipe; I Hamwi; M Morgan; A Krons; I Tchebotarenko; D Ihlenburg-Schwarz; E Dammann; M Collin; S Ehrlich; H Diedrich; M Stadler; M Eder; E Holler; H Mischak; J Krauter; A Ganser
Journal:  Leukemia       Date:  2013-07-11       Impact factor: 11.528

View more
  9 in total

Review 1.  Current concepts and unmet needs in psoriatic arthritis.

Authors:  Farrouq Mahmood; Laura C Coates; Philip S Helliwell
Journal:  Clin Rheumatol       Date:  2017-11-13       Impact factor: 2.980

Review 2.  Proteomic profiling of urine: implications for lupus nephritis.

Authors:  Najla Aljaberi; Michael Bennett; Hermine I Brunner; Prasad Devarajan
Journal:  Expert Rev Proteomics       Date:  2019-03-18       Impact factor: 3.940

Review 3.  Clinical Features of Psoriatic Arthritis: a Comprehensive Review of Unmet Clinical Needs.

Authors:  Angela McArdle; Stephen Pennington; Oliver FitzGerald
Journal:  Clin Rev Allergy Immunol       Date:  2018-12       Impact factor: 8.667

Review 4.  Recent Advances in the Etiopathogenesis of Inflammatory Bowel Disease: The Role of Omics.

Authors:  Eleni Stylianou
Journal:  Mol Diagn Ther       Date:  2018-02       Impact factor: 4.074

Review 5.  Exploring the Psoriatic Arthritis Proteome in Search of Novel Biomarkers.

Authors:  Shalini M Mahendran; Vinod Chandran
Journal:  Proteomes       Date:  2018-01-24

6.  Molecular Network Analysis of the Urinary Proteome of Alzheimer's Disease Patients.

Authors:  Yumi Watanabe; Yoshitoshi Hirao; Kensaku Kasuga; Takayoshi Tokutake; Yuka Semizu; Kaori Kitamura; Takeshi Ikeuchi; Kazutoshi Nakamura; Tadashi Yamamoto
Journal:  Dement Geriatr Cogn Dis Extra       Date:  2019-02-08

7.  Proteomics and phosphoproteomics in precision medicine: applications and challenges.

Authors:  Girolamo Giudice; Evangelia Petsalaki
Journal:  Brief Bioinform       Date:  2019-05-21       Impact factor: 11.622

8.  Bile and urine peptide marker profiles: access keys to molecular pathways and biological processes in cholangiocarcinoma.

Authors:  Torsten Voigtländer; Jochen Metzger; Holger Husi; Martha M Kirstein; Martin Pejchinovski; Agnieszka Latosinska; Maria Frantzi; William Mullen; Thorsten Book; Harald Mischak; Michael P Manns
Journal:  J Biomed Sci       Date:  2020-01-03       Impact factor: 8.410

9.  Bioinformatic Analysis of the Wound Peptidome Reveals Potential Biomarkers and Antimicrobial Peptides.

Authors:  Erik Hartman; Karl Wallblom; Mariena J A van der Plas; Jitka Petrlova; Jun Cai; Karim Saleh; Sven Kjellström; Artur Schmidtchen
Journal:  Front Immunol       Date:  2021-02-03       Impact factor: 7.561

  9 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.