Human ADP-ribosyltransferase 2 (ARTD2/PARP2) is an enzyme catalyzing a post-translational modification, ADP-ribosylation. It is one of the three DNA dependent ARTDs in the 17 member enzyme family. ADP-ribosylation catalyzed by ARTD2 is involved in the regulation of multiple cellular processes such as control of chromatin remodeling, transcription and DNA repair. Here we used a combination of biochemical and biophysical methods to elucidate the structure and function of ARTD2. The solution structures revealed the binding mode of the ARTD2 monomer and dimer to oligonucleotides that mimic damaged DNA. In the complex, DNA binds between the WGR domain and the catalytic fragment. The binding mode is supported by biophysical data that indicate all domains contribute to DNA binding. Also, our study showed that ARTD2 is preferentially activated by short 5'-phosphorylated DNA oligonucleotides. We demonstrate that the N-terminus functions as a high-affinity DNA-binding module, while the WGR domain contributes to DNA binding specificity and subsequent catalytic activation. Our data further suggest that ARTD2 would function in double strand break repair as a dimeric module, while in single strand break repair it would function as a monomer.
HumanADP-ribosyltransferase 2 (ARTD2/PARP2) is an enzyme catalyzing a post-translational modification, ADP-ribosylation. It is one of the three DNA dependent ARTDs in the 17 member enzyme family. ADP-ribosylation catalyzed by ARTD2 is involved in the regulation of multiple cellular processes such as control of chromatin remodeling, transcription and DNA repair. Here we used a combination of biochemical and biophysical methods to elucidate the structure and function of ARTD2. The solution structures revealed the binding mode of the ARTD2 monomer and dimer to oligonucleotides that mimic damaged DNA. In the complex, DNA binds between the WGR domain and the catalytic fragment. The binding mode is supported by biophysical data that indicate all domains contribute to DNA binding. Also, our study showed that ARTD2 is preferentially activated by short 5'-phosphorylated DNA oligonucleotides. We demonstrate that the N-terminus functions as a high-affinity DNA-binding module, while the WGR domain contributes to DNA binding specificity and subsequent catalytic activation. Our data further suggest that ARTD2 would function in double strand break repair as a dimeric module, while in single strand break repair it would function as a monomer.
ADP-ribosylation is a post-translational modification that was first described in the early 1960s1. It is involved in the regulation of numerous cellular processes such as maintenance of genome integrity, chromatin remodeling and transcription control23456. The ARTD family in humans consist of 17 enzymes that have been further classified into poly ADP-ribosyltransferases (pARTDs) and mono ADP-ribosyltransferases (mARTDs)789. pARTDs (ARTD1,2,5,6 and potentially 3 and 4) synthesize polymers of ADP-ribose (PAR) attached to a target protein, while mARTDs (ARTD7–17) only add monomers of ADP-ribose to the target proteins. Two proteins, ARTD9 and ARTD13, are likely inactive. Within the pARTD group, the catalytic activities of ARTD1–3 have been shown to be DNA-damage dependent23456. They are activated by DNA breaks, which result in the hydrolysis of nicotinamide adenine dinucleotide (NAD+) to nicotinamide and ADP-ribose. The ADP-ribose moiety is successively attached to the acceptor proteins (ARTDs, histones and other DNA repair enzymes) or to a growing PAR chain. PAR adjacent to the DNA breaks forms a scaffold that recruits DNA repair factors561011.ARTD1 (PARP1) is the first and best characterized member of the ARTD superfamily and has been shown to play crucial roles in the maintenance of genome stability and in DNA repair3101213. The discovery of ARTD2 (PARP2) was based on the residual DNA-dependent activity observed in ARTD1 deficient mouse embryonic fibroblasts5. Similar to ARTD1, ARTD2 interacts with base excision repair (BER)/single strand base excision repair (SSBER) factors, X-ray repair cross complementing 1 (XRCC1), DNA polymerase β, and DNA ligase, which suggests a role in recruiting these factors to the site of DNA damage3141516. ARTD2 can also heterodimerize with ARTD1 leading to their activation14. In contrast to ARTD1, ARTD2 lacks the specialized DNA binding zinc fingers in the N-terminus (N), but it has a putative DNA binding motif, which has not been well characterized. It was recently demonstrated that the N-terminus was not strictly required for DNA binding or enzymatic activity17, but it was also reported that ARTD2 recognizes apurinic sites through Schiff base formation with the N-terminus18. RNA binding activity of the N-terminus has also been reported19. The N-terminus is followed by the tryptophanglycine and arginine rich domain (WGR) and the catalytic fragment (CAT) consisting of a regulatory domain (RD) and an ARTD domain (Fig. 1a).
Figure 1
Schematic illustration of DNA dependent ARTDs, ARTD2 constructs and different oligonucleotides used in this study.
(a) Domain organizations of ARTD1, ARTD2 and ARTD3. ARTD2 constructs used for this study include full length (ARTD2FL), N (ARTD2N), N+WGR (ARTD2N+WGR), WGR (ARTD2WGR), WGR+CAT (ARTD2WGR+CAT) and CAT (ARTD2CAT). (b) The oligonucleotides used for the study, which include hairpin, dumbbell shape, palindromic and single stranded DNA. The sequences of the oligonucleotides can be found in Supplementary Table S10.
In order to understand the DNA binding and activation of ARTD2, we have used biochemical and biophysical methods to characterize the full length and truncated fragments of the enzyme (Fig. 1a). Our study shows that ARTD2 is activated by various oligonucleotides and high activation of ARTD2 was observed with 10–26 base pair oligonucleotides with a 5′-phosphate. In line with the previous study17, we show that the N-terminus is not strictly required for the enzymatic activity as ARTD2WGR-CAT lacking the N-terminus is active although its affinity to DNA is lower. The presence of the N-terminus increases the affinity of all tested DNA molecules (up to 10 nM KD) whereas the affinity of constructs lacking the N-terminus was 10–40 folds lower. We also observed that ARTD2 can bind DNA non-specifically through the N-terminus and the binding of ARTD2 to DNA alone is not the switch controlling catalytic activation. We used small-angle X-ray scattering (SAXS) to study solution structures of ARTD2 bound to nicked oligonucleotide mimicking a single stand break (SSB) and to blunt end oligonucleotide mimicking a double strand break (DSB). Biochemical characterization combined with solution structures revealed that the WGR domain is essential for the activation of the enzyme and that the mode of ARTD2 DNA binding and activity could be DNA damage specific.
Results
Protein production
ARTD2 can be divided into three different structural parts: the N-terminus, WGR domain and the catalytic fragment. In order to study the roles of the different parts, we cloned, expressed and purified the full length ARTD2 and the truncated fragments (Fig. 1a and Supplementary Fig. S1). Protein constructs were all expressed in E. coli and amounts sufficient for structural and functional studies (4–10 mg/L) were purified. Notably, the DNA contamination of the N-terminal and/or WGR containing protein constructs was removed by heparin affinity chromatography.
DNA dependent catalytic activity
Recent reports have indicated that ARTD2 is activated by specific DNA fragments1416171920. It was reported that ARTD2 is selectively activated by 5′-phosphorylated DNA17 while other studies have shown that ARTD2 is activated by 5′-overhang DNA and RNA1619. We screened different DNA oligonucleotides at a 1:10 protein:DNA ratio using a fluorescence-based activity assay that measures the decrease in the concentration of the substrate NAD+ in the reaction. We observed that ARTD2FL is activated by DNase I treated calf thymus DNA and various oligonucleotides (Figs 1b and 2a). ARTD2 was activated by a 38 base long nicked DNA model with a 5′-phosphate (oligonucleotide 2), but not by a similar 48 base long DNA model (oligonucleotide 4). For the blunt ended dumbbell DNA, a 5′-phosphate was required for efficient activation (oligonucleotides 5 and 6). Similarly the 5′-phosphate was preferred for a 5′-overhang (oligonucleotides 10 and 11). The most activating DNA model was a short double stranded DNA with a 5′-phosphate (oligonucleotide 14). Interestingly, an increase in the DNA length decreased the activation of ARTD2 (oligonucleotide 14 vs. 18). Single stranded DNA also activated ARTD2 (oligonucleotide 32–35). Notably, an ARTD inhibitor, 1 μM olaparib, completely inhibited the purified recombinant protein (Supplementary Fig. S2).
Figure 2
DNA dependent activation of ARTD2.
(a) Quantification of ARTD2FL catalytic activity with different oligonucleotides at a 10:1 DNA:Protein ratio (500 nM:50 nM, 60 min) in comparison with activated DNA. (b) Quantification of the effect of DNA:protein ratio on the activity of ARTD2. DNA concentration was titrated from 0.125 nM to 1 μM using a constant protein concentration of 50 nM. (c) Activation of ARTD2FL at a 1:1 protein:DNA ratio without salt (50 nM, 10 min). (d) Activation of ARTD2FL at a 1:1 protein:DNA ratio with 150 mM NaCl (100 nM, 30 min). (e) Comparison of the DNA dependent activation of the full length enzyme (ARTD2FL) against the truncated fragment lacking the N terminus (ARTD2WGR+CAT) using 10 nM protein and 10 nM DNA. (f) Comparison of the DNA dependent activation of the full length enzyme (ARTD2FL) against the truncated fragment lacking the N terminus (ARTD2WGR+CAT) using 1 μM protein and 1 μM DNA. Data shown are mean and standard deviation of the experiment carried out in quadruplicate.
Our initial experiments showed that the KD of ARTD2 to DNA would be in the range of 20 nM–50 nM and we expected that saturation of ARTD2 with DNA would result in higher activity. However, when we titrated DNA (12.5 nM–1 μM) against the protein (50 nM ARTD2FL) we observed that the highest activity was achieved at a 1:1 or 2:1 ratio of ARTD2 protein to DNA depending on the oligonucleotide (Fig. 2b). Oversaturation of ARTD2 with DNA resulted in a decreased NAD+ hydrolysis in all cases. This suggests that automodification would require dimerization of the enzyme at the DNA damage site. Increase in DNA concentration or increase in the possible binding sites at the DNA could result in a non-catalytic 1:1 protein:DNA complexes that would lower the activity. Based on this hypothesis, we rescreened the activation of ARTD2 by the oligonucleotides at a 1:1 Protein-to-DNA ratio and included more oligonucleotides (oligonucleotides 19–31) (Figs 1b and 2c). Increasing salt concentration decreases ARTD2 activity, but we carried out the experiment also in the presence of 150 mM salt using higher protein concentration (50 nM vs. 100 nM) and a longer incubation time (10 min vs. 30 min) (Fig. 2d). Highest activity was achieved with dumbbell DNA molecules (oligonucleotides 6, 10 and 11), double stranded blunt ended DNA molecules (oligonucleotides 14, 16, 18, 20, 22) and single stranded DNA molecules with 5′-phosphates (oligonucleotides 27 and 29) (Fig. 2c,d). A nick DNA model (oligonucleotide 2) was not among the top activating oligonucleotides (Fig. 2c) although its relative activation was comparable in the higher salt conditions (Fig. 2d). Oligonucleotide 8 with a 3′-phosphate did not activate the enzyme in either condition. These results demonstrated that not only is ARTD2 selectively activated by various 5′-phosphorylated DNAs but also the length of the DNA has a significant effect on the activity in vitro. In both cases the results showed clearly that ARTD2 activation is strongly dependent on the DNA length (Fig. 2c,d) as an increase in the DNA length resulted in decreased ARTD2 catalytic activity.
Contribution of the N-terminus to the catalytic function
In order to provide an explanation for the role of the N-terminus in the catalytic activity of ARTD2, we compared the rate of activation of ARTD2FL with ARTD2WGR+CAT using the most activating DNA (oligonucleotide 14). We observed that the rate of activation of ARTD2FL is significantly higher than that of ARTD2WGR+CAT (Fig. 2e). In this low DNA and protein concentration (10 nM), this difference could be the result of lower DNA binding affinity of ARTD2WGR+CAT. Therefore the rate of activation at 1 μM protein and DNA concentrations was measured and it was observed that the N-terminus is not required for the catalytic activation of ARTD2 at high protein and DNA concentrations (Fig. 2f).
DNA binding properties of ARTD2
The binding affinity of ARTD2 (full length and the different domains) to selected DNA molecules was studied using a fluorescence polarization assay (FP). The affinity of ARTD2FL towards activating and fluorescence labeled oligonucleotides was between 10 and 63 nM (Fig. 3a). The affinity of the construct lacking the N-terminus was significantly lower with a KD up to 4 μM (Fig. 3b). Oligonucleotide 14 had the highest activating property in the assays and the binding affinity of ARTD2WGR+CAT to the corresponding fluorescently tagged oligonucleotide (oligonucleotide 36) was the highest (170 nM) of the oligonucleotides tested. Notably, with ARTD2FL the binding affinity is independent of the presence of 5′-phosphorylation. This was observed with oligonucleotides 39 and 40, which had similar affinities for the enzyme. ARTD2N and ARTD2N+WGR had affinities in the same range as ARTD2FL (Fig. 3c,d), whereas ARTD2WGR had a KD in the micromolar range to the activating single and double stranded oligonucleotides (Fig. 3e). It appears that while the N-terminus functions as a non-specific, high-affinity DNA-binding module, the WGR domain is a low-affinity, selective DNA-binder.
Figure 3
Fluorescence polarization assay showing the binding affinity of ARTD2 domains to different oligonucleotides.
The oligonucleotides used are 36, 37, 38 39, 40, 41 and 42 (Fig. 1b). (a–e) Affinities of ARTD2FL, ARTD2WGR+CAT, ARTD2N, ARTD2N+WGR and ARTD2WGR to the oligonucleotides. (f) Stoichiometry analysis of ARTD2FL binding to oligonucleotides 36, 38, 41 and 42. The saturation point was considered as the stoichiometric ratio. Data shown are mean and standard deviation of the experiment carried out in triplicate.
We also studied the binding of ARTD2 to the activating and non-activating oligonucleotides using EMSA (Fig. 4a,b). We observed that ARTD2FL upon binding to the 5′-phosphorylated oligonucleotide resulted in a clear supershift while nonphosphorylated oligonucleotides did not show a clear supershift (Fig. 4a). As an example, nonphosphorylated oligonucleotides 1, 5, 13, 17 and 19 did not bind efficiently to ARTD2, whereas similar phosphorylated oligonucleotides 2, 6, 14, 18 and 20 resulted in a supershift that indicated binding. The binding of ARTD2FL in comparison with the truncated ARTD2 constructs was also studied using oligonucleotides 6 and 14. As expected, ARTDFL caused a supershift on the gel and ARTD2CAT did not seem to bind DNA (Fig. 4b). Binding of the ARTD2WGR+CAT to the oligonucleotides resulted in the same super shift on the gel as with the full-length enzyme. ARTD2N did not cause a supershift despite the high affinity measured in FP, but the ARTDWGR domain caused a smear on the gel with oligonucleotide 14 that indicated binding. Interestingly, ARTD2N+WGR caused even more delay in the DNA on the gel. The results indicate that the N-terminus has a high affinity for DNA, but the off rate is likely also high explaining why there is no observable supershift in EMSA. The KD of the WGR domain to DNA is lower, but the binding is more specific and the off rate is lower, which contributes to the observable supershift with ARTD2WGR (Fig. 4b). Notably, a 5′-phosphate is required for the specific binding with the WGR domain. The catalytic fragment also clearly affects the DNA binding indirectly through the other domains as ARTD2WGR+CAT and ARTD2FL cause a supershift, whereas ARTD2N+WGR only causes a slight delay of DNA on the gel (Fig. 4b).
Figure 4
EMSA assay of ARTD2 domains showing the binding and stoichiometry to different oligonucleotides.
(a) The binding of ARTD2FL (1 μM) to different DNA oligonucleotides (1 μM). A supershift was observed with the 5′-phosphorylated DNA oligonucleotides. (b) Binding of ARTD2FL and the truncated fragments to oligonucleotides 6 and 14. (c) Stoichiometry analysis of ARTD2FL binding to oligonucleotide 2 (equivalent of oligonucleotide 41), oligonucleotide 6 (equivalent of oligonucleotide 42), oligonucleotide 14 (equivalent of oligonucleotide 36) and oligonucleotide 18 (equivalent of oligonucleotide 38). The protein:DNA ratio used was 0–8 and DNA was kept constant at 1 μM.
ARTD2 binds to DNA with varying stoichiometries
We studied the stoichiometry of the DNA oligonucleotide ARTD2FL complexes using an FP assay where a DNA concentration (250 nM) well above the KD was used and titrated with protein. Double stranded palindromic 5′-phosphate (oligonucleotides 36 and 38), dumbbell blunt end 5′-phosphate (oligonucleotide 42) and nicked 5′-phosphate DNAs (oligonucleotide 41) were used. ARTD2 was observed to bind to oligonucleotide 42 as a monomer and to oligonucleotide 36 as a dimer (Fig. 3f). With oligonucleotides 38 and 41, different stoichiometries were observed (ranging from 1:1 to 4:1 protein-to-DNA).Furthermore, we titrated the protein concentration from 0.25–8 μM against 1 μM DNA and analyzed the samples using an electrophoretic mobility shift assay (EMSA). In the EMSA assay there was a continuous increase in the band shift with increasing protein concentration. With oligonucleotides 6 and 14 (the equivalent of fluorescein tagged oligonucleotides 42 and 36) there was no free oligonucleotide at a stoichiometric ratio higher than 2:1 protein to DNA ratio (Fig. 4c). In contrast, with oligonucleotide 18 (equivalent of fluorescein tagged oligonucleotide 38) there was no free oligonucleotide only after a 4:1 protein-to-DNA ratio. With oligonucleotide 2 (equivalent of fluorescein tagged oligonucleotide 41) there was still some free oligonucleotide even at a protein-to-DNA ratio of 4:1 (Fig. 4c).
Solution structures of ARTD2
The structure of the humanARTD2 catalytic domain (ARTD2CAT) in complex with inhibitors has been solved using X-ray crystallography2122. At the moment, there is no high-resolution structure of the other domains or the full-length enzyme. Here we have used SAXS to provide a low-resolution structure of the full-length enzyme and the truncated fragments. The scattering curves and Guinier plots for all the proteins were generated after subtraction of the buffer contribution (Fig. 5a–f and Supplementary Fig. S3). From the Kratky plot analysis of the individual domains, we observed that ARTD2N exhibits behavior typical of a disordered molecule while the other domains, especially ARTD2CAT and ARTD2WGR, exhibit behavior typical of a globular molecule with one distinct peak (Fig. 5g). From the processed scattering intensity, the radius of gyration (Rg), molecular weight (MW), maximum dimension (Dmax), and volume (porod volume) were derived (Tables 1 and 2). With the exception of ARTD2N+WGR, the experimental MWs of all the fragments are in good correlation with the calculated monomeric MWs. The experimental MW of the ARTD2N+WGR (47.7 kDa) indicates that it forms a dimer in solution. This correlates with the retention volume (56 mL) observed during size exclusion purification, when compared with e.g. monomeric CAT fragment with MW of 39.8 kDa (retention volume 61 mL). The Dmax and Rg of the ARTD2N are higher than expected, which agrees with the fact that it is highly disordered (Tables 1 and 2, Fig. 5a). The pair distribution function [P(r)] curve of ARTD2FL and ARTD2WGR+CAT has a dumbbell shape containing more than one maximum, which is typical for molecules with individual domains connected by flexible linkers (Fig. 5h). This supports the structural organization of ARTD2FL having two domains (CAT and WGR), whereas the N-terminus does not form a folded domain. The P(r) plot for ARTD2N+WGR shows a similar dumbbell shape, which is due to the dimeric form of the construct. The P(r) functions of ARTD2N, ARTD2WGR and ARTD2CAT are characterized with a single maximum indicating that they consist of one structural domain (Fig. 5h). The experimental SAXS data from the CAT domain match the scattering intensity of the crystal structure with chi2 of 1.26 (Supplementary Fig. S4). From the SAXS data we generated ab initio models of each of the proteins (Supplementary Fig. S5). These molecular shapes agree with above analysis of the P(r) functions.
Figure 5
Characterization of ARTD2FL and the truncated fragments using small-angle X-ray scattering.
(a–f) SAXS data plots as well as the Guinier plots of ARTD2N, ARTD2WGR, ARTD2CAT, ARTD2N+WGR, ARTD2WGR+CAT, and ARTD2FL, respectively. The zoom in view of the Guinier region is provided in Supplementary Fig. S3. (g) The normalized Krakty plot analysis of ARTD2FL and the truncated fragments. (h) The P(r) distribution profile of ARTD2FL and the truncated fragments. (i) Secondary structure analysis of ARTD2FL, ARTD2N and ARTD2WGR+CAT with CD.
Table 1
SAXS data analysis of the ARTD2, the truncated fragments, protein-DNA complexes and the oligonucleotides.
Samples
Rg (gnom) (Å)
Rg (guinier) (Å)
maxqRg
I(0)
Data points used
ARTD2FL + OLIGO 2
41.86
41.52
1.19
111.40
9–50
ARTD2 + OLIGO 6
54.70
56.31
1.20
167.57
3–37
ARTD2FL
45.20
45.10
1.13
27.02
14–43
ARTD2WGR+CAT
40.71
40.70
1.15
42.91
8–48
ARTD2N+WGR
42.18
40.70
1.21
35.87
4–51
ARTD2WGR
20.30
20.20
1.05
15.48
4–113
ARTD2CAT
21.83
21.80
1.05
26.57
5–83
ARTD2N
28.10
28.10
1.07
8.75
5–70
Oligonucleotide 2
22.30
22.21
1.2
25.91
24–92
Oligonucleotide 6
14.93
14.71
1.09
13.96
16–140
Table 2
SAXS model parameters.
Samples
MW based on seq (KDa)
MW based porod volume (KDa)
Dmax (Å)
Porod volume (Å3)
NDS values (dammif)
NDS Values (MONSA)
chi2 (bunch)
ARTD2FL + OLIGO 2
77.9
84.8
145.4
144084
—
0.56 ± 0.02
—
ARTD2 + OLIGO 6
138.8
182.9
187
311013
—
0.64 ± 0.03
—
ARTD2FL
66.3
72.1
159.2
103423
0.67 ± 0.03
—
2.14 ± 0.076
ARTD2WGR+CAT
58.7
57.4
142.5
97592
0.64 ± 0.04
—
—
ARTD2N+WGR
24.9
47.7
142.3
81153
0.69 ± 0.03
—
—
ARTD2WGR
17.4
17.1
71.2
29027
0.55 ± 0.02
—
—
ARTD2CAT
39.8
34.8
76.0
59190
0.60 ± 0.02
—
—
ARTD2N
7.8
9.3
98.0
15725
0.91 ± 0.06
—
—
Oligonucleotide 2
12.0
9.9
77.1
16969
0.61 ± 0.02
—
—
Oligonucleotide 6
6.0
5.7
51.5
9606
0.59 ± 0.03
—
—
*ARTD2N+WGR is a dimeric protein. The monomeric form is 24.9 KDa and the data in the table represent the dimeric form of the protein.
**The scattering curve, Guinier plots and P(r) in the Supplementary Figs S3 and S9.
MW based porod volume were obtained by dividing the Porod volume estimated by AUTOPOROD by 1.7. Notably the porod volumes were obtained AUTOPOROD and the values obtained were divided by 1.7. 1.7 was taken to be a maximal ratio between the porod volume and the molecular weight41.
The SAXS study indicated that the N-terminus is structurally disordered. To provide further evidence, we measured circular dichroism spectra of the protein and compared it with spectra of ARTD2FL and ARTD2WGR+CAT. As expected, the CD spectrum of ARTD2N is characterized with a single minimum at a wavelength of around 200 nm, whereas with ARTD2FL and ARTDWGR+CAT the spectra represent typical folded molecules with secondary structures (Fig. 5i). The single minimum of ARTD2N at 200 nm showed that the N-terminus of ARTD2 is structurally disordered and is completely in agreement with a previous report20.
Solution structures of ARTD2-DNA complexes
We have shown that ARTD2 is preferentially activated by 10–26 base pair oligonucleotides with a 5′-phosphate (Fig. 2c,d). From the FP analysis we have shown that ARTD2 binds to the different activating oligonucleotides as a monomer, dimer and other higher oligomeric states depending on the DNA structure (Fig. 3f). Prior to the SAXS studies, HPLC analysis of ARTD2FL and ARTD2WGR+CAT in complex with oligonucleotides 2, 6 or 14 (FP equivalents 41, 42 and 36 respectively) showed that upon DNA binding ARTD2 adopts different oligomeric states like in the FP stoichiometry analysis (Fig. 3f and Supplementary Fig. S6). Notably, with oligonucleotide 2, there were different oligomeric states and the major peak was the 1:1 protein DNA complex (Supplementary Fig. S6). With oligonucleotides 6 and 14, the major peak was the 2:1 protein DNA complexes (Supplementary Fig. S6).Based on the observed property of ARTD2 to form different oligomeric states upon DNA binding, it was necessary to collect the SAXS data of the DNA complexes using an on-line HPLC system. SAXS data were measured for oligonucleotides 2 and 6. In agreement with the HPLC studies prior to the SAXS studies, there were different oligomeric states based on the different chromatograms (Supplementary Fig. S6). With oligonucleotide 2 (nicked DNA) the major monomeric complex and with oligonucleotide 6 (short double stranded dumbbell DNA) the major dimeric complex were used for the subsequent data analysis. Also the Rg profiles across the targeted peaks show that they are highly monodispersed (Supplementary Fig. S6). The data of the higher oligomeric complexes could not be processed due to high polydispersity and low scattering intensity (Supplementary Fig. S6). The scattering curves and Guinier plots after subtraction of the background signals are shown in Fig. 6a–c and Supplementary Fig. S3. From the Kratky plots, the apo protein as well as the complexes show curves typical for globular molecules (Fig. 6d). The Kratky plots indicate that upon DNA binding ARTD2 assumes a more compact structure. In agreement with the Krakty plots, the P(r) analysis clearly shows that upon binding to DNA, ARTD2 assumes a compact structure without double maxima as was observed in the absence of DNA (Figs 5h and 6e). With oligonucleotide 2, the Dmax and Rg were smaller in comparison to ARTDFL, which also indicates a more compact structure (Tables 1 and 2). With oligonucleotide 6, the Dmax and Rg were observed to be higher than those of the apo enzyme as well as its complex with oligonucleotide 2, which indicates dimerization of the enzyme.
Figure 6
Characterization of ARTD2FL and its DNA complexes using small angle X-ray scattering.
(a–c) SAXS data plots as well as the Guinier plots of ARTD2FL, ARTD2 in complex with Oligonucleotide 2 and 6, respectively. (d) Kratky plot analysis of ARTD2FL and its complex with oligonucleotides 2 and 6. (e) P(r) distribution profile of ARTD2FL and its complex with DNA oligonucleotides 2 and 6. (f) The Ab initio model of ARTD2FL was reconstructed using DAMMIF and shown is the averaged filtered shape from DAMFILT (f,g) ARTD2-DNA complexes (nicked and blunt end oligonucleotide 2 and 6, respectively) were reconstituted using MONSA and shown is the averaged filtered shape from DAMFILT.
The average filtered ab initio models generated with MONSA23 show the overall structures of the ARTDFL with and without the oligonucleotides (Fig. 6f–h). In the 1:1 complex with the nicked oligonucleotide, ARTD2 interacts with the DNA through a middle part corresponding to a WGR domain (Fig. 6g), where the assignment of the domains in the DNA complexes is based on rigid body modelling done on the apo enzyme (Supplementary Fig. S4). In case of a blunt end dumbbell, the ARTD2 forms a dimer around the oligonucleotide (Fig. 6h). In the model it appears that the catalytic domains are facing in opposite directions and the interaction with the DNA would not be identical for both monomers. The ab initio models give information on the average structures in solution. Considering that oligonucleotide 6 is one of the most activating DNAs, we expect that this may be an ideal binding mode in solution allowing one protein to ADP-ribosylate the other. It also provides an explanation to why we observed higher activity with short blunt end DNA molecules than with the nicked DNA molecules.
Discussion
The role of ARTD2 in base excision repair/single strand base excision repair (BER/SSBER) and homologous recombination has been a subject of discussion. The importance of ARTD2 in BER/SSBER and double strand breaks is based on its interaction with the main DNA repair factors, a function similar to that reported for ARTD131424252627. Despite the recent data on ARTD2 DNA binding and activation1720, is still not clear how the enzyme is activated by many different forms of DNA. We studied activation, affinity, stoichiometry, oligomerization and solution structures of the enzyme upon binding to different DNA molecules to gain insight into the specificity of the DNA damage recognition mechanism of ARTD2. SAXS structures provide the first experimental views of ARTD2-DNA complexes.Our results show that ARTD2 is robustly activated when the DNA is phosphorylated at the 5′-end, which is in agreement with the previous reports1720. Interestingly the oligonucleotide identified by Langelier et al. as the most activating DNA model was a very weak activator of ARTD2 in our assays (oligonucleotide 4, Fig. 2a,c,d). This could result from the use of slightly different experimental conditions and assays. It could also depend for example on the isoform used in the studies. Langelier et al. used ARTD2 isoform 2 (NP_001036083), which is a shorter isoform of the enzyme, whereas we used the canonical ARTD2 isoform (NP_005475). Isoform 2 lacks 13 internal amino acid residues (G68-S80) (Supplementary Fig. S7). In contrast to the earlier report, we also removed the N-terminal histidine-tag from the recombinant enzyme. Despite the differences, ARTD2 was consistently more activated by the oligonucleotides containing 5′-phosphate also in our assays (Fig. 2a,c). The activation of ARTD2 by single stranded RNA with 5′-phosphate is comparable to the activation by single stranded DNA (Supplementary Fig. S8). Importantly, the presence of 5′-phosphate on the short DNA molecules results in robust catalytic activation, whereas we did not observe activation of ARTD2 by the PAR chains (Supplementary Fig. S8).In our study, we discovered that the length of the oligonucleotide and increase in oligonucleotide concentration had negative effects on the activation of ARTD2. With 10–18 base pair DNA ARTD2 was observed to have the highest activity at a ratio of 1:1 and 2:1 protein:DNA complex, while with 26–33 base pair DNA, the highest activity was at a ratio of 2:1 and 4:1 protein:DNA complex (Fig. 2b). Also oligonucleotides of more than 50 base pairs were observed to have a negative effect on the activation of ARTD2 (Fig. 2c,d). Based on this, we hypothesize that in the presence of excessive DNA damage, more ARTD2 binds to the lesion site as monomers, which are not capable of robust automodification. In the shorter double stranded oligonucleotide, there is effectively only one possible binding site similar to a dumbbell oligonucleotide, which increases the protein:DNA damage site ratio. The nicked DNA would be expected to activate the enzyme similar to the short oligonucleotides but that was not observed as the activity with the nicked DNA was lower (Fig. 2a,c). The mechanism employed by the enzyme could be different in this case and binding to the nick could help hetero-oligomerization with different protein targets. Therefore, with an exposed DNA end, a dimer of ARTD2 is efficiently formed and automodification is efficient at least in vitro. We observed that high salt concentration lowers the activity of ARTD2 roughly 6-fold as similar NAD+ conversion required more protein and longer incubation time. This effect could be related to disruption of protein-protein interaction needed at the DNA blunt ends. At the high salt conditions, although the overall activity is lower, activation by phosphorylated nick and double stranded DNA were comparable (Fig. 2d). Monomer dimer equilibrium could provide a possible mechanism for ARTD2 to regulate various DNA repair pathways, although the possible binding partners and environment at the chromosome will differ from the in vitro enzymatic assays carried out in this study.Notably, the affinity of ARTD2 towards the oligonucleotides was independent of whether they are activating or not (Figs 2 and 3). The affinity of the full-length enzyme in comparison to ARTD2N and ARTD2N+WGR was observed to be within the same range (Fig. 3), highlighting the roles of the N-terminus and WGR domain as the main DNA binding modules. The N-terminus interacts with DNA and contributes to the high binding affinity of the enzyme to the oligonucleotide. The WGR domain contributes to the DNA binding of the enzyme as well as to the catalytic activation and may be an essential factor for the recognition of the 5′-phosphate on the oligonucleotides. Also the catalytic fragment is important in the binding of the enzyme to the activating DNA molecules (Figs 3b,e and 4b). Interestingly, the N-terminus is not required for the catalytic activity in high protein-DNA concentrations, but appears to be necessary when concentrations are low (Fig. 2e,f).We also show that the N-terminus of ARTD2 is highly disordered (Fig. 5g,i) and this is inline with a previous report20. The high affinity of the N-terminus observed in FP experiments (Fig. 3) could enable ARTD2 to scan the DNA whereas the WGR domain would act as the damage detection module as it forms a stable complex with the DNA in EMSA (Fig. 4b). It may not only be the WGR domain that contributes to the damage site detection, but also the catalytic fragment could contribute to the DNA binding (Fig. 4b). SAXS models show that the main interface interacting with the DNA is in the middle of the protein, which would be the region between the WGR domain and the catalytic fragment (Fig. 6g,h). It would suggest that when ARTD2 recognizes a DNA damage site, a structural change in the complex would relocate the N-terminus from the DNA break. The contribution of the catalytic fragment to the DNA binding is evident in the FP and the EMSA experiments and it can be visualized with the experimental low-resolution model (Figs 3b,e, 4b and 6g).Solution structures show that ARTD2 can bind DNA as a monomer and as a dimer. To SSB ARTD2 binds preferentially as a monomer, while to DSB it binds mostly as a dimer. In case of a dimer DNA in the SAXS envelope (Fig. 6h) does not bind symmetrically to both ARTD2 monomers and this indicates that only one ARTD2 interacts productively with the DNA resulting in activation and consequent trans-automodification as reported with ARTD128. Similar to the 1:1 complex, DNA would bind close to the catalytic part possibly contributing to the increased stability of the complex observed in EMSA (Figs 4b and 6h). N-terminal lysines (36 and 37) have been identified as ADP-ribosylation sites in ARTD229 and in agreement with this the N-terminal region is located close to the catalytic site of an adjacent ARTD2 in the SAXS model. It has been reported that WGR+CAT domains of ARTD1-3 tightly cooperate with their corresponding N-terminal region30. Other modification sites within the WGR and catalytic domains of ARTD2 have also been identified31. The most striking feature of the solution structure is how ARTD2 preferentially binds to nicked DNA (mimicking single strand DNA break) as a monomer and to blunt end DNA (mimicking double strand DNA break) as a dimer. Notably the binding mode of ARTD2 to DNA may differ from that of ARTD1, which detects the DNA damage through multiple zinc fingers32 which are not present in ARTD2.Collectively, the N-terminal region of ARTD2 is highly disordered and has the ability to interact non-specifically with DNA. The WGR domain is an important DNA damage recognition site and is essential for the DNA dependent activity of ARTD2. ARTD2 is preferentially activated by short 5′-phosphoryated oligonucleotides and the structure and length of the DNA is very important for the robust activation of the enzyme in vitro. The binding ratio of ARTD2 to nicked DNA (mimicking single strand DNA break) is mostly one protein to one DNA while to blunt end DNA (mimicking double strand DNA break) two protein to one DNA. This study highlights the different binding modes employed by ARTD2, which could enable it to function in multiple DNA repair pathways.
Materials and Methods
Cloning
The codon optimized (E. coli) cDNA of the human full length ARTD2 isoform 1 (NP_005475) was purchased from Genescript. Full-length ARTD2 as well as ARTD2N+WGR and ARTD2N were cloned by PCR extension cloning into a pNH-trxt vector containing an N-terminal 6xHis-tag, a thioredoxin fusion protein and a TEV-protease cleavage site (marked with *) (MHHHHHHSSGMSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYG IRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGTENLYF*QS). ARTD2CAT was cloned into pNIC28-BSA4 (MHHHHHHSSGVDLGTENLYFQ*SM) while the other constructs (ARTD2WGR+CAT and ARTD2WGR,) were cloned into a pNIC-ZB vector (MHHHHHHSSGVDNKFNKERRRARREIRHLPNLNREQRRAFIRSLRDDPSQSANLLAEAKKLNDAQPKGTENLYF*QS). The full-length ARTD2 construct was used as a template in cloning of the truncated fragments.
Protein expression and purification
The expression vectors containing the individual genes were transformed into E. coliBL21 (DE3) competent cells. An overnight pre-culture supplemented with 50 μg/mL kanamycin was grown in LB broth medium at 37 °C. The pre-culture was used to inoculate terrific broth auto-induction media (Formedium) supplemented with 0.8% glycerol (w/v) and 50 μg/mL kanamycin. Notably in the expression of ARTD2FL and ARTD2WGR+CAT the expression media was supplemented with 10 mM benzamide, a general small ARTD inhibitor33, to overcome the toxic effect of the constructs on E. coli. The culture was incubated at 37 °C with shaking until the OD600 reached 1.2. The temperature was lowered to 18 °C and the incubation was continued for 22 hours. The cells were collected by centrifugation (4000 × g, at 4 °C for 30 minutes) and the cell pellet was suspended in 1.5 mL/g lysis buffer [50 mM Hepes (4-(2-hydroxyethyl)-1-piperazineethanesulfate), 500 mM NaCl, 10% glycerol, 10 mM imidazole, 0.5 mM TCEP (tris(2-carboxyethyl)phosphine), pH 7.5] and stored at −20 °C. The cell suspension was thawed at room temperature and supplemented with 0.1 mM Pefabloc (4-(2-Aminoethyl) benzenesulfonyl fluoride hydrochloride from Sigma-Aldrich). The cells were lysed by sonication and the cell debris cleared by centrifugation (30000 × g at 4 °C for 45 minutes). The supernatant was loaded onto 2 mL of IMAC resin (Qiagen). The column was washed with 30 mL of wash buffer 1 (50 mM Hepes, 500 mM NaCl, 10% glycerol, 10 mM imidazole, 0.5 mM TCEP, pH 7.5), followed by 30 mL wash buffer 2 (20 mM Hepes, 500 mM NaCl, 10% glycerol, 25 mM imidazole, 0.5 mM TCEP, pH 7.5). ARTD2 was eluted with 15 mL of elution buffer (50 mM Hepes, 250 mM NaCl, 10% glycerol, 200 mM imidazole, 0.5 mM TCEP, pH 7.5). The constructs containing the N-terminus or the WGR domain were purified by heparin chromatography with a gradient from 300 mM NaCl to 1500 mM NaCl. The fusion tags were cleaved with TEV-protease (1:30 TEV:ARTD2 molar ratio) at 4 °C for 24 hours. The protein was then loaded onto 1 mL HisTrap (GE Healthcare) and the flow through containing the cleaved proteins was collected, concentrated and further purified using Superdex 200 (for ARTD2FL, ARTD2WGT+CAT and ARTD2CAT) and Superdex 75 (for ARTD2N, ARTD2WGR and ARTD2N+WGR) (50 mM Hepes, 300 mM NaCl, 10% glycerol, 0.5 mM TCEP, pH 7.5). The purified protein was pooled, concentrated, flash frozen and stored in −70 °C.
Activity assays
Assays were conducted as reported earlier343536. The reactions were carried out in 96-well plates (Greiner BioOne U-shaped) at room temperature in 50 mM Tris-HCl pH 8.0, 10 μg/mL activated DNA (with the oligonucleotides at 0.5, 0.05, or 0.01 μM), 5 μM NAD+, 0.1 mg/ml BSA, 5 mM MgCl2 supplemented with 150 nM NaCl when mentioned. In most cases, the DNA and protein concentrations were varied to enable effective quantification of activation. At the completion of the reaction, 20 μL of 20% acetophenone in ethanol and 20 μL of 2 M KOH were added. The plate was incubated for 10 minutes and then 90 μL of formic acid was added. The fluorescence was read after 20 minutes of incubation using a Tecan Infinity M1000 at the excitation and emission wavelengths of 372 nm and 444 nm, respectively.The fluorescence assay measures the consumption of NAD+ and we found that it correlates well with the analysis of the generated PAR chains with western blot method (Supplementary Fig. S2). ARTD2FL (100 nM) was incubated with 100 nM Oligonucleotides 1, 2, 5, 6, 13, and 14 for 10 minutes at RT in the reaction buffer (50 mM Tris pH 8.0, 10 mM NAD+, and 10 mM MgCl2). Reactions were stopped by the addition of SDS-PAGE loading buffer, incubated at 95 °C for 5 minutes. The samples were resolved on 4–20% gradient gel (Bio-Rad) and blotted onto Nitrocellulose membrane (Bio-Rad). Blots were incubated with anti-PAR antibody (Trevigen) and then HRP conjugated mouse anti-goat antibody. PAR chains were visualized with an ECL plus reagent (Advansta).
DNA binding assays
The DNA substrates were prepared by annealing the oligonucleotides (Fig. 1b; Supplementary Table S10) purchased from Integrated DNA Technologies in 10 mM Tris-HCl pH 8.0, 0.1 mM EDTA and 100 mM NaCl as described37. In the electrophoretic mobility shift assay (EMSA) the proteins were incubated with 1 μM oligonucleotides in a binding buffer (50 mM Hepes, 0.1 mM EDTA, 300 mM NaCl, 10% glycerol (V/V), 0.1 mM TCEP) for 30 minutes in an ice bath. The mixtures were resolved on 0.5% agarose gels in 0.5X Tris/Borate/EDTA buffer at +4 °C degrees, 80 volts for 80 minutes. The gels were stained using GelRed (Biotium) and visualized using a gel imaging system (Bio-Rad).The fluorescence polarization assay (FP) was done in black 96-well U-bottom propylene plates (Greiner BioOne). Notably, the concentration of the protein samples were quantified prior to the measurements using calculated extinction coefficients and absorbance at 280 nm. The DNA amount was determined by the supplier (Integrated DNA Technologies) and the measured absorbance at 260 nm was found to agree with the calculated concentration. The reaction was carried out in 10 mM Hepes pH 8.0, 0.1 mM TCEP, 0.1 mM EDTA, 150 mM NaCl and 10% glycerol. DNA oligonucleotides 36–42 (Fig. 1b) were used. Specifically, 5 nM DNA was used and the protein concentration was titrated from 0–4 μM for ARTD2FL, and from 0–8 μM for the other constructs (Fig. 1a). The plates were incubated at 25 °C with shaking (300 rpm) in a PST-60 HL Plus shaker (Biosan) for 60 minutes. The fluorescence polarization was measured using a Tecan Infinite M1000 at the excitation and emission wavelengths of 475 and 520 nM, respectively. The experiment was done in triplicate and the measurements were fitted using Graphpad Prism version 5.04 for windows (GraphPad Software). Stoichiometry of ARTD2FL DNA binding was measured with FP as described by Updegrove et al.38. We used DNA concentrations of 250 nM, which is significantly higher than the measured KD. The protein was titrated from 0–4 μM.
Analytical HPLC for ARTD2 and DNA complexes
Analytical HPLC was done for ARTD2FL and ARTD2WGR+CAT in order to evaluate the complexes formed upon mixing ARTD2 and different oligonucleotides. The complexes were reconstituted at a ratio of 1:1 (Protein:DNA) at a concentration of 15 μM, and the samples (100 μL) were analyzed using a Superdex 200 10/300 GL column (20 mM Hepes pH 7.5, 300 mM NaCl, 5% glycerol). Using the elution volume of the apo enzymes and a comparison of a test separation of standard proteins in the column, the size of the complexes were estimated.
Small-angle X-ray scattering studies
For the SAXS measurement of ARTD2FL with DNA oligonucleotides 2 and 6, the protein-DNA-complex was reconstituted at a ratio of 1:1 and dialyzed into HPLC buffer (20 mM Hepes pH 7.5, 300 mM NaCl, 5% glycerol). The samples were run at a flow rate of 0.25 mL/min through a KW403-4F HPLC column (Shodex) connected to the online SAXS system on the BM29 beamline at ESRF (Grenoble, France). 100 μL of the samples were injected to the column and peaks in the scattering intensities for all frames were identified. Matching frames from individual peak were averaged. With the oligonucleotide 2 and 6, matching frames of the major peak corresponding to the 1:1 and 2:1 (protein:DNA) respectively were averaged. The scattering intensity corresponding to the complexes were processed using PRIMUS39. Distance distribution functions (Pr) and maximum distances (Dmax) were determined with GNOM40, and Porod volumes were determined with DATPOROD41. The ab initio model of the DNA complex was created with MONSA using data collected from the DNA, the protein and the complex23. Ten independent MONSA models without symmetry constraints were generated and 8 consistent models based on the NSD values were averaged using DAMAVER42.For the truncated fragments and the DNA oligonucleotides, the SAXS measurements were done without chromatography at three different concentrations. The data were analyzed using the ATSAS suite41. Prior the experiments all the sample were centrifuged at 14,000 × g for 10 minutes. 50 μL of the individual protein sample was loaded into a sample capillary using a liquid handling and was exposed to X-rays. Scattering data were collected in multiple exposures (10 frames). Data processing and Rg determination were done with PRIMUS39. Distance distribution functions (Pr) and maximum distances (Dmax) were determined with GNOM40, and Porod volumes were determined with DATPOROD41. Ab initio molecules were generated with DAMMIF43 and 15 individual molecules were averaged with DAMAVER42. For rigid body modelling we used a homology model of the WGR domain and a crystal structure of the catalytic domain (PDB code 3KCZ) using the program bunch (Supplementary Fig. S4)44. The fit of the calculated scattering intensity of the crystal structure of the catalytic domain (PDB code 3KCZ) to the SAXS scattering intensity was analyzed using crysol45.
Circular dichroism
CD spectra of ARTD2FL, ARTD2WGR+CAT and ARTD2N were recorded at 22 °C using ChiranscanTM CD spectroscopy (Applied Photophysics Ltd.) equipped with a temperature-regulated sample chamber. A 1 mm path length quartz cuvette was used to obtain spectra in the far-UV region of 190–280 nm. The sample concentration was 0.04–0.06 mg/mL in 10 mM sodium phosphate pH 7.4 and 150 mM ammonium sulfate. The data were analyzed using the Pro-DataTM Software suit (Applied Photophysics Ltd.).
Additional Information
How to cite this article: Obaji, E. et al. Characterization of the DNA dependent activation of humanARTD2/PARP2. Sci. Rep.
6, 34487; doi: 10.1038/srep34487 (2016).
Authors: Christian Boehler; Laurent R Gauthier; Oliver Mortusewicz; Denis S Biard; Jean-Michel Saliou; Anne Bresson; Sarah Sanglier-Cianferani; Susan Smith; Valérie Schreiber; François Boussin; Françoise Dantzer Journal: Proc Natl Acad Sci U S A Date: 2011-01-26 Impact factor: 11.205
Authors: J C Amé; V Rolli; V Schreiber; C Niedergang; F Apiou; P Decker; S Muller; T Höger; J Ménissier-de Murcia; G de Murcia Journal: J Biol Chem Date: 1999-06-18 Impact factor: 5.157
Authors: Michael O Hottiger; Paul O Hassa; Bernhard Lüscher; Herwig Schüler; Friedrich Koch-Nolte Journal: Trends Biochem Sci Date: 2010-01-26 Impact factor: 13.807
Authors: Helge Otto; Pedro A Reche; Fernando Bazan; Katharina Dittmar; Friedrich Haag; Friedrich Koch-Nolte Journal: BMC Genomics Date: 2005-10-04 Impact factor: 3.969
Authors: Gabriella Zarkovic; Ekaterina A Belousova; Ibtissam Talhaoui; Christine Saint-Pierre; Mikhail M Kutuzov; Bakhyt T Matkarimov; Denis Biard; Didier Gasparutto; Olga I Lavrik; Alexander A Ishchenko Journal: Nucleic Acids Res Date: 2018-03-16 Impact factor: 16.971
Authors: M M Kutuzov; E A Belousova; T A Kurgina; A A Ukraintsev; I A Vasil'eva; S N Khodyreva; O I Lavrik Journal: Sci Rep Date: 2021-03-01 Impact factor: 4.379
Authors: Marie-France Langelier; Levani Zandarashvili; Pedro M Aguiar; Ben E Black; John M Pascal Journal: Nat Commun Date: 2018-02-27 Impact factor: 14.919
Authors: Lisa Weixler; Katja Schäringer; Jeffrey Momoh; Bernhard Lüscher; Karla L H Feijs; Roko Žaja Journal: Nucleic Acids Res Date: 2021-04-19 Impact factor: 16.971