| Literature DB >> 27872794 |
Abstract
Aspergillus fumigatus is capable of causing invasive aspergillosis or acute bronchopulmonary aspergillosis, and the current situation is alarming. There are no vaccine or allergen shots available for Aspergillus-induced allergies. Thus, a novel approach in designing of an effective vaccine or allergen shot candidate against A. fumigatus is needed. Using immunoinformatics approaches from the characterized A. fumigatus allergens, we have mapped epitopic regions to predict potential peptides that elicit both Aspergillus-specific T cells and B cell immune response. Experimentally derived immunodominant allergens were retrieved from www.allergen.org. A total of 23 allergenic proteins of A. fumigatus were retrieved. Out of 23 allergenic proteins, 13 of them showed high sequence similarity to both human and mouse counterparts and thus were eliminated from analysis due to possible cross-reactivity. Remaining allergens were subjected to T cell (major histocompatibility complex class I and II alleles) and B cell epitope prediction using immune epitope database analysis resource. Only five allergens have shown a common B and T cell epitopic region between human and mouse. They are Asp f1 {147-156 region (RVIYTYPNKV); Mitogillin}, Asp f2 {5-19 region (LRLAVLLPLAAPLVA); Hypothetical protein}, Asp f5 {305-322 region (LNNYRPSSSSLSFKY); Metalloprotease}, Asp f17 {98-106 region (AANAGGTVY); Hypothetical protein}, and Asp f34 {74-82 region (YIQDGSLYL); PhiA cell wall protein}. The epitopic region from these five allergenic proteins showed potential for development of single peptide- or multipeptide-based vaccine or allergen shots for experimental prioritization.Entities:
Keywords: Asp f34; Aspergillus fumigatus; allergens; epitopes; vaccine; vaccine design
Year: 2016 PMID: 27872794 PMCID: PMC5116691 DOI: 10.1089/biores.2016.0035
Source DB: PubMed Journal: Biores Open Access ISSN: 2164-7844

Overall strategy used for prediction of vaccine or allergy shot candidates against Aspergillus-induced infections and allergy.
Allergen Retrieved from
| Allergen | GI number | Molecular weight (KDa) |
|---|---|---|
| 166486 | 18 | |
| 1881574 | 37 | |
| 2769700 | 19 | |
| 3005839 | 30 | |
| 3776613 | 40 | |
| 1648970 | 26.5 | |
| 2879888 | 12 | |
| 6686524 | 11 | |
| 2879890 | 34 | |
| 963013 | 34 | |
| 5019414 | 24 | |
| 1930153 | 90 | |
| 2295 | 34 | |
| 3005841 | 16 | |
| 3643813 | 43 | |
| 2980819 | ||
| 2143220 | 34 | |
| 13925873 | 46 | |
| 21215170 | 44 | |
| 91680605 | 18 | |
| 91680607 | 13 | |
| 91680609 | 13 | |
| 133920236 | 20 | |
Antigenicity of Allergen
| Antigen | GI number | Protein name | Antigenicity score (Threshold >0.4) |
|---|---|---|---|
| 166486 | Mitogillin | 0.7540 | |
| 1881574 | Hypothetical protein | 0.8795 | |
| 3005839 | Hypothetical protein | 1.0311 | |
| 3776613 | Metalloprotease | 0.5683 | |
| 2879888 | Hypothetical protein | 0.8011 | |
| 2879890 | Hypothetical protein | 0.7615 | |
| 3005841 | Hypothetical protein | 0.8088 | |
| 3643813 | Hypothetical protein | 0.9120 | |
| 2980819 | IgE-binding protein | 0.9860 | |
| 133920236 | Cell wall protein PhiA | 0.5564 |
Linear B Cell Epitopes for Allergen
| Serial No. | Allergen | GI number | Start | End | Epitope |
|---|---|---|---|---|---|
| 166486 | 1 | 24 | MVAIKNLFLLAATAVSVLAAPSPL | ||
| 35 | 48 | QQLNPKTNKWEDKR | |||
| 104 | 118 | RPPKHSQNGMGKDDH | |||
| 132 | 142 | YKFDSKKPKED | |||
| 81 | 97 | GYDGNGKLIKGRTPIKF | |||
| 1881574 | 20 | 37 | TLPTSPVPIAARATPHEP | ||
| 56 | 63 | CNATQRRQ | |||
| 97 | 105 | GNRPTMEAV | |||
| 124 | 133 | DNPDGNCALE | |||
| 136 | 146 | GGHWRGANATS | |||
| 169 | 179 | YTVAGSETNTF | |||
| 215 | 225 | SNGTESTHDSE | |||
| 242 | 304 | PGVGCAGESHGPDQGHDTGSASAPASTSTSSSSSGSGSGATTTPTDSPSATIDVPSNCHTHEG | |||
| 3005839 | 21 | 44 | EWSGEAKTSDAPVSQATPVSNAVA | ||
| 46 | 97 | AAAASTPEPSSSHSDSSSSSGVSADWTNTPAEGEYCTDGFGGRTEPSGSGIF | |||
| 101 | 108 | NVGKPWGS | |||
| 111 | 120 | IEVSPENAKK | |||
| 128 | 135 | VGSDTDPW | |||
| 143 | 153 | IGPDGGLTGWY | |||
| 169 | 195 | YVAFDENSQGAWGAAKGDELPKDQFGG | |||
| 221 | 228 | IQAENAHH | |||
| 264 | 275 | VDGIGGKVVPGP | |||
| 3776613 | 51 | 69 | TVIEAPSSFAPFKPQSYVE | ||
| 119 | 127 | NVGKDGKVF | |||
| 132 | 144 | SFYTGQIPSSAAL | |||
| 147 | 158 | RDFSDPVTALKG | |||
| 170 | 182 | DSASSESTEEKES | |||
| 255 | 274 | INDPTEGERTVIKDPWDSVA | |||
| 280 | 318 | ISDGSTNYTTSRGNNGIAQSNPSGGPSYLNNYRPSSSSL | |||
| 324 | 335 | YSVSSSPPSSYI | |||
| 360 | 376 | EKAGNFEYNTNGQGGLG | |||
| 385 | 405 | QDGSGTNNANFATPPDGQPGR | |||
| 471 | 510 | LKPGDKRSTDYTMGEWASNRAGGIRQYPYSTSLSTNPLTY | |||
| 541 | 559 | HGKNDAPKPTLRDGVPTDG | |||
| 2879888 | 1 | 15 | SSGYSGPCSKGSPCV | ||
| 21 | 41 | YDTATSASAPSSCGLTNDGFS | |||
| 2879890 | 31 | 58 | TWSKCNPLEKTCPPNKGLAASTYTADFT | ||
| 68 | 94 | VTAGKVPVGPQGAEFTVAKQGDAPTID | |||
| 110 | 116 | AAPGTGV | |||
| 196 | 207 | YNDAKGGTRFPQ | |||
| 217 | 231 | WAGGDPSNPKGTIEW | |||
| 233 | 243 | GGLTDYSAGPY | |||
| 252 | 270 | IENANPAESYTYSDNSGSW | |||
| 3005841 | 18 | 32 | LAAPTPENEARDAIP | ||
| 34 | 55 | SVSYDPRYDNAGTSMNDVSCSN | |||
| 73 | 91 | FARIGGAPTIPGWNSPNCG | |||
| 109 | 117 | DAAPGGFN | |||
| 138 | 150 | ATYEEADPSHCAS | |||
| 3643813 | 27 | 40 | PLAETCPPNKGLAA | ||
| 58 | 84 | VTAGKVPVGPQGAEFTVAKQGDAPTID | |||
| 127 | 160 | GDTTQVQTNYFGKGDTTTYDRGTYVPVATPQETF | |||
| 186 | 197 | YNDAKGGTRFPQ | |||
| 207 | 218 | GPAATPATPGHH | |||
| 271 | 337 | SSSSSVTSSTTSTASSASSTSSKTPSTSTLATSTKATPTPSGTSSGSNSSSSAEPTTTGGSGSSNTG | |||
| 351 | 378 | STGSSTSAGASATPELSQGAAGSIKGSV | |||
| 391 | 399 | CWHSKQNDD | |||
| 2980819 | 3 | 11 | LVSREAPAV | ||
| 29 | 42 | SSYNGGDPSAVKSA | |||
| 51 | 65 | NSGVDTVKSGPALST | |||
| 98 | 106 | AANAGGTVY | |||
| 111 | 118 | AQYTAADS | |||
| 125 | 133 | AKVPESLSD | |||
| 133920236 | 13 | 26 | AATASAAACQAPTN | ||
| 39 | 48 | AVQYQPFSAA | |||
| 58 | 71 | SQNASCDRPDEKSA | |||
| 75 | 92 | IQDGSLYLYAASATPQEI | |||
| 98 | 125 | GMGQGKIGYTTGAQPAPRNSERQGWAID | |||
| 154 | 165 | AGVANPAGNTDC | |||
| 173 | 182 | EDVTNPNSCV |
Selected High-Affinity Binding (IC50 < 50 nM) Nine-mer Mouse MHC Class I Epitopes
| Serial No. | Allergen | GI number | Start | End | Epitope |
|---|---|---|---|---|---|
| 166486 | 2 | 10 | VAIKNLFLL | ||
| 148 | 156 | VIYTYPNKV | |||
| 87 | 95 | KLIKGRTPI | |||
| 1881574 | 102 | 110 | MEAVGAYDV | ||
| 3005839 | 8 | 16 | YATINGVLV | ||
| 162 | 170 | LEAGETKYV | |||
| 3776613 | |||||
| 2879888 | 41 | 49 | SENVVALPV | ||
| 2879890 | 244 | 252 | TMYVKSVRI | ||
| 167 | 175 | QETFHTYTI | |||
| 3005841 | 25 | 33 | NEARDAIPV | ||
| 5 | 13 | TPISLISLF | |||
| 3643813 | 157 | 165 | QETFHTYTI | ||
| 2980819 | 6 | 14 | REAPAVGVI | ||
| 82 | 90 | VEGVIDDLI | |||
| 133920236 | 67 | 75 | DEKSATFYI |
MHC, major histocompatibilty complex.
Selected High-Affinity Binding (IC50 < 50 nM) Fifteen-mer Mouse MHC Class II Epitopes
| Serial No. | Allergen | GI number | Start | End | Epitope |
|---|---|---|---|---|---|
| 166486 | 9 | 23 | LLAATAVSVLAAPSP | ||
| 8 | 22 | FLLAATAVSVLAAPS | |||
| 1881574 | 5 | 19 | LRLAVLLPLAAPLVA | ||
| 3005839 | 39 | 53 | VSNAVAAAAAASTPE | ||
| 38 | 52 | PVSNAVAAAAAASTP | |||
| 3776613 | 318 | 332 | LSFKYPYSVSSSPPS | ||
| 319 | 333 | SFKYPYSVSSSPPSS | |||
| 2980819 | 93 | 108 | KDKFVAANAGGTVYED | ||
| 133920236 | 75 | 89 | IQDGSLYLYAASATP |
Selected High-Affinity Binding (IC50 < 50 nM) Fifteen-mer Human MHC Class II Epitopes
| Serial No. | Allergen | GI number | Start | End | Epitope |
|---|---|---|---|---|---|
| 166486 | 1 | 15 | MVAIKNLFLLAATAV | ||
| 39 | 53 | PKTNKWEDKRLLYSQ | |||
| 40 | 54 | KTNKWEDKRLLYSQA | |||
| 49 | 63 | LYSQAKAESNSHHAP | |||
| 75 | 89 | HWFTNGYDGNGKLIK | |||
| 1881574 | 4 | 18 | LLRLAVLLPLAAPLV | ||
| 226 | 240 | AFEYFALEAYAFDIA | |||
| 15 | 29 | APLVATLPTSPVPIA | |||
| 204 | 218 | DGYDEVIALAKSNGT | |||
| 3005839 | 5 | 20 | DTVYATINGVLVSWI | ||
| 37 | 51 | TPVSNAVAAAAAAST | |||
| 40 | 54 | GELCSIISHGLSKVI | |||
| 3776613 | 1 | 15 | MRGLLLAGALALPAS | ||
| 179 | 193 | EKESYVFKGVSGTVS | |||
| 64 | 78 | PQSYVEVATQHVKMI | |||
| 576 | 590 | CNPNFVQARDAILDA | |||
| 505 | 519 | TNPLTYTSVNSLNAV | |||
| 308 | 322 | LNNYRPSSSSLSFKY | |||
| 305 | 319 | PSYLNNYRPSSSSLS | |||
| 2879888 | 15 | 28 | VGQLTYYDTATSASA | ||
| 2879890 | 9 | 23 | ADMYFKYTAAALAAV | ||
| 18 | 32 | AALAAVLPLCSAQTW | |||
| 238 | 252 | YSAGPYTMYVKSVRI | |||
| 274 | 288 | KFDGSVDISSSSSVT | |||
| 104 | 118 | AEVVMKAAPGTGVVS | |||
| 3005841 | 68 | 82 | GSVPGFARIGGAPTI | ||
| 6 | 20 | PISLISLFVSSALAA | |||
| 1 | 15 | MKFTTPISLISLFVS | |||
| 3643813 | 102 | 116 | GGTVYEDLKAQYTAA | ||
| 43 | 57 | SEKLVSTINSGVDTV | |||
| 100 | 114 | NAGGTVYEDLKAQYT | |||
| 114 | 128 | TAADSLAKAISAKVP | |||
| 15 | 29 | SDISAQTSALASAVS | |||
| 2980819 | 1 | 15 | MYFKYTAAALAAVLP | ||
| 260 | 274 | AEHQVRRLRRYSSSS | |||
| 196 | 210 | PQTPMRLRLAAGPAA | |||
| 93 | 108 | AEVVMKAAPGTGVVS | |||
| 340 | 354 | LRLRLWLWLYSSTGS | |||
| 133920236 | 1 | 15 | MQIKSFVLAASAAAT | ||
| 39 | 53 | AVQYQPFSAAKSSIF | |||
| 48 | 62 | AKSSIFAGLNSQNAS | |||
| 75 | 89 | IQDGSLYLYAASATP | |||
| 25 | 39 | TNKYFGIVAIHSGSA |
Common or Overlapping Epitopes of Allergens Recognizing MHC Class I and MHC Class II Alleles of Human and Mouse
| S. No. | Allergen | Mouse MHC class I | Mouse MHC class II | Human MHC class I | Human MHC class II |
|---|---|---|---|---|---|
| 148–156 (VIYTYPNKV) | 147–155 (RVIYTYPNK) | ||||
| 9–23 (LLAATAVSVLAAPSP) | 9–17 (LLAATAVSV) | 1–15 (MVAIKNLFLLAATAV) | |||
| 5–19 (LRLAVLLPLAAPLVA) | 9–17 (VLLPLAAPL) | 4–18 (LLRLAVLLPLAAPLV) | |||
| 318–332 (LSFKYPYSVSSSPPS) | 316–324 (SSLSFKYPY) | 308–322 (LNNYRPSSSSLSFKY) | |||
| 319–333 (SFKYPYSVSSSPPSS) | 314–322 (SSSSLSFKY) | 305–319 (PSYLNNYRPSSSSLS) | |||
| 93–108 (DKFVAANAGGTVYED) | 98–106 (AANAGGTVY) | ||||
| 75–89 (IQDGSLYLYAASATP) | 74–82 (YIQDGSLYL) |
Potential Antigenic Allergen Proteins for Vaccine Candidate
| Serial No. | Allergen | GI Number | GenBank protein ID | Protein name | Immune response |
|---|---|---|---|---|---|
| 1 | 166486 | AAB07779 | Mitogillin | Cellular and humoral | |
| 2 | 1881574 | AAC69357 | Hypothetical protein | Cellular and humoral | |
| 3 | 3776613 | CAA83015 | Metalloprotease | Cellular and humoral | |
| 4 | 2980819 | CAA12162 | IgE-binding protein | Cellular and humoral | |
| 5 | 133920236 | CAM54066 | cell wall protein PhiA | Cellular and humoral |

Predicted 3D structure of Asp f1 and B cell and T cell epitopic regions. (A) The B and T cell epitopic region of Asp f1, red surface shows MHC-I T cell epitopic region, whereas green surface-exposed region shows overlapped T and B cell epitopes. (B) 3D structure of Asp f1. MHC, major histocompatibility complex.

Predicted 3D structure of Asp f5 and B cell and T cell epitopic regions. (A) The B and T cell epitopic region of Asp f5, red surface shows MHC-I and II T cell epitopic region, whereas green surface-exposed region shows overlapped T and B cell epitopes. (B) 3D structure of Asp f5.
Potential Allergen Shot Peptides of Selected Allergenic Proteins
| Serial No. | Allergen | GI Number | T cell peptides |
|---|---|---|---|
| 1 | 166486 | HYLLEFPTF | |
| VIYTYPNKV | |||
| KLIKGRTPI | |||
| 2 | 1881574 | MEAVGAYDV | |
| 3 | 2980819 | REAPAVGVI | |
| VEGVIDDLI | |||
| 4 | 133920236 | DEKSATFYI |
Selected High-Affinity Binding (IC50 < 50 nM) Nine-mer Human MHC Class I Epitopes
| Serial No. | Allergen | GI number | Start | End | Epitope |
|---|---|---|---|---|---|
| 166486 | 118 | 126 | HYLLEFPTF | ||
| 9 | 17 | LLAATAVSV | |||
| 147 | 155 | RVIYTYPNK | |||
| 1881574 | 9 | 17 | VLLPLAAPL | ||
| 181 | 189 | ASDLMHRLY | |||
| 198 | 206 | WVDHFADGY | |||
| 15 | 23 | APLVATLPT | |||
| 163 | 171 | SMCSQGYTV | |||
| 94 | 102 | KYFGNRPTM | |||
| 183 | 191 | DLMHRLYHV | |||
| 3005839 | 244 | 252 | SIISHGLSK | ||
| 272 | 280 | VPGPTRLVV | |||
| 31 | 39 | APVSQATPV | |||
| 244 | 252 | SIISHGLSK | |||
| 91 | 99 | PSGSGIFYK | |||
| 3776613 | 529 | 537 | MLYEVLWNL | ||
| 242 | 250 | YVAEADYQV | |||
| 312 | 320 | RPSSSSLSF | |||
| 76 | 84 | KMIAPDATF | |||
| 334 | 342 | YIDASIIQL | |||
| 19 | 27 | HPAHQSYGL | |||
| 495 | 503 | RQYPYSTSL | |||
| 125 | 133 | KVFSYGNSF | |||
| 4 | 12 | LLLAGALAL | |||
| 316 | 324 | SSLSFKYPY | |||
| 314 | 322 | SSSSLSFKY | |||
| 348 | 356 | IYHDLLYTL | |||
| 2879888 | |||||
| 2879890 | 235 | 243 | LTDYSAGPY | ||
| 15 | 23 | YTAAALAAV | |||
| 47 | 55 | GLAASTYTA | |||
| 192 | 200 | RTLTYNDAK | |||
| 171 | 179 | HTYTIDWTK | |||
| 141 | 149 | QVQTNYFGK | |||
| 95 | 103 | TDFYFFFGK | |||
| 5 | 13 | ILRSADMYF | |||
| 7 | 15 | RSADMYFKY | |||
| 3005841 | 96 | 104 | LQYEQNTIY | ||
| 3643813 | 251 | 259 | HLLGQLWLL | ||
| 381 | 389 | ALWCSAPSL | |||
| 5 | 13 | YTAAALAAV | |||
| 285 | 293 | SSASSTSSK | |||
| 198 | 206 | TPMRLRLAA | |||
| 182 | 190 | RTLTYNDAK | |||
| 161 | 169 | HTYTIDWTK | |||
| 333 | 341 | SSNTGSWLR | |||
| 242 | 250 | RERQPRRVL | |||
| 131 | 139 | QVQTNYFGK | |||
| 245 | 253 | QPRRVLHLL | |||
| 85 | 93 | TDFYFFFGK | |||
| 19 | 206 | TPMRLRLAA | |||
| 285 | 293 | SSASSTSSK | |||
| 417 | 425 | FGIGVSPSF | |||
| 2980819 | 84 | 92 | GVIDDLISK | ||
| 23 | 31 | ALASAVSSY | |||
| 130 | 138 | SLSDIAAQL | |||
| 118 | 126 | SLAKAISAK | |||
| 113 | 121 | YTAADSLAK | |||
| 98 | 106 | AANAGGTVY | |||
| 85 | 93 | VIDDLISKK | |||
| 118 | 126 | SLAKAISAK | |||
| 133920236 | 74 | 82 | YIQDGSLYL | ||
| 175 | 183 | VTNPNSCVY | |||
| 175 | 183 | VTNPNSCVY | |||
| 45 | 53 | FSAAKSSIF | |||
| 65 | 73 | RPDEKSATF | |||
| 61 | 69 | ASCDRPDEK |