| Literature DB >> 27794585 |
Masoumeh Baradaran1, Amir Jalali2, Maryam Naderi Soorki3, Hamid Galehdari1.
Abstract
INTRODUCTION: Scorpion venom is a source of bioactive peptides, and some antimicrobial peptides (AMPs) have been found in the venom gland of scorpions. Therefore, the discovery of new anti-infective agents is an essential need to overcome the problem of antibiotic resistance of clinical isolates. Here, we describe three new cationic AMPs, including meuVAP-6, meuAP-18-1, and meuPep34 from the venom gland of the Iranian scorpion, Mesobuthus eupeus.Entities:
Keywords: Antimicrobial cationic peptides; Defensin-like peptide; Mesobuthus eupeus
Mesh:
Substances:
Year: 2017 PMID: 27794585 PMCID: PMC5392222 DOI: 10.18869/acadpub.ibj.21.3.190
Source DB: PubMed Journal: Iran Biomed J ISSN: 1028-852X
Fig. 1cDNA and translated open-reading frame (ORF)for meuVAP-6 (A), meuAP-18-1 (B), and meuPep34 (C). Nucleotides of ORF are single underlined, and stop codons are indicated by asterisks. AAA and TTT motifs in 3’UTR are highlighted with yellow color.
Fig. 2The left images are schematic image of (A) meuVAP-6, (B) meuAP-18-1, and (C) meuPep34 with its domains. The right images showes aa sequences of (A) meuVAP-6, (B) meuAP-18-1, (C) meuPep34 and aa of each domain. (A) Down image indicates aa sequences alignment of meuVAP-6 with homologues, including venom antimicrobial peptide-6 (Meucin-13), Chinese M. eupeus (AC. no.: E4VP07), NDBP11, Lychas mucronatus (AC. no.: A0A0U1S7U5), Peptide BmKn1, Mesobuthus martensii (AC. no.: Q9GQW4), Peptide BmKn2, Mesobuthus martensii (AC. no.: Q6JQN2), Amphipathic peptide Tx348, Buthus occitanus israelis (AC. no.: B8XH50), non-disulfide-bridged peptide androcin 10-2, Androctonus bicolor (AC. no.: A0A0K0LBS0), non-disulfide-bridged peptide androcin 10-1, and Androctonus bicolor (AC. no.: A0A0K0LCH4). (B) Down image shows the aa sequences alignment of meuAP-18-1 with homologues, including antimicrobial peptide meucin-18-1, Chinese M. eupeus (AC. no.: F6K5S5), antimicrobial peptide marcin-18, Mesobuthus martensii (AC. no.: F6K5S6), antimicrobial peptide marcin-18-1, Mesobuthus martensii (AC. no.: F6K5S7), antimicrobial peptide megicin-18, Mesobuthus gibbosus (AC. no.: A0A059U8Y9), antimicrobial peptide AMP2, Odontobuthus doriae (AC. no: A0A0U4LVY4), non-disulfide-bridged peptide androcin 18-1, Androctonus bicolor (AC. no.: A0A0K0LBT6), non-disulfide-bridged peptide androcin 18-4, Androctonus bicolor (AC. no.: A0A0K0LBT1), non-disulfide-bridged peptide androcin 18-2, Androctonus bicolor (AC. no.: A0A0K0LBT8). (C) Down image displys aa sequences alignment of meuPep34 with homologue peptide cellular protein AbCp-7 from Androctonus bicolor (Ac.no.: A0A0K0LC44). Conserved residues are represented in dark gray. Arginine and tryptophan are indicated with black color. Transmembrane domain is highlighted with yellow highlight. Residues with similar physicochemical properties are shown in light gray. Dash showes that there is not any residue in that position. The percentages of similarity with meuVAP-6, meuAP-18-1, and meuPep34 are brought in the right of alignment. Cystein residues are indicated with red rectangule.
Fig. 3A three-dimensional model of meuPep34
Predicted Secondary structure and some physiochemical properties of peptides described in this study
| Peptide name | Secondary structure | Molecular weight | Isoelectric pI | Hidrophobicity index | Net charge at pH 7 |
|---|---|---|---|---|---|
| meuVAP-6 | MKSQTFFLLFLVVFLLAITQSEAFIGGVVSLLKNIFGKRSL | 8014.45 | 9.61 | 0.37 | 2.0 |
| meuAP-18-1 | MQWKKQLMVIFLAYFLVVNESEAFFGSLFKLATKIIPSLF | 9289.96 | 10.42 | -0.25 | 6.0 |
| meuPep34 | MKFSLFILLIVLTYVHYSLAGGCFCYSRTGTYCGFQREHH | 11614.19 | 9.28 | -0.47 | 8.9 |
The random coil is represented by “c”, the extended strand by “e” and the helix by “h”