Literature DB >> 27872794

In silico Identification of Potential Peptides or Allergen Shot Candidates Against Aspergillus fumigatus.

Raman Thakur1, Jata Shankar1.   

Abstract

Aspergillus fumigatus is capable of causing invasive aspergillosis or acute bronchopulmonary aspergillosis, and the current situation is alarming. There are no vaccine or allergen shots available for Aspergillus-induced allergies. Thus, a novel approach in designing of an effective vaccine or allergen shot candidate against A. fumigatus is needed. Using immunoinformatics approaches from the characterized A. fumigatus allergens, we have mapped epitopic regions to predict potential peptides that elicit both Aspergillus-specific T cells and B cell immune response. Experimentally derived immunodominant allergens were retrieved from www.allergen.org. A total of 23 allergenic proteins of A. fumigatus were retrieved. Out of 23 allergenic proteins, 13 of them showed high sequence similarity to both human and mouse counterparts and thus were eliminated from analysis due to possible cross-reactivity. Remaining allergens were subjected to T cell (major histocompatibility complex class I and II alleles) and B cell epitope prediction using immune epitope database analysis resource. Only five allergens have shown a common B and T cell epitopic region between human and mouse. They are Asp f1 {147-156 region (RVIYTYPNKV); Mitogillin}, Asp f2 {5-19 region (LRLAVLLPLAAPLVA); Hypothetical protein}, Asp f5 {305-322 region (LNNYRPSSSSLSFKY); Metalloprotease}, Asp f17 {98-106 region (AANAGGTVY); Hypothetical protein}, and Asp f34 {74-82 region (YIQDGSLYL); PhiA cell wall protein}. The epitopic region from these five allergenic proteins showed potential for development of single peptide- or multipeptide-based vaccine or allergen shots for experimental prioritization.

Entities:  

Keywords:  Asp f34; Aspergillus fumigatus; allergens; epitopes; vaccine; vaccine design

Year:  2016        PMID: 27872794      PMCID: PMC5116691          DOI: 10.1089/biores.2016.0035

Source DB:  PubMed          Journal:  Biores Open Access        ISSN: 2164-7844


Introduction

Aspergillus species are the most common ubiquitous spore-bearing fungal pathogens. A. fumigatus is one of the leading causative agents of invasive aspergillosis and acute bronchopulmonary aspergillosis.[1] A. fumigatus causes infection in the form of invasive aspergillosis in the allogeneic hematopoietic stem cell transplant, HIV patients and individuals having cancer. A. fumigatus causes allergy in asthmatic or cystic fibrosis patients.[2,3] Allergy results from hypersensitive reaction to Aspergillus allergens in patients with atopic asthma or having cystic fibrosis disease.[2] Diseases associated with A. fumigatus allergens are increasing compared with other fungal allergens and, furthermore, it adds problems to life-threatening infections in immunocompromised patients such as patients having cancer, HIV, and those who have undergone organ transplants.[2,4] Globally, it has been estimated that of 193 million asthmatic patients, 4,837,000 have allergic bronchopulmonary aspergillosis (ABPA).[5] Recent data suggested that the fungal-associated allergic reactions or infections are increasing worldwide.[1] To control Aspergillus-associated problems, various studies have been conducted for the development of a vaccine candidate against aspergillosis that showed promising results in mouse models.[6-8] However, the use of recombinant allergens (Asp f3 and Asp f2) or crude extract and homology to host protein showed certain limitations.[6,7,9] Furthermore, the emergence of drug resistance isolate of A. fumigatus opens up new challenges for A. fumigatus-associated infections.[10] Over the last few decades, the use of azole fungicides increased in agriculture that led to emergence of azole-resistant A. fumigatus strain.[11] Other major hurdles in fungal vaccine designing are the pathogenesis process, evading of pathogen from the immune system, host genetic factors such as highly polymorphic nature of major histocompatibility complex (MHC) genes present in the population, and genetic variation in pathogen recognition receptors (PRRs).[12,13] Polymorphisms in PRRs (TLR, Pentraxins, etc.) can modulate host response against the microbes and that needs to be addressed for better immune response against the vaccines.[14,15] Till now, there is no vaccine or allergen shot therapy for Aspergillus-induced allergies.[16] In a recent development, epitopic peptide-based approaches to map potential vaccine candidates have gained importance.[17] Designing of vaccine against A. fumigatus possibly needs integration of the immunoinformatics or immunogenetic approach.[12] Thus, to map the epitopic region from the reported allergens of A. fumigatus, we used different in silico approaches to predict potential human and mouse MHC class I and MHC class II T cell or B cell epitopic region from protein sequence of A. fumigatus's allergens. Mouse MHC class II and MHC class I T cell epitopes were predicted because common epitopes that recognize both human and mouse MHC T cell epitopes might be tested on model organism for their therapeutic potential and their results can be tested on human subjects.[18] Another purpose for screening of epitopic peptides of antigens from A. fumigatus with no homologs in humans is that they recognize both MHC class I and MHC class T cells of human. Other than vaccine or allergy shot candidate, such peptides can be directly used ex vivo for the development of A. fumigatus-specific T cells (Asp-STs) for adoptive immunotherapy of invasive aspergillosis in the allogeneic hematopoietic stem cell transplant individuals having hematopoietic malignancies.[4] With the advancement of technology or various omics approaches, they pave the way to discover novel therapeutic or drug targets for both communicable and noncommunicable diseases that have serious impact in both developed or developing countries.[19] In this study, we used the reverse vaccinology approach that resulted in identification of potential peptides or allergen shot candidate against A. fumigatus-induced infections or allergies.

Materials and Methods

Retrieval of A. fumigatus allergens

A. fumigatus allergens known to date were retrieved from www.allergen.org, which provided the allergen data sets classified by WHO/IUIS/allergen nomenclature subcommittee, an international organization that is responsible for maintaining and developing a unique, unambiguous, and systematic nomenclature for allergenic proteins.

Protein sequence retrieval

The complete amino acid sequences of allergenic proteins were retrieved from www.allergen.org and National Center for Biotechnology Information database (NCBI) (www.ncbi.nlm.nih.gov). A total of 23 allergens of A. fumigatus were retrieved from NCBI database and further explored for vaccine or allergen shot candidates for A. fumigatus-induced infections.

Identification of protein sequence similarity with the host

Sequence similarity of the allergenic protein with host's protein sequences, for example, Homo sapiens (Taxid: 9606) and model organism Mus musculus (Taxid: 10090), was carried out using the basic local alignment search tool (BLASTp). The hit with an expectation value (E-value) less than 10−4 was excluded from the analysis and these protein sequences were assumed to have high sequence similarity with the host and model organism's proteome.[18]

Antigenicity prediction of allergens

Antigenicity of allergenic proteins was predicted by the use of VaxiJen v2.0 server, which provides the antigenic profile of bacterial, viral, parasitic, and fungal proteins. We choose the threshold value of 0.4 to increase the accurate antigenicity and to avoid false-positive results.[19]

Mapping of B cell epitope

Each allergen protein sequence was then subjected to B cell epitope prediction using immune epitope database analysis resource (IEDB-AR). It is a linear B cell epitope prediction software that uses a different method to predict the linear B cell epitope. In this software, we use the BepiPred method for the prediction of B cell epitope. BepiPred program uses a combination of hidden Markov and propensity scale methods to find out the linear B cell epitope in antigenic proteins.[20,21]

Mapping of T cell epitope

(1) T cell MHC class I epitope mapping

T cell MHC class I-restricted epitopes from the set of allergenic proteins were identified using IEDB-AR programs available at the IEDB-AR.[21] This database contains data sets of experimentally characterized B cell and T cell epitopes for humans and other model organisms that are used for vaccine research (mouse and nonhuman primates). MHC class molecules bind with antigens and then these bound antigens or epitopes are recognized by T cells for further processing. Inhibitory concentration (IC50) values were calculated for peptide epitopes that bind to MHC alleles, and on the bases of IC value, T cell epitopes were classified as follows: low-affinity IC50 value <5000 nM, intermediate-affinity IC50 value <500 nM, and high-affinity IC50 value <50 nM. We considered only lower IC50 value epitopes because lower value indicates higher binding affinity of epitopes with host MHC alleles. We used all mouse MHC class I alleles (H-2-Db, H-2-Dd, H-2-Kb, H-2-Kd, H-2-Kk, and H-2-Ld)[18] and eight human MHC class I alleles that cover about 85–90% of the world population (A*0101, A*0201, A*2402, A*0301, A*1101, B*0702, B*0801, and B*1501). The epitopes for T cell MHC class I alleles were identified by submitting the FASTA format of allergenic protein sequence to IEDB-AR. The artificial neural network (ANN) method was used to predict nine-mer sequence MHC class I epitopes.[18]

(II) Mapping of T cell MHC class II epitope

T cell MHC class II-restricted epitopes were identified using IEDB-AR.[21] We used mouse MHC class II alleles and most common human MHC class II molecule DR alleles. The epitopes for T cell MHC class II alleles were identified by submitting the FASTA format of allergenic protein sequence to IEDB-AR. The 15-mer sequence epitope identification was performed using the consensus method.[22] This method uses combination of stabilized matrix alignment and average relative binding matrix strategies to deduce MHC class II epitopes. This approach showed the best performance and is highly sensitive among other similar methods.[18]

Sequence identity mapping of epitopes with host proteome

The most common predicted B cell and T cell epitopic regions of allergenic proteins were further subjected for sequence similarity with protein sequences of human or mouse to eliminate any possible autoimmune response in the host. BLASTp program was used to predict the similarity.[23]

3D structure modeling and characterization of epitopes

Using 10 allergenic proteins, Asp f1, Asp f2, Asp f5, Asp f17, and Asp f34 allergenic proteins containing both T cell and B cell epitopes (in mouse and human) were subjected to 3D structure modeling for epitopic region characterization. The FASTA formats of these proteins were subjected to Phyre2 server to make the 3D structure of target allergenic protein.[24] BLAST of protein sequences using Phyre2 server against the protein data bank (PDB) was performed and few best hits based on the structural alignment were used as template. Out of five allergens, the PDB template was predicted for only Asp f1 and Asp f5 allergenic proteins. For the best template, predicted PDB files were subjected to ModRefiner for refinement of structure.[25] Energy minimization of these structures was carried out by YASARA force field minimization tool that improves overall quality of predicted protein structures.[26] Furthermore, modeled structures were validated by RAMPAGE (http://mordred.bioc.cam.ac.uk/∼rapper/rampage.php), a program that has been extensively used for stereochemical characteristics of predicted structures of the protein. PyMOL program (www.pymol.org/) was used to illustrate the predicted structures of epitopes. The position of predicted epitopes was also visualized by PyMOL.

Result and Discussion

Allergic disorders such as asthma, atopic dermatitis, and allergic rhinitis caused by A. fumigatus have gained public attention. A. fumigatus not only causes ABPA but also is responsible for allergic Aspergillus sinusitis, hypersensitivity pneumonitis, and IgE-mediated asthma.[27] Various strategies have been used to treat allergies such as allergen avoidance and elimination, subcutaneous injection of allergenic extract, and allergen shots.[28] Immunotherapy involves the subcutaneous administration of gradually increasing quantities of allergens or allergen epitopic peptides until a dose has been reached that is effective enough to induce immunologic tolerance to these allergens. The goal of allergen-specific immunotherapy (SIT) is to subside the symptoms induced by allergens and further to reduce the recurrence of disease in the long term.[29] In a recent report, it is observed that allergic incidence was caused by Alternaria alternata where whole crude antigens were used as SIT.[30,31] So, attention has been focused on envisaging peptides that display both MHC class I and, especially, MHC class II T cell epitopes.[32] A multitope vaccine or allergen shots having epitopes from several allergens may provide protection from A. fumigatus infections or allergies. In this direction, the reverse vaccinology approach has been employed to discover best epitopic peptides from A. fumigatus for experimental prioritization for vaccine or allergen shot candidates. The overall strategy used in this work is given in Figure 1.

Overall strategy used for prediction of vaccine or allergy shot candidates against Aspergillus-induced infections and allergy.

Overall strategy used for prediction of vaccine or allergy shot candidates against Aspergillus-induced infections and allergy. A total of 23 allergens of A. fumigatus were derived from allergen database and are presented in Table 1. These retrieved allergenic proteins of A. fumigatus were used to predict a vaccine or allergic shot candidate and have also been analyzed for ideal epitopic regions. Initially, these 23 allergenic proteins were subjected to homology search with host and mouse (model organism) proteome. A similar epitopic region, if selected for vaccine or allergy shots against A. fumigatus, may lead to devastating cross-reaction in host or it might lead to autoimmune diseases.[33,34] Thus, it is important to screen the best allergenic protein that can be considered as potential vaccine or allergic shot candidate for experimental studies. Therefore, to obtain similarity between allergenic proteins and host or model organisms proteome, BLASTp was performed against mouse and human proteins. Of 23 allergenic proteins of A. fumigatus, 13 allergic proteins (Asp f3, Asp f6, Asp f8, Asp f10, Asp f11, Asp f12, Asp f13, Asp f18, Asp f22, Asp f23, Asp f27, Asp f28, and Asp f29) showed high sequence similarity with host and model organism. Thus, these allergenic proteins were eliminated from further analysis due to their role in potential cross-reactivity. Remaining 10 allergenic proteins (Asp f1, Asp f2, Asp f4, Asp f5, Asp f7, Asp f9, Asp f15, Asp f16, Asp f17, and Asp f 34) (Table 2) were considered for antigenicity analysis. All 10 allergenic proteins predicted to be most probable antigens by VaxiJen server having a threshold value >0.4. The antigenicity score of each of these allergens is given in Table 2. Furthermore, these allergens were subjected to map B and T cell epitopes.
Table 1.

Allergen Retrieved from

Aspergillus fumigatus
AllergenGI numberMolecular weight (KDa)
Asp f116648618
Asp f2188157437
Asp f3276970019
Asp f4300583930
Asp f5377661340
Asp f6164897026.5
Asp f7287988812
Asp f8668652411
Asp f9287989034
Asp f1096301334
Asp f11501941424
Asp f12193015390
Asp f13229534
Asp f15300584116
Asp f16364381343
Asp f172980819 
Asp f18214322034
Asp f221392587346
Asp f232121517044
Asp f279168060518
Asp f289168060713
Asp f299168060913
Asp f3413392023620
Table 2.

Antigenicity of Allergen

AntigenGI numberProtein nameAntigenicity score (Threshold >0.4)
Asp f1166486Mitogillin0.7540
Asp f21881574Hypothetical protein0.8795
Asp f43005839Hypothetical protein1.0311
Asp f53776613Metalloprotease0.5683
Asp f72879888Hypothetical protein0.8011
Asp f92879890Hypothetical protein0.7615
Asp f153005841Hypothetical protein0.8088
Asp f163643813Hypothetical protein0.9120
Asp f172980819IgE-binding protein0.9860
Asp f34133920236Cell wall protein PhiA0.5564
Allergen Retrieved from Antigenicity of Allergen

B and T cell epitope mapping

In silico tools become important for selecting good epitopic regions from immunodominant proteins that can save the screening time or expenses of synthetic peptides.[13,19] It has been established that T and B lymphocytes act as antigenic determinants or epitopes of antigens instead of entire antigens. T cell recognizes epitopic peptides using T cell receptor that binds to either MHC I (CD8+ T cell) or MHC II (CD4+ T cells) class molecules or both present on antigen-presenting cells. Furthermore, T helper (CD4+ T cells) cells induce the B cells to activate humoral immune response.[18] Ten antigenic allergenic proteins of A. fumigatus were subjected for mapping of linear B cell epitopes using the IEDB-AR BepiPred method. The identification of B cell epitopes is important for vaccine design, diagnosis, and antibody production.[35,36] B cell epitopes are antigenic determinants that are recognized by the paratope region of membrane-bound antibodies or receptors on B-lymphocytes.[18] All the identified B cell epitopes are listed in Table 3. Previously, it has been observed that allergen epitopes mainly comprised hydrophobic amino acids, and amino acids, Ser, Gly, Ala, and particularly Lys, play an important role in IgE antibody binding allergenic epitopic peptides.[37,38] Our results showed very few lysine residues in predicted epitopic peptides from Asp f1, Asp f2, Asp f5, Asp f17, and Asp f34 allergens (Table 4).
Table 3.

Linear B Cell Epitopes for Allergen

Serial No.AllergenGI numberStartEndEpitope
1Asp f1166486124MVAIKNLFLLAATAVSVLAAPSPL
   3548QQLNPKTNKWEDKR
   104118RPPKHSQNGMGKDDH
   132142YKFDSKKPKED
   8197GYDGNGKLIKGRTPIKF
2Asp f218815742037TLPTSPVPIAARATPHEP
   5663CNATQRRQ
   97105GNRPTMEAV
   124133DNPDGNCALE
   136146GGHWRGANATS
   169179YTVAGSETNTF
   215225SNGTESTHDSE
   242304PGVGCAGESHGPDQGHDTGSASAPASTSTSSSSSGSGSGATTTPTDSPSATIDVPSNCHTHEG
3Asp f430058392144EWSGEAKTSDAPVSQATPVSNAVA
   4697AAAASTPEPSSSHSDSSSSSGVSADWTNTPAEGEYCTDGFGGRTEPSGSGIF
   101108NVGKPWGS
   111120IEVSPENAKK
   128135VGSDTDPW
   143153IGPDGGLTGWY
   169195YVAFDENSQGAWGAAKGDELPKDQFGG
   221228IQAENAHH
   264275VDGIGGKVVPGP
4Asp f537766135169TVIEAPSSFAPFKPQSYVE
   119127NVGKDGKVF
   132144SFYTGQIPSSAAL
   147158RDFSDPVTALKG
   170182DSASSESTEEKES
   255274INDPTEGERTVIKDPWDSVA
   280318ISDGSTNYTTSRGNNGIAQSNPSGGPSYLNNYRPSSSSL
   324335YSVSSSPPSSYI
   360376EKAGNFEYNTNGQGGLG
   385405QDGSGTNNANFATPPDGQPGR
   471510LKPGDKRSTDYTMGEWASNRAGGIRQYPYSTSLSTNPLTY
   541559HGKNDAPKPTLRDGVPTDG
5Asp f72879888115SSGYSGPCSKGSPCV
   2141YDTATSASAPSSCGLTNDGFS
6Asp f928798903158TWSKCNPLEKTCPPNKGLAASTYTADFT
   6894VTAGKVPVGPQGAEFTVAKQGDAPTID
   110116AAPGTGV
   196207YNDAKGGTRFPQ
   217231WAGGDPSNPKGTIEW
   233243GGLTDYSAGPY
   252270IENANPAESYTYSDNSGSW
7Asp f1530058411832LAAPTPENEARDAIP
   3455SVSYDPRYDNAGTSMNDVSCSN
   7391FARIGGAPTIPGWNSPNCG
   109117DAAPGGFN
   138150ATYEEADPSHCAS
8Asp f1636438132740PLAETCPPNKGLAA
   5884VTAGKVPVGPQGAEFTVAKQGDAPTID
   127160GDTTQVQTNYFGKGDTTTYDRGTYVPVATPQETF
   186197YNDAKGGTRFPQ
   207218GPAATPATPGHH
   271337SSSSSVTSSTTSTASSASSTSSKTPSTSTLATSTKATPTPSGTSSGSNSSSSAEPTTTGGSGSSNTG
   351378STGSSTSAGASATPELSQGAAGSIKGSV
   391399CWHSKQNDD
9Asp f172980819311LVSREAPAV
   2942SSYNGGDPSAVKSA
   5165NSGVDTVKSGPALST
   98106AANAGGTVY
   111118AQYTAADS
   125133AKVPESLSD
10Asp f341339202361326AATASAAACQAPTN
   3948AVQYQPFSAA
   5871SQNASCDRPDEKSA
   7592IQDGSLYLYAASATPQEI
   98125GMGQGKIGYTTGAQPAPRNSERQGWAID
   154165AGVANPAGNTDC
   173182EDVTNPNSCV
Table 4.

Selected High-Affinity Binding (IC50 < 50 nM) Nine-mer Mouse MHC Class I Epitopes

Serial No.AllergenGI numberStartEndEpitope
1Asp f1166486210VAIKNLFLL
   148156VIYTYPNKV
   8795KLIKGRTPI
2Asp f21881574102110MEAVGAYDV
3Asp f43005839816YATINGVLV
   162170LEAGETKYV
4Asp f53776613   
5Asp f728798884149SENVVALPV
6Asp f92879890244252TMYVKSVRI
   167175QETFHTYTI
7Asp f1530058412533NEARDAIPV
   513TPISLISLF
8Asp f163643813157165QETFHTYTI
9Asp f172980819614REAPAVGVI
   8290VEGVIDDLI
10Asp f341339202366775DEKSATFYI

MHC, major histocompatibilty complex.

Linear B Cell Epitopes for Allergen Selected High-Affinity Binding (IC50 < 50 nM) Nine-mer Mouse MHC Class I Epitopes MHC, major histocompatibilty complex. Furthermore, T cells and MHC-I and MHC-II class epitopes have been predicted by the ANN method.[18] We considered a low IC50 value for epitope prediction. On the basis of IC50 value, epitopes were classified into three categories: high-affinity (IC50 < 50 nM), intermediate (IC50 < 500), and low-affinity (IC50<) binding epitopes. Two allergenic proteins, Asp f5 and Asp f7, did not contain any high-affinity binding MHC class I T cell epitopes for mouse and human, respectively. We use all mouse MHC class I alleles and eight human alleles (A*0101, A*0201, A*2402, A*0301, A*1101, B*0702, B*0801, and B*1501) that cover 90% of the world population[39] (Tables 3–6). Furthermore, four allergenic proteins, Asp f1, Asp f2, Asp f4, and Asp f5, were predicted to have high-affinity binding mouse MHC class II-restricted epitopes, whereas all 10 allergenic proteins showed high-affinity human MHC class II-restricted T cell epitopes. The fifteen-mer MHC class II-restricted T cell epitopes are presented in Tables 6 and 7. Previously, Chaudhary et al. tested the therapeutic potential of Asp f1 allergen epitopes (INQQLNPKTNKWEDK, INQQLNPK, LNPKTNKWEDK) in sensitized BALB/c mice. They observed the increase in production of Th1 cytokines and suppression of lung eosinophilia by Asp f1 peptides. Thus, they establish the use of allergen peptides to control allergenic reactions in mice and open the way for human study.[27] Our analysis also predicted the same B cell and T cell (MHC-II class) epitopic peptides that are used by Chaudhary et al. and suggested a strong correlation between in silico prediction and experimental evidences. We further analyze the epitopic data to screen common epitopic peptides for mouse and human so that they can be tested first on mouse model of A. fumigatus-induced allergy or infection model, and then the promising results from these studies can go for clinical trials for human use. Three allergenic proteins, Asp f1, Asp f2, and Asp f5, contained overlapping mouse and human MHC class I and II epitopes (Table 7), whereas only two allergic proteins, Asp f17 and Asp f34, contained overlapping human MHC class I and II epitopes (Table 8). It has been suggested that the cell wall proteins of A. fumigatus having no homology with humans, but showing homology with other fungal proteins, can be considered as ideal vaccine candidates against fungal pathogens.[40] Recently, Tiwari et al. found the Asp fl 2 allergenic protein at germinating stage of Aspergillus flavus and showed no homology with human proteome.[41] Previously, Gautam et al. have also reported Asp f2 and Asp f13 using the immunoproteomic approach and showed antibodies against these proteins in the serum samples of ABPA patients.[42] Furthermore, Virginio et al. identified Asp f 12 and Asp f 22 from cell wall extracts of A. fumigatus's germinating conidia and also confirmed the presence of antibodies in patient serum samples against Asp f 12 and Asp f 22.[43] Thus, the epitopic regions (predicted in our study) from these allergens may also be considered as promising vaccine candidates that potentially block the germinating conidia in the host. Furthermore, overlapping epitopes (MHC class I and II) were also recognized as B cell epitopes. So, these identified epitopes might be involved in both humoral and cell-mediated immunity (CD4+ and CD8+), which will be suitable for experimental studies in combination or alone in a mouse model of A. fumigatus-induced infection or for in vitro studies in human cell lines (Table 9). Previously, various studies showed the immunodominant role of allergens as vaccine or allergy shot candidates.[7,44] Furthermore, allergen SIT or allergen shots balance the immune response, specially TH1 and TH2 immune response, and control the undesirable immune reactions.[27,45]
Table 6.

Selected High-Affinity Binding (IC50 < 50 nM) Fifteen-mer Mouse MHC Class II Epitopes

Serial No.AllergenGI numberStartEndEpitope
1Asp f1166486923LLAATAVSVLAAPSP
   822FLLAATAVSVLAAPS
2Asp f21881574519LRLAVLLPLAAPLVA
3Asp f430058393953VSNAVAAAAAASTPE
   3852PVSNAVAAAAAASTP
4Asp f53776613318332LSFKYPYSVSSSPPS
   319333SFKYPYSVSSSPPSS
5Asp f17298081993108KDKFVAANAGGTVYED
6Asp f341339202367589IQDGSLYLYAASATP
Table 7.

Selected High-Affinity Binding (IC50 < 50 nM) Fifteen-mer Human MHC Class II Epitopes

Serial No.AllergenGI numberStartEndEpitope
1Asp f1166486115MVAIKNLFLLAATAV
   3953PKTNKWEDKRLLYSQ
   4054KTNKWEDKRLLYSQA
   4963LYSQAKAESNSHHAP
   7589HWFTNGYDGNGKLIK
2Asp f21881574418LLRLAVLLPLAAPLV
   226240AFEYFALEAYAFDIA
   1529APLVATLPTSPVPIA
   204218DGYDEVIALAKSNGT
3Asp f43005839520DTVYATINGVLVSWI
   3751TPVSNAVAAAAAAST
   4054GELCSIISHGLSKVI
4Asp f53776613115MRGLLLAGALALPAS
   179193EKESYVFKGVSGTVS
   6478PQSYVEVATQHVKMI
   576590CNPNFVQARDAILDA
   505519TNPLTYTSVNSLNAV
   308322LNNYRPSSSSLSFKY
   305319PSYLNNYRPSSSSLS
5Asp f728798881528VGQLTYYDTATSASA
6Asp f92879890923ADMYFKYTAAALAAV
   1832AALAAVLPLCSAQTW
   238252YSAGPYTMYVKSVRI
   274288KFDGSVDISSSSSVT
   104118AEVVMKAAPGTGVVS
7Asp f1530058416882GSVPGFARIGGAPTI
   620PISLISLFVSSALAA
   115MKFTTPISLISLFVS
8Asp f163643813102116GGTVYEDLKAQYTAA
   4357SEKLVSTINSGVDTV
   100114NAGGTVYEDLKAQYT
   114128TAADSLAKAISAKVP
   1529SDISAQTSALASAVS
9Asp f172980819115MYFKYTAAALAAVLP
   260274AEHQVRRLRRYSSSS
   196210PQTPMRLRLAAGPAA
   93108AEVVMKAAPGTGVVS
   340354LRLRLWLWLYSSTGS
10Asp f34133920236115MQIKSFVLAASAAAT
   3953AVQYQPFSAAKSSIF
   4862AKSSIFAGLNSQNAS
   7589IQDGSLYLYAASATP
   2539TNKYFGIVAIHSGSA
Table 8.

Common or Overlapping Epitopes of Allergens Recognizing MHC Class I and MHC Class II Alleles of Human and Mouse

S. No.AllergenMouse MHC class IMouse MHC class IIHuman MHC class IHuman MHC class II
1Asp f1148–156 (VIYTYPNKV) 147–155 (RVIYTYPNK) 
   9–23 (LLAATAVSVLAAPSP)9–17 (LLAATAVSV)1–15 (MVAIKNLFLLAATAV)
2Asp f2 5–19 (LRLAVLLPLAAPLVA)9–17 (VLLPLAAPL)4–18 (LLRLAVLLPLAAPLV)
3Asp f5 318–332 (LSFKYPYSVSSSPPS)316–324 (SSLSFKYPY)308–322 (LNNYRPSSSSLSFKY)
   319–333 (SFKYPYSVSSSPPSS)314–322 (SSSSLSFKY)305–319 (PSYLNNYRPSSSSLS)
4Asp f17 93–108 (DKFVAANAGGTVYED)98–106 (AANAGGTVY) 
5Asp f34 75–89 (IQDGSLYLYAASATP)74–82 (YIQDGSLYL) 
Table 9.

Potential Antigenic Allergen Proteins for Vaccine Candidate

Serial No.AllergenGI NumberGenBank protein IDProtein nameImmune response
1Asp f1166486AAB07779MitogillinCellular and humoral
2Asp f21881574AAC69357Hypothetical proteinCellular and humoral
3Asp f53776613CAA83015MetalloproteaseCellular and humoral
4Asp f172980819CAA12162IgE-binding proteinCellular and humoral
5Asp f34133920236CAM54066cell wall protein PhiACellular and humoral
Selected High-Affinity Binding (IC50 < 50 nM) Nine-mer Human MHC Class I Epitopes Selected High-Affinity Binding (IC50 < 50 nM) Fifteen-mer Mouse MHC Class II Epitopes Selected High-Affinity Binding (IC50 < 50 nM) Fifteen-mer Human MHC Class II Epitopes Common or Overlapping Epitopes of Allergens Recognizing MHC Class I and MHC Class II Alleles of Human and Mouse Potential Antigenic Allergen Proteins for Vaccine Candidate

Modeling of tertiary structure

These five allergenic proteins that have overlapping MHC class I and MHC class II T cell epitopes were used to predict 3D modeled structure. Previously, Asp f1, Asp f2, Asp f3, and Asp f16 recombinant allergens have been tested as vaccine candidates.[7,9,46] Of five promising allergens as vaccine or allergen shot candidates, Phyre2 server predicted 3D structure template for Asp f1 and Asp f5 only (Figs. 2 and 3). It identified multiple templates based on the best aligned sequence for some of the proteins. The best structural template was selected for Asp f1 and Asp f5 manually on the basis of best alignment length, a minimum number of gaps, and higher identity. For Asp f1 and Asp f5 structure models, unique template IDs (d1jbsa and c4k90A) were chosen. Asp f1 allergenic protein predicted to be a member of the ribonuclease family, whereas Asp f5 predicted to be an extracellular metalloproteinase. Furthermore, predicted model structures were submitted to energy minimization and structure refinement using ModRefiner and YASARA force field energy minimization server. After that modeled structures were validated by RAMPAGE. The Ramachandran plot predicted the structure stability of modeled structure. For Asp f1, 95.2% residues were found in the favored region, 4.8% in allowed region, and 0% in outlier region (Supplementary Fig. S1), and in case of Asp f5, 88.6% residues were in the favored region, 7.3% residues were in allowed region, and 4.1% residues were in outlier region (Supplementary Fig. S2). Furthermore, PyMOL was used to illustrate the spatial locations of residues in some epitopic peptides, which predicted to be located on the surface of the protein and presented at N-terminal of the protein. It is evident that T cell and B cell epitopes are exposed to the surface of the protein and therefore it supports that the predicted sequence may act as a potential vaccine peptide[32] (Figs. 2 and 3). A similar method has been used for prediction of the 3D structure of proteins for vaccine candidate.[19]

Predicted 3D structure of Asp f1 and B cell and T cell epitopic regions. (A) The B and T cell epitopic region of Asp f1, red surface shows MHC-I T cell epitopic region, whereas green surface-exposed region shows overlapped T and B cell epitopes. (B) 3D structure of Asp f1. MHC, major histocompatibility complex.

Predicted 3D structure of Asp f5 and B cell and T cell epitopic regions. (A) The B and T cell epitopic region of Asp f5, red surface shows MHC-I and II T cell epitopic region, whereas green surface-exposed region shows overlapped T and B cell epitopes. (B) 3D structure of Asp f5.

Predicted 3D structure of Asp f1 and B cell and T cell epitopic regions. (A) The B and T cell epitopic region of Asp f1, red surface shows MHC-I T cell epitopic region, whereas green surface-exposed region shows overlapped T and B cell epitopes. (B) 3D structure of Asp f1. MHC, major histocompatibility complex. Predicted 3D structure of Asp f5 and B cell and T cell epitopic regions. (A) The B and T cell epitopic region of Asp f5, red surface shows MHC-I and II T cell epitopic region, whereas green surface-exposed region shows overlapped T and B cell epitopes. (B) 3D structure of Asp f5. Thus, the vaccination, alone and combination of selected peptides from these five allergenic proteins, can be used to combat Aspergillus-induced infection due to activation of both humoral and cell-mediated immune responses. On the other side, small T cell peptides (8–9 mer) (Table 10) can be used as allergen shot candidates because IgE antibody recognizes large epitopic peptides (B cell epitopes), thus these small peptides can activate T cell immune response and eliminate IgE activation.[47]
Table 10.

Potential Allergen Shot Peptides of Selected Allergenic Proteins

Serial No.AllergenGI NumberT cell peptides
1Asp f1166486HYLLEFPTF
   VIYTYPNKV
   KLIKGRTPI
2Asp f21881574MEAVGAYDV
3Asp f172980819REAPAVGVI
   VEGVIDDLI
4Asp f34133920236DEKSATFYI
Potential Allergen Shot Peptides of Selected Allergenic Proteins

Conclusion

A total of five potential allergenic proteins (Asp f1, Asp f2, Asp f5, Asp f17, and Asp f34) from A. fumigatus as vaccine or allergy shot candidates were obtained. Epitopic peptides from these five proteins in combination or alone could be used to prioritize in experimental validation with human cell lines or in mouse model of A. fumigatus infection or allergic mouse models. Previously, Chaudhary et al. showed the therapeutic use of Asp f1 allergen epitopes (INQQLNPKTNKWEDK, INQQLNPK, LNPKTNKWEDK) in sensitized BALB/c mice. Chaudhary et al. observed increase in production of Th1 cytokines and suppression of lung eosinophilia by Asp f1 peptides. Thus, they established the use of allergen peptides to control allergenic reaction in mice. In addition, Gautam et al. identified Asp f2 using the immunoproteomic approach in ABPA patients, which correlates with our in silico results. Furthermore, we also analyzed the 3D structure of Asp f1 and Asp f5 allergenic proteins. Overall, resulting peptides from our analysis could be subjected to experimental prioritization to explore vaccine candidates or allergy immunotherapy against Aspergillus-mediated infections.
Table 5.

Selected High-Affinity Binding (IC50 < 50 nM) Nine-mer Human MHC Class I Epitopes

Serial No.AllergenGI numberStartEndEpitope
1Asp f1166486118126HYLLEFPTF
   917LLAATAVSV
   147155RVIYTYPNK
2Asp f21881574917VLLPLAAPL
   181189ASDLMHRLY
   198206WVDHFADGY
   1523APLVATLPT
   163171SMCSQGYTV
   94102KYFGNRPTM
   183191DLMHRLYHV
3Asp f43005839244252SIISHGLSK
   272280VPGPTRLVV
   3139APVSQATPV
   244252SIISHGLSK
   9199PSGSGIFYK
4Asp f53776613529537MLYEVLWNL
   242250YVAEADYQV
   312320RPSSSSLSF
   7684KMIAPDATF
   334342YIDASIIQL
   1927HPAHQSYGL
   495503RQYPYSTSL
   125133KVFSYGNSF
   412LLLAGALAL
   316324SSLSFKYPY
   314322SSSSLSFKY
   348356IYHDLLYTL
5Asp f72879888   
6Asp f92879890235243LTDYSAGPY
   1523YTAAALAAV
   4755GLAASTYTA
   192200RTLTYNDAK
   171179HTYTIDWTK
   141149QVQTNYFGK
   95103TDFYFFFGK
   513ILRSADMYF
   715RSADMYFKY
7Asp f15300584196104LQYEQNTIY
8Asp f163643813251259HLLGQLWLL
   381389ALWCSAPSL
   513YTAAALAAV
   285293SSASSTSSK
   198206TPMRLRLAA
   182190RTLTYNDAK
   161169HTYTIDWTK
   333341SSNTGSWLR
   242250RERQPRRVL
   131139QVQTNYFGK
   245253QPRRVLHLL
   8593TDFYFFFGK
   19206TPMRLRLAA
   285293SSASSTSSK
   417425FGIGVSPSF
9Asp f1729808198492GVIDDLISK
   2331ALASAVSSY
   130138SLSDIAAQL
   118126SLAKAISAK
   113121YTAADSLAK
   98106AANAGGTVY
   8593VIDDLISKK
   118126SLAKAISAK
10Asp f341339202367482YIQDGSLYL
   175183VTNPNSCVY
   175183VTNPNSCVY
   4553FSAAKSSIF
   6573RPDEKSATF
   6169ASCDRPDEK
  47 in total

1.  Improving the physical realism and structural accuracy of protein models by a two-step atomic-level energy minimization.

Authors:  Dong Xu; Yang Zhang
Journal:  Biophys J       Date:  2011-11-15       Impact factor: 4.033

Review 2.  From memory to antifungal vaccine design.

Authors:  Rossana G Iannitti; Agostinho Carvalho; Luigina Romani
Journal:  Trends Immunol       Date:  2012-05-28       Impact factor: 16.687

3.  Vaccinations with recombinant variants of Aspergillus fumigatus allergen Asp f 3 protect mice against invasive aspergillosis.

Authors:  James I Ito; Joseph M Lyons; Teresa B Hong; Daniel Tamae; Yi-Kuang Liu; Sharon P Wilczynski; Markus Kalkum
Journal:  Infect Immun       Date:  2006-09       Impact factor: 3.441

Review 4.  More than one reason to rethink the use of peptides in vaccine design.

Authors:  Anthony W Purcell; James McCluskey; Jamie Rossjohn
Journal:  Nat Rev Drug Discov       Date:  2007-05       Impact factor: 84.694

5.  Global burden of allergic bronchopulmonary aspergillosis with asthma and its complication chronic pulmonary aspergillosis in adults.

Authors:  David W Denning; Alex Pleuvry; Donald C Cole
Journal:  Med Mycol       Date:  2012-12-04       Impact factor: 4.076

6.  Proteomic Analysis of Pathogenic Fungi Reveals Highly Expressed Conserved Cell Wall Proteins.

Authors:  Jackson Champer; James I Ito; Karl V Clemons; David A Stevens; Markus Kalkum
Journal:  J Fungi (Basel)       Date:  2016-01-12

7.  The Phyre2 web portal for protein modeling, prediction and analysis.

Authors:  Lawrence A Kelley; Stefans Mezulis; Christopher M Yates; Mark N Wass; Michael J E Sternberg
Journal:  Nat Protoc       Date:  2015-05-07       Impact factor: 13.491

8.  In Silico Prediction of T and B Cell Epitopes of Der f 25 in Dermatophagoides farinae.

Authors:  Xiaohong Li; Hai-Wei Yang; Hao Chen; Jing Wu; Yehai Liu; Ji-Fu Wei
Journal:  Int J Genomics       Date:  2014-05-08       Impact factor: 2.326

9.  The immune epitope database (IEDB) 3.0.

Authors:  Randi Vita; James A Overton; Jason A Greenbaum; Julia Ponomarenko; Jason D Clark; Jason R Cantrell; Daniel K Wheeler; Joseph L Gabbard; Deborah Hix; Alessandro Sette; Bjoern Peters
Journal:  Nucleic Acids Res       Date:  2014-10-09       Impact factor: 16.971

10.  In silico Analysis Revealed High-risk Single Nucleotide Polymorphisms in Human Pentraxin-3 Gene and their Impact on Innate Immune Response against Microbial Pathogens.

Authors:  Raman Thakur; Jata Shankar
Journal:  Front Microbiol       Date:  2016-02-23       Impact factor: 5.640

View more
  4 in total

1.  Evaluating complete surface-associated and secretory proteome of Leishmania donovani for discovering novel vaccines and diagnostic targets.

Authors:  Munawwar Karim; Garima Singh; Shweta Thakur; Aarti Rana; Abdur Rub; Yusuf Akhter
Journal:  Arch Microbiol       Date:  2022-09-07       Impact factor: 2.667

Review 2.  Advances in Fungal Peptide Vaccines.

Authors:  Leandro B R Da Silva; Carlos P Taborda; Joshua D Nosanchuk
Journal:  J Fungi (Basel)       Date:  2020-07-25

3.  In Silico Designing of a Multitope Vaccine against Rhizopus microsporus with Potential Activity against Other Mucormycosis Causing Fungi.

Authors:  Mohamed A Soltan; Muhammad Alaa Eldeen; Nada Elbassiouny; Hasnaa L Kamel; Kareem M Abdelraheem; Hanaa Abd El-Gayyed; Ahmed M Gouda; Mohammed F Sheha; Eman Fayad; Ola A Abu Ali; Khalid Abd El Ghany; Dalia A El-Damasy; Khaled M Darwish; Sameh S Elhady; Ashraf E Sileem
Journal:  Cells       Date:  2021-11-04       Impact factor: 6.600

Review 4.  Molecular Insights Into Development and Virulence Determinants of Aspergilli: A Proteomic Perspective.

Authors:  Jata Shankar; Shraddha Tiwari; Sonia K Shishodia; Manali Gangwar; Shanu Hoda; Raman Thakur; Pooja Vijayaraghavan
Journal:  Front Cell Infect Microbiol       Date:  2018-05-29       Impact factor: 5.293

  4 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.