Keyvan Karimi Galougahi1, Chia-Chi Liu2, Alvaro Garcia2, Carmine Gentile3, Natasha A Fry2, Elisha J Hamilton2, Clare L Hawkins4, Gemma A Figtree5. 1. North Shore Heart Research Group, Kolling Institute, University of Sydney, Australia University of Sydney Medical School Foundation, Sydney, Australia Columbia University Medical Center, New York, NY. 2. North Shore Heart Research Group, Kolling Institute, University of Sydney, Australia. 3. School of Medicine, University of Sydney, Australia Heart Research Institute, Sydney, Australia. 4. Heart Research Institute, Sydney, Australia. 5. North Shore Heart Research Group, Kolling Institute, University of Sydney, Australia Department of Cardiology, Royal North Shore Hospital, Sydney, Australia gemma.figtree@sydney.edu.au.
Abstract
BACKGROUND: Perturbed balance between NO and O2 (•-). (ie, NO/redox imbalance) is central in the pathobiology of diabetes-induced vascular dysfunction. We examined whether stimulation of β3 adrenergic receptors (β3 ARs), coupled to endothelial nitric oxide synthase (eNOS) activation, would re-establish NO/redox balance, relieve oxidative inhibition of the membrane proteins eNOS and Na(+)-K(+) (NK) pump, and improve vascular function in a new animal model of hyperglycemia. METHODS AND RESULTS: We established hyperglycemia in male White New Zealand rabbits by infusion of S961, a competitive high-affinity peptide inhibitor of the insulin receptor. Hyperglycemia impaired endothelium-dependent vasorelaxation by "uncoupling" of eNOS via glutathionylation (eNOS-GSS) that was dependent on NADPH oxidase activity. Accordingly, NO levels were lower while O2 (•-) levels were higher in hyperglycemic rabbits. Infusion of the β3 AR agonist CL316243 (CL) decreased eNOS-GSS, reduced O2 (•-), restored NO levels, and improved endothelium-dependent relaxation. CL decreased hyperglycemia-induced NADPH oxidase activation as suggested by co-immunoprecipitation experiments, and it increased eNOS co-immunoprecipitation with glutaredoxin-1, which may reflect promotion of eNOS de-glutathionylation by CL. Moreover, CL reversed hyperglycemia-induced glutathionylation of the β1 NK pump subunit that causes NK pump inhibition, and improved K(+)-induced vasorelaxation that reflects enhancement in NK pump activity. Lastly, eNOS-GSS was higher in vessels of diabetic patients and was reduced by CL, suggesting potential significance of the experimental findings in human diabetes. CONCLUSIONS: β3 AR activation restored NO/redox balance and improved endothelial function in hyperglycemia. β3 AR agonists may confer protection against diabetes-induced vascular dysfunction.
BACKGROUND: Perturbed balance between NO and O2 (•-). (ie, NO/redox imbalance) is central in the pathobiology of diabetes-induced vascular dysfunction. We examined whether stimulation of β3 adrenergic receptors (β3 ARs), coupled to endothelial nitric oxide synthase (eNOS) activation, would re-establish NO/redox balance, relieve oxidative inhibition of the membrane proteins eNOS and Na(+)-K(+) (NK) pump, and improve vascular function in a new animal model of hyperglycemia. METHODS AND RESULTS: We established hyperglycemia in male White New Zealand rabbits by infusion of S961, a competitive high-affinity peptide inhibitor of the insulin receptor. Hyperglycemia impaired endothelium-dependent vasorelaxation by "uncoupling" of eNOS via glutathionylation (eNOS-GSS) that was dependent on NADPH oxidase activity. Accordingly, NO levels were lower while O2 (•-) levels were higher in hyperglycemic rabbits. Infusion of the β3 AR agonist CL316243 (CL) decreased eNOS-GSS, reduced O2 (•-), restored NO levels, and improved endothelium-dependent relaxation. CL decreased hyperglycemia-induced NADPH oxidase activation as suggested by co-immunoprecipitation experiments, and it increased eNOS co-immunoprecipitation with glutaredoxin-1, which may reflect promotion of eNOS de-glutathionylation by CL. Moreover, CL reversed hyperglycemia-induced glutathionylation of the β1 NK pump subunit that causes NK pump inhibition, and improved K(+)-induced vasorelaxation that reflects enhancement in NK pump activity. Lastly, eNOS-GSS was higher in vessels of diabeticpatients and was reduced by CL, suggesting potential significance of the experimental findings in humandiabetes. CONCLUSIONS: β3 AR activation restored NO/redox balance and improved endothelial function in hyperglycemia. β3 AR agonists may confer protection against diabetes-induced vascular dysfunction.
Elevated levels of reactive oxygen species (ROS), or “oxidative stress” and decreased NO levels are central pathobiological features of vascular dysfunction in diabetes.1 At low levels, ROS play an important role in physiological cell signaling.2, 3 Within the signaling microdomains in membrane lipid rafts/caveolae, the levels of ROS are kept in a tight balance with NO for optimal signaling, in what is known as “NO/redox balance.”3 The NO/redox balance is structurally based on co‐localization of NADPH oxidase, the major source of ROS in the membrane, with endothelial NO synthase (eNOS) and their signaling interaction.3 In diabetes, excessive activation of the oxidase and a switch in the function of eNOS from NO‐ to ROS generation (ie, eNOS “uncoupling”) causes disruption of this balance, resulting in adverse effects on cellular homeostasis and vascular function.2, 3Despite the established role of ROS in diabetes‐induced vascular dysfunction, general antioxidants are clinically inefficacious.2 Even if general antioxidants are successfully delivered to the membrane signalosomes, a feat that is yet to be established,4 and they scavenge ROS on a one‐to‐one basis, they have no effects on sources of ROS; whereas diabetes‐induced NADPH oxidase‐derived ROS generation is a continuous process.1 In physiological signaling, antioxidants need to achieve “controlled” generation rather than complete suppression of ROS. In contrast to nonspecific antioxidants, disruption of the renin–angiotensin system in diabetes by angiotensin‐converting enzyme inhibitors or angiotensin receptor blockers protects against the diabetes‐induced vascular dysfunction.2 Angiotensin II (Ang II) receptors are co‐localized with NADPH oxidase and eNOS,5 and inhibition of Ang II receptor–coupled signaling re‐establishes NO/redox balance by decreasing NADPH oxidase–mediated ROS production2 and by restoring eNOS function.6, 7Due to a paucity of therapies protective against vascular complications of diabetes besides angiotensin‐converting enzyme inhibitors/angiotensin receptor blockers, we sought to determine whether agents that modulate adrenergic signaling via β3 adrenergic receptors (β3 ARs) have effects on redox pathways and vascular function in hyperglycemic state. β3 ARs are expressed in endothelial cells8 and enriched in the caveolae9 and their stimulation is coupled to eNOS activation and NO release.10, 11 We have previously shown that β3 AR stimulation reverses oxidative inhibition of the cardiac Na+‐K+ pump,10, 11 a biomolecule also enriched in the caveolae.12 This effect was mediated by a decrease in glutathionylation of the pump's β1 subunit.10 Glutathionylation, which involves formation of a reversible disulphide bond between glutathione and reactive cysteines on proteins with significant structural and functional consequences, is increasingly recognized in physiological and pathophysiological cell signaling.13 Of direct relevance to our objective, glutathionylation also mediates eNOS uncoupling in endothelial cells under oxidative stress.14 In contrast to uncoupling by depletion of the cofactor tetrahydrobiopterin (BH4), which leads to O2
•− generation in the oxidase domain of the enzyme instead of NO synthesis, uncoupling by glutathionylation of 2 highly conserved cysteine residues of eNOS leads to O2
•− generation in the reductase domain and abolishment of NO production.14 These seemingly distinct mechanisms of eNOS uncoupling have recently been shown to interact, with one mechanism inducing uncoupling by the other in an integrated manner.15To study the effects of β3 AR agonism in diabetes, we established and characterized a novel model of hyperglycemia because we found that the widely used diabetogenic agents such as streptozotocin (STZ) and alloxan, which induce type 1 diabetes, have direct and cofounding effects on glutathionylation levels. The prevalence of type 2 diabetes is substantially higher than type 1, driven by the epidemics of obesity and insulin resistance,16 and is alarmingly on the rise with vascular pathophysiology being the major cause of morbidity and mortality. Since both disruption in insulin signaling17 and hyperglycemia16 are key pathophysiological mechanisms of type 2 diabetes–induced vascular dysfunction, we induced a hyperglycemic state by competitively blocking insulin signaling through continuous infusion of S961, a high‐affinity peptide inhibitor of insulin receptor.18 Moreover, pharmacology and physiological effects of the β3 ARs in the cardiovascular system are highly species‐dependent, and since rabbits provide a relevant model for human β3 AR,19 we characterized the metabolic and biochemical profile of S961‐induced hyperglycemia in rabbits. We assessed endothelial function, measured O2
•−‐ and NO levels in vessels and examined oxidative modification of eNOS and Na+‐K+ pump and relevant redox pathways that regulate these modifications. Subsequently, we assessed modulating effects of the β3 AR agonist CL316243 (CL) on these pathways/molecules and vascular function in this model.
Materials and Methods
S961‐Induced Hyperglycemia, Animals, Cells, Treatments, and Hemodynamic and Metabolic Measurements
S961 was expressed in Escherichia coli as a fusion protein with an affinity tag and had the peptide sequence GSLDESFYDWFERQLGGGSGGSSLEEEWAQIQCEVWGRGCPSY with a disulfide bridge connecting the 2 cysteine residues (a gift from Novo Nordisk, Denmark).18 We infused S961 dissolved in normal saline for 7 days at a rate of 12 μg/kg per hour via osmotic mini‐pumps (Alzet, Palo Alto, CA) implanted subcutaneously in male New Zealand White rabbits, weighing 2.2 to 2.6 kg while they were under general anesthesia. The selective β3 AR agonist CL (Sigma‐Aldrich, St. Louis, MO) was dissolved in normal saline and infused via mini‐pumps at a rate of 40 μg/kg per hour during the last 3 days of hyperglycemia. Since infusion of the vehicle alone (normal saline) in 5 rabbits did not change oxidative modification of the target proteins or endothelium‐dependent vasorelaxation (either identical or almost‐identical means within nearly equal SEM), we did not use sham infusions in controls. Durations of infusions of S961 and CL were limited by the amount of S961 we had available and the cost of CL needed in a relatively large animal such as rabbit. Blood samples for biochemical and metabolic analysis were obtained from the central ear artery of the anesthetized rabbits before and after each treatment. Blood glucose was measured in a drop of blood from the marginal ear vein using a glucometer and strips (Optium Xceed, Abbott Diabetes Care Ltd, Australia). Heart rate and blood pressure were measured via a catheter in the ear artery after anesthesia by subcutaneous injection of ketamine hydrochloride (50 mg/kg) and xylazine hydrochloride (50 mg/kg) prior to euthanasia by intravenous bolus injection of ketamine. The rabbit thoracic aorta was harvested and cleared of adhering tissue in Krebs buffer. The total number of rabbits used for this study was 50 (diabetogenesis with alloxan in vivo, n=9, control rabbits for in vitro assessment of diabetogenic agents n=6, sham infusions with normal saline n=5, control rabbits for vasomotor studies and molecular experiments n=10, rabbits with hyperglycemia induced by S961 infusion including dose titration experiments n=20). Pooled, multiple‐donorhuman umbilical vein endothelial cells (Lonza, Basel, Switzerland) were used for in vitro experiments. Surplus segments of human internal mammary or radial artery were obtained from patients undergoing coronary artery bypass graft operation at our institution (n=4 samples from diabeticpatients and n=4 from nondiabetic patients). Myocardial tissue was obtained from a patient undergoing cardiac biopsy at another institution. The study protocols were in accordance with institutional guidelines and were approved by the appropriate research ethics committees at our institution. Informed written consent was obtained from patients.
Immunodetection of Glutathionylated Protein and Protein Co‐Immunoprecipitation
To detect glutathionylation of eNOS and β1 Na+‐K+ pump subunit in co‐immunoprecipitation experiments, an antibody against glutathionylated protein (anti‐glutathione antibody) was used to detect glutathionylation.10 Aorta was homogenized in ice‐cold lysis buffer containing 150 mmol/L NaCl, 50 mmol/L Tris‐HCl (pH 8.0), 1% Triton X‐100, 2 mmol/L EDTA, and protease inhibitor (Complete EGTA‐free, Roche Diagnostics), followed by centrifugation at 16 000g for 20 minutes. The supernatant (0.5–1 mg protein) was incubated with the appropriate antibody at a ratio of 1 μg of β1 Na+‐K+ subunit antibody:1 mg protein and 2.5 μg anti‐eNOS antibody:1 mg protein at 4°C for 1 hour and then with protein A/G‐Plus agarose beads. The proteins bound to the collected beads were eluted in Laemmli buffer, subjected to SDS‐PAGE, and probed with anti‐glutathione antibody. This protocol was also used to detect co‐immunoprecipitation of eNOS/ glutaredoxin‐1 (Grx1), β1 subunit/Grx1, and p47/eNOS. To detect glutathionylation of β1 Na+‐K+ subunit in cardiac myocytes, freshly isolated myocytes were loaded with biotinylated glutathione ester (500 μmol/L) for 1 hour at room temperature. The biotin‐tag was used to precipitate glutathionylated proteins as previously described.10 Western blot chemiluminescence was read by a LAS‐4000 image reader and quantified by densitometry using Multi Gauge 3.1 software (Fujifilm Life Science, Tokyo, Japan). Exposure times were adjusted to ensure that the variation in signal intensity was in the linear dynamic range.
Electron Paramagnetic Resonance Spin‐Trapping Measurement of NO
To synthesize the colloid spin trap, sodium diethyldithiocarbamate (sodium DETC, 4.5 mg) and FeSO4 7H2O (2.8 mg) were dissolved separately in 10 mL of deoxygenated Krebs bubbled with a nitrogen purge and mixed rapidly, resulting in a final concentration of Fe(DETC)2 of 0.5 mmol/L. The spin trap was used immediately. After harvesting the aorta from rabbits and separating the loose adhering tissue, the aorta was opened longitudinally and cut into 10×10 mm segments. The segments were placed in a 6‐well plate containing 500 μL Krebs, with 500 μL of Fe(DETC)2 added (final concentration of 0.25 mmol/L), and incubated at 37°C for 30 minutes. The tissue samples were placed in electron paramagnetic resonance tubes, snap‐frozen, and stored at −80°C until analysis. Spectra were recorded at 77 K with a Bruker EMX X‐band spectrometer using the following parameters: microwave power 2.5 mW; microwave frequency 9.4 GHz; modulation amplitude 0.2 mT; modulation frequency 100 kHz; conversion time 81.9 ms, time constant 163.8 ms, scan time 83.9 s with 12 scans averaged. The amplitude of NO signal was determined as the perpendicular height between the top of the first low‐field signal and the valley of the third high‐field signal.20
High‐Performance Liquid Chromatography Analysis of Dihydroethidium (DHE) Oxidation Products
The stock solution of DHE was prepared by dissolving DHE in deoxygenated dimethyl sulfoxide under argon in the dark with the concentration checked by UV‐VIS. Immediately after harvesting from rabbits, five 2‐mm segments of aorta were incubated in Krebs buffer containing the metal chelator diethylenetriaminepentaacetic acid (DTPA, 100 μmol/L) to minimize artificial oxidation, and DHE (50 μmol/L) in 1.5 mL Eppendorf tubes (37°C, 30 minutes, in the dark). The tissue was washed of the DHE with Krebs/DTPA 3 times and homogenized in 300 μL of cold methanol by centrifugation at 12 000g for 10 minutes at 4°C in the dark. Fifty microliters of homogenate was taken to determine protein concentration. Equal amounts of the homogenate were then added to equal amount of 0.2 mol/L of HClO4 in methanol, vortexed, and placed on ice for 1 hour in the dark to allow precipitation of protein. After centrifugation at 20 000g at 4°C for 30 minutes, the supernatant was stored at −80°C until analysis. High‐performance liquid chromatography equipped with a fluorescence and a CoulArray electrochemical detector was used to separate the O2
•−‐dependent 2‐hydroxy‐ethidium (2‐OH‐E+) product from the nonspecific product ethidium (E+) following DHE oxidation in rabbit aorta.21 Samples (50 μL) were separated by high‐performance liquid chromatography (Shimadzu) after injection onto a Synergi Polar RP C18 column (250×4.6 mm, 4 μmol/L, 80 Å, Phenomenex) equilibrated at 30°C with 60% mobile phase A (10% CH3CN in potassium phosphate buffer, 50 mmol/L, pH 2.6) and 40% mobile phase B (60% CH3CN in potassium phosphate buffer, 50 mmol/L, pH 2.6). Separation of products was performed by a linear increase to 100% mobile phase B over 30 minutes at a flow rate of 0.5 mL min−1. Products were quantified by fluorescence (DHE and 2‐OH‐E+: λEX 358 nm, λEM 440 nm; E+ λEX 490 nm, λEM 565 nm) and electrochemical oxidation using a CoulArray detector (Environmental Sciences Associates; electrodes at 0, 200, 280, 365, 400, 450, 500, and 600 mV). The quantified 2‐OH‐E+ levels were normalized to protein concentration.
Aortic Preparation and Functional Measurements
Aortic rings measuring 5 mm in length were mounted on 2 stainless steel hooks immersed in 25 mL organ bath chambers filled with Krebs buffer containing (in mmol/L) NaCl 118, KCl 4.6, NaHCO3 27.2, MgSO4 1.2, CaCl2 2.5, KH2PO4 1.2, and glucose 11.1 (pH 7.4). The isometric contractions were measured in organ chambers at 37°C by using a force transducer (Radnoti) and recording with Powerlab software (AD Instruments, United States). Vascular rings were allowed to equilibrate for 0.5 hours and tension was gradually increased to 2 g. Vessels were then contracted with the addition of 80 mmol/L KCl to determine integrity of the rings. After maximum contraction was achieved, the aortic rings were washed with Krebs buffer and re‐equilibrated. Rings were then precontracted with phenylephrine (100 nmol/L). Once a plateau was achieved, increasing concentrations of acetylcholine were added. The endothelium‐dependent relaxation was expressed as the percentage of relaxation to phenylephrine‐induced contraction. In separate experiments, Krebs buffer was replaced with Krebs buffer that was nominally K+‐free. After 20 minutes in K+‐free Krebs buffer, rings were precontracted with phenylephrine (100 nmol/L). Once a plateau was achieved, increasing concentrations of K+ were administered as previously described.22, 23 As the Na+‐K+ pump is inhibited in the absence of extracellular K+ and reactivated by its reintroduction at low concentrations, K+‐induced relaxation has been characterized as an index of Na+‐K+ pump activity in arteries, which is dependent on external K+ and intracellular Na+ and Mg2+ and inhibited by the pump inhibitor ouabain.22
Materials
Sodium diethyldithiocarbamate, FeSO4 7H2O, diethylenetriaminepentaacetic acid, and glutathione ethyl ester were purchased from Sigma‐Aldrich. N‐Hydroxysulfosuccinimidobiotin was obtained from Merck, dithiothreitol from Promega, streptavidin–Sepharose from GE Healthcare Bio‐Sciences, and Protein A/G‐Plus agarose from Santa Cruz Biotechnology. Osmotic mini‐pumps were purchased from Alzet and CL from Sigma‐Aldrich. Dihydroethidium and N‐(Biotinoyl)‐N′‐(iodoacetyl) ethylenediamine were obtained from Invitrogen. Monoclonal antibodies were purchased from the following vendors: β1 subunit of Na+‐K+ ATPase from Upstate Biotechnology; anti‐glutathione from Virogen, eNOS antibody from Sigma‐Aldrich, and p47, phosphorylated eNOS116, phosphorylated eNOS1177, neuronal NOS (nNOS), and α tubulin from Santa Cruz Biotechnology. All chemicals used in Krebs solutions were analytical grade and were obtained from BDH.
Statistical Analysis
Results are presented as mean±SEM and median with 25% to 75% interquartile range where necessary. Kolgomorov–Smirnov test was performed to check for normality. For comparison between 2 groups either a non‐paired Student t test or a Mann–Whitney test were used where appropriate. Paired t test was used for analysis of changes in blood biochemistry and body weight before and after the induction of hyperglycemia or treatment with CL (Table). For multiple comparisons, 1‐way ANOVA was used with Tukey's post‐hoc analysis. For vasorelaxation data, concentrations of acetylcholine and vasorelaxation responses in rabbits from different experimental groups were included in 2‐way repeated‐measures ANOVA with Tukey or Sidak's post‐hoc tests used for multiple comparisons. P value <0.05 was considered statistically significant.
Table 1
Metabolic, Biochemical and Hemodynamic Effects of the Insulin Receptor Antagonist S961 and the β3 AR Agonist CL
Baseline
Hyperglycemia
Weight, kg
2.4±0.2
2.7±0.2a
Na+, mmol/L
143.5±7.4
140.2±3.8
K+, mmol/L
4.4±0.2
3.9±0.4
Urea, mmol/L
6.5±2.1
5.7±2.8
Creatinine, mmol/L
67.8±11.3
50.3±11.9
Triglyceride, mmol/L
1.3±1.0
2.2±1.1
Cholesterol, mmol/L
1.5±0.4
1.0±0.5
Insulin, mIU/L
<3
121.2±54a
C‐peptide, pmol/L
<33
<33
Pre CL
Post CL
Blood glucose, mmol/L
15.9±0.7
17±0.6
Plasma insulin, mIU/L
104.9±1.1
132.5±17.5
Control
CL
HG
HG+CL
Heart rate
204±6
212±5
205±5
200±3
Systolic blood pressure
93±2
78±5a
90±2
79±2a
Diastolic blood pressure
82±2
66±5a
76±2
63±2a
Mean arterial pressure
86±2
70±3a
81±2
68±2a
Body weight, electrolytes, renal function, lipid profile, insulin, and C‐peptide levels in rabbits at baseline and after 7 days of infusion with S961 at 12 μg/kg per hour. n=8. Heart rate, systolic, diastolic, and mean arterial pressure in rabbits with S961 hyperglycemia (HG) and after the infusion of the selective β3 AR agonist CL316243 (CL, 40 μg/kg per hour, 3 days). n=10. Blood glucose and insulin levels in S961 hyperglycemic rabbits pre‐ and postinfusion of CL (40 μg/kg per hour, 3 days). n=5. β3 AR indicates β3 adrenergic receptors; IU, international units.
Statistical significance.
Metabolic, Biochemical and Hemodynamic Effects of the Insulin Receptor Antagonist S961 and the β3 AR Agonist CLBody weight, electrolytes, renal function, lipid profile, insulin, and C‐peptide levels in rabbits at baseline and after 7 days of infusion with S961 at 12 μg/kg per hour. n=8. Heart rate, systolic, diastolic, and mean arterial pressure in rabbits with S961 hyperglycemia (HG) and after the infusion of the selective β3 AR agonist CL316243 (CL, 40 μg/kg per hour, 3 days). n=10. Blood glucose and insulin levels in S961 hyperglycemic rabbits pre‐ and postinfusion of CL (40 μg/kg per hour, 3 days). n=5. β3 AR indicates β3 adrenergic receptors; IU, international units.Statistical significance.
Results
Choice of Hyperglycemia Model to Avoid Redox Effects of Diabetogenic Agents
Since we aimed to examine the effects of hyperglycemia on oxidative modification of proteins, we first determined whether alloxan and STZ, agents commonly used to establish type 1 diabetes, would have direct redox effects independently of diabetes per se. We tested this by examining glutathionylation of the highly abundant, ubiquitous membrane protein Na+‐K+ pump, which mediates inhibition of the pump function in cardiac myocytes24 and vascular smooth muscle cells.23 Alloxan, at high concentrations in vitro (1 mmol/L, 37°C, 30 minutes), reflecting the pancreatotoxic diabetogenic doses used in vivo, increased glutathionylation of the β1 Na+‐K+ pump subunit (Figure 1A). Moreover, glutathionylation of the β1 pump subunit was also increased in rabbits that received a typically diabetogenic dose of alloxan (100 mg/kg) in vivo but did not develop diabetes due to insufficient necrosis of pancreatic β cells (Figure 1B). Higher glutathionylation levels were detected 7 days after alloxan injection and were similar to levels in rabbits that did develop diabetes (Figure 1B), thus showing that alloxan can alter glutathionylation independent of diabetogenesis in vivo. In contrast, exposure of isolated rabbit cardiac myocytes to STZ in vitro (37°C, 30 minutes) decreased glutathionylation of β1 Na+‐K+ pump subunit in a concentration‐dependent manner (Figure 1C). In contrast, S961, the peptide antagonist of the insulin receptor, had no effects on β1 pump subunit glutathionylation in vitro (Figure 1D).
Figure 1
Effects of diabetogenic agents on redox modification of the Na+‐K+ pump. A, Effect of alloxan on β1 Na+‐K+ pump glutathionylation (β1‐GSS) in isolated rabbit cardiac myocytes loaded with biotinylated glutathione (BiOGEE technique) prior to alloxan exposure (n=5). B, β1‐GSS in rabbits receiving a bolus injection of alloxan (100 mg/kg) with and without developing diabetes, as detected by immunoblots (IB) with anti‐glutathione and anti‐β1 subunit antibodies in the β1 subunit immunoprecipitate (IP). C, Effect of STZ on β1‐GSS examined by BiOGEE technique (n=5). D, Effect of S961 on β1‐GSS (n=6). α tubulin was used as loading control. Statistical significance is indicated by *. STZ indicates streptozocin.
Effects of diabetogenic agents on redox modification of the Na+‐K+ pump. A, Effect of alloxan on β1 Na+‐K+ pump glutathionylation (β1‐GSS) in isolated rabbit cardiac myocytes loaded with biotinylated glutathione (BiOGEE technique) prior to alloxan exposure (n=5). B, β1‐GSS in rabbits receiving a bolus injection of alloxan (100 mg/kg) with and without developing diabetes, as detected by immunoblots (IB) with anti‐glutathione and anti‐β1 subunit antibodies in the β1 subunit immunoprecipitate (IP). C, Effect of STZ on β1‐GSS examined by BiOGEE technique (n=5). D, Effect of S961 on β1‐GSS (n=6). α tubulin was used as loading control. Statistical significance is indicated by *. STZ indicates streptozocin.
Metabolic and Biochemical Parameters and Vascular Phenotype of S961‐Induced Hyperglycemia
The details of how we determined the appropriate dose of S961 to establish stable, persistent hyperglycemia is described by us elsewhere.25 Briefly, after checking for transient hyperglycemia induced by a bolus injection of S961 in rabbits, we examined the effects of continuous subcutaneous infusion at different rates, and found that mean blood glucose values increased with an increase in the rate of S961 infusion.25 On the basis of our dose titration experiments, we selected an infusion rate of 12 μg/kg per hour for the study. Continuous S961 infusion at this rate induced a relatively rapid rise in blood glucose levels in rabbits that remained stably high during the 7 days of infusion (Figure 2A). Since infusion of vehicle (normal saline) alone in 5 rabbits had no effect oxidative modification of the target proteins (data not shown), we did not use sham infusions in controls. Mean blood glucose levels in rabbits infused for 7 days with this rate compared to levels in controls are shown in Figure 2B. The S961‐induced increase in blood glucose levels was associated with an increase in plasma insulin levels (Table) consistent with a counter‐regulatory response to the competitive insulin receptor blockade shown in in vitro studies.18 C‐peptide levels were not within the detection limits of the assay (Table). The rabbits gained weight normally during the study (Table). S961 infusion had no effect on serum Na+ or K+, renal function, and cholesterol or triglyceride levels (Table). To examine the impact of S961 model on vascular physiology, we measured endothelium‐dependent relaxation in aortic rings precontracted with phenylephrine in organ chambers. S961 hyperglycemia reduced acetylecholine‐induced relaxation (Figure 2C). In contrast, sodium nitroprusside–induced relaxation was unchanged (Figure 2D).
Figure 2
Blood glucose levels and vascular function in S961‐induced hyperglycemia. A, Blood glucose levels of rabbits infused subcutaneously via osmotic mini‐pump with S961 (12 μg/kg per hour). (n=5). B, Mean blood glucose levels of control rabbits and rabbits with S961‐induced hyperglycemia over 7 days (n=10). C, Endothelium‐dependent vasorelaxation in aortic rings of control and hyperglycemic rabbits (n=6 control and 5 hyperglycemic rabbits, with 2–3 or 3–5 rings studied per rabbit in each group, respectively). These baseline data are re‐presented in Figure 3A. P=0.01 on 2‐way repeated‐measures ANOVA. D, SNP‐induced vasorelaxation in control and diabetic rabbits (n=6 rabbits and 2–3 rings per rabbit). P=0.69 on 2‐way repeated‐measures ANOVA. Relaxations are plotted as the percentage decrease in PE‐induced contraction against the concentration of ACh or SNP on a logarithmic scale. PE‐induced contractions were not different across different groups. Statistical significance is indicated by *. ACh indicates acetylcholine; PE, phenylephrine; SNP, sodium nitroprusside.
Blood glucose levels and vascular function in S961‐induced hyperglycemia. A, Blood glucose levels of rabbits infused subcutaneously via osmotic mini‐pump with S961 (12 μg/kg per hour). (n=5). B, Mean blood glucose levels of control rabbits and rabbits with S961‐induced hyperglycemia over 7 days (n=10). C, Endothelium‐dependent vasorelaxation in aortic rings of control and hyperglycemic rabbits (n=6 control and 5 hyperglycemic rabbits, with 2–3 or 3–5 rings studied per rabbit in each group, respectively). These baseline data are re‐presented in Figure 3A. P=0.01 on 2‐way repeated‐measures ANOVA. D, SNP‐induced vasorelaxation in control and diabetic rabbits (n=6 rabbits and 2–3 rings per rabbit). P=0.69 on 2‐way repeated‐measures ANOVA. Relaxations are plotted as the percentage decrease in PE‐induced contraction against the concentration of ACh or SNP on a logarithmic scale. PE‐induced contractions were not different across different groups. Statistical significance is indicated by *. ACh indicates acetylcholine; PE, phenylephrine; SNP, sodium nitroprusside.
Figure 3
Effect of β3
AR agonism on endothelial function, NO‐ and O2
•− levels, and redox modification of eNOS in S961‐induced hyperglycemia. A, Effect of CL316243 (CL) on ACh‐induced relaxation in aorta of control and hyperglycemic rabbits. Number of rabbits per each group: 6 controls (2–3 rings/rabbit), 5 hyperglycemics (3–5 rings/rabbit), 5 CL‐treated controls (4–6 rings/rabbit), and 6 CL‐treated hyperglycemics (HG) (3–6 rings/rabbit). P=0.01 (control vs HG) and 0.005 (HG vs HG+CL) on 2‐way repeated‐measures ANOVA. B, O2
•− levels in rabbit aorta by HPLC analysis of the specific‐ (2‐OH‐E+) and nonspecific product (E+) of DHE oxidation. Representative chromatograms from a control and a hyperglycemic rabbit are shown. [2‐OH‐E+]=mean values over protein concentration (pmol/mg per mL). n=5 control, 5 CL‐treated, 6 hyperglycemic‐ and 5 CL‐treated hyperglycemic rabbits. C, NO measurement by electron paramagnetic resonance of Fe(DETC)2 in rabbit aorta. The amplitude of NO‐Fe(DETC)2 signal was determined as the height between the top of the first low field signal (g1=3291 G) and the valley of the third high field signal (g2=3327 G) (up–down double arrows on the left). The trace from the standard spermine NONOate in dimethyl sulfoxide solution is shown. n=7 control‐, 4 CL‐treated‐, 5 hyperglycemic‐, and 5 CL‐treated hyperglycemic rabbits. D, Glutathione and eNOS immunoblot (IB) of eNOS immunoprecipitate (IP) from rabbit aorta. n=5. *P<0.05 vs control and **P<0.05 vs hyperglycemia. eNOS indicates endothelial nitric oxide synthase.
Effects of β3 AR Agonism on NO‐ and O2
•− Levels, eNOS Uncoupling, and Endothelial Function in S961 Model
We co‐administered the β3 AR agonist CL by continuous infusion in hyperglycemic rabbits for the last 3 days of the study. Treatment with CL had no effect on plasma glucose or insulin levels (Table). CL also had no effect on heart rate but it reduced blood pressure (Table). S961‐induced hyperglycemia impaired endothelial function as measured by acetylcholine‐induced relaxation in aortic rings of hyperglycemic rabbits, which was restored by in vivo CL treatment (Figure 3A). There was a marked increase in O2
•− levels in aorta of hyperglycemic rabbits as measured by 2‐OH‐E+ levels, the specific product of DHE oxidation by O2
•− (Figure 3B). Treatment with CL reduced O2
•− levels in aorta of hyperglycemic rabbits (Figure 3B). While NO levels, measured by electron paramagnetic resonance analysis of NO‐Fe(DETC)2 complexes, were decreased in aorta of hyperglycemic rabbits, they were restored to almost normal levels by treatment with CL (Figure 3C).Effect of β3
AR agonism on endothelial function, NO‐ and O2
•− levels, and redox modification of eNOS in S961‐induced hyperglycemia. A, Effect of CL316243 (CL) on ACh‐induced relaxation in aorta of control and hyperglycemic rabbits. Number of rabbits per each group: 6 controls (2–3 rings/rabbit), 5 hyperglycemics (3–5 rings/rabbit), 5 CL‐treated controls (4–6 rings/rabbit), and 6 CL‐treated hyperglycemics (HG) (3–6 rings/rabbit). P=0.01 (control vs HG) and 0.005 (HG vs HG+CL) on 2‐way repeated‐measures ANOVA. B, O2
•− levels in rabbit aorta by HPLC analysis of the specific‐ (2‐OH‐E+) and nonspecific product (E+) of DHE oxidation. Representative chromatograms from a control and a hyperglycemic rabbit are shown. [2‐OH‐E+]=mean values over protein concentration (pmol/mg per mL). n=5 control, 5 CL‐treated, 6 hyperglycemic‐ and 5 CL‐treated hyperglycemic rabbits. C, NO measurement by electron paramagnetic resonance of Fe(DETC)2 in rabbit aorta. The amplitude of NO‐Fe(DETC)2 signal was determined as the height between the top of the first low field signal (g1=3291 G) and the valley of the third high field signal (g2=3327 G) (up–down double arrows on the left). The trace from the standard spermine NONOate in dimethyl sulfoxide solution is shown. n=7 control‐, 4 CL‐treated‐, 5 hyperglycemic‐, and 5 CL‐treated hyperglycemic rabbits. D, Glutathione and eNOS immunoblot (IB) of eNOS immunoprecipitate (IP) from rabbit aorta. n=5. *P<0.05 vs control and **P<0.05 vs hyperglycemia. eNOS indicates endothelial nitric oxide synthase.Since hyperglycemia was associated with increased O2
•− and decreased NO levels, we next examined whether hyperglycemia had induced eNOS uncoupling. Indeed, consistent with the pattern of changes in the free radicals, we found an increase in eNOS glutathionylation in aorta of hyperglycemic rabbits (Figure 3D). In vivo infusion of CL abolished the increase in hyperglycemia‐induced eNOS glutathionylation (Figure 3D). Taken together, these data show that CL enhances NO bioavailability, decreases oxidative stress, recouples eNOS, and improves endothelial function in S961‐induced hyperglycemia.
Effect of β3 AR Agonism on Redox Regulation of the Vascular Na+‐K+ Pump in S961‐Induced Hyperglycemia
Since the Na+‐K+ pump plays a major role in regulation of many essential cellular processes in the vasculature including regulation of vascular tone, we next examined the effects of CL on the function of the pump, previously reported by our group to be regulated by redox‐dependent mechanisms in the vasculature.23 Hyperglycemia decreased K+‐induced relaxation, which is dependent on Na+‐K+ pump reactivation upon a switch from nominally K+‐free to K+‐containing solutions in the tissue bath22 (Figure 4A). CL enhanced K+‐induced relaxation in aortic rings of hyperglycemic rabbits (Figure 4A). Consistent with this functional effect, CL abolished hyperglycemia‐induced increase in β1 subunit glutathionylation (Figure 4B).
Figure 4
β3
AR stimulation and redox regulation of the vascular Na+‐K+ pump in S961‐induced hyperglycemia. A, Effect of CL on K+‐induced relaxation in aortic rings of control‐ and hyperglycemic rabbits. n=7 control‐ (2–4 rings/rabbit), 5 hyperglycemic‐ (2 rings/rabbit), 4 CL‐treated‐ (4–6 rings/rabbit), 6 CL‐treated hyperglycemic‐ (4–6 rings/rabbit) rabbits. P=0.01 (HG vs control), 0.02 (CL vs control) and 0.001 (HG vs HG+CL) on 2‐way repeated‐measures ANOVA. B, Glutathionylated β1 subunit detected by glutathione antibody technique. β1 Na+‐K+ pump subunit IB of the glutathione IP is shown on top row. IB of β1 subunit and α tubulin from raw homogenates of rabbit aorta are also shown. n=5. *P<0.05 vs control and **P<0.05 vs hyperglycemia. HG indicates hyperglycemia; IB, immunoblot; IP, immunoprecipitate.
β3
AR stimulation and redox regulation of the vascular Na+‐K+ pump in S961‐induced hyperglycemia. A, Effect of CL on K+‐induced relaxation in aortic rings of control‐ and hyperglycemic rabbits. n=7 control‐ (2–4 rings/rabbit), 5 hyperglycemic‐ (2 rings/rabbit), 4 CL‐treated‐ (4–6 rings/rabbit), 6 CL‐treated hyperglycemic‐ (4–6 rings/rabbit) rabbits. P=0.01 (HG vs control), 0.02 (CL vs control) and 0.001 (HG vs HG+CL) on 2‐way repeated‐measures ANOVA. B, Glutathionylated β1 subunit detected by glutathione antibody technique. β1 Na+‐K+ pump subunit IB of the glutathione IP is shown on top row. IB of β1 subunit and α tubulin from raw homogenates of rabbit aorta are also shown. n=5. *P<0.05 vs control and **P<0.05 vs hyperglycemia. HG indicates hyperglycemia; IB, immunoblot; IP, immunoprecipitate.
Effect of β3 AR Agonism on Sources of ROS and Antioxidant Pathways in S961‐Induced Hyperglycemia
Because O2
•− levels were significantly higher in vessels of hyperglycemic rabbits, and since NADPH oxidase is a major source of vascular O2
•− in diabetes, we examined whether activation of the oxidase contributed to the redox stress in hyperglycemia. Aortic rings from control and hyperglycemic rabbits were incubated with the membrane‐permeable peptide gp91ds‐tat ex vivo. The peptide had no effect on acetylcholine‐induced relaxation in control rings (Figure 5A), but it improved relaxation in rings from hyperglycemic rabbits (Figure 5B), suggesting that increased constitutive NADPH oxidase activity contributed to the hyperglycemia‐induced endothelial dysfunction. Accordingly, gp91ds‐tat had no effect on eNOS glutathionylation in control rabbits (Figure 5C), but it decreased eNOS glutathionylation in aorta of hyperglycemic rabbits (Figure 5D).
Figure 5
Effect of β3
AR agonism on sources of ROS and de‐glutathionylation enzymatic system in hyperglycemia. A and B, ACh‐induced relaxation in aortic rings from control and hyperglycemic rabbits with and without ex vivo incubation with gp91ds‐tat (5 μmol/L, 37°C, 1 hour) prior to vasomotor studies. n=5 control and 5 hyperglycemic rabbits with 3 rings pre‐incubated vs 3 rings not pre‐incubated with gp91ds‐tat (5 μmol/L, 37°C, 1 hour) in each rabbit. P=0.15 in controls and 0.01 in hyperglycemics on 2‐way repeated‐measures ANOVA. C and D, eNOS IB of glutathione IP from rabbit aorta with and without ex vivo exposure and α tubulin IB as loading control are shown. n=5. E, p47phox and eNOS IB of p47phox
IP from rabbit aorta n=5. F, Glutaredoxine‐1 (Grx1), β1 Na+‐K+ pump subunit (β1), and eNOS IB of Grx1 IP from rabbit aorta. n=5. Grx1/Grx1 co‐immunoprecipitation was unaltered between the groups. The panels show the mean of signal for eNOS‐ and β1 subunit coimmunoprecipitation with Grx1. *P<0.05 vs control and **P<0.05 vs hyperglycemia. β3
AR indicates β3 adrenergic receptors; ACh, acetylcholine; CL, CL316243; eNOS, endothelial nitric oxide synthase; GSS, glutathionylation; HG, hyperglycemia; IB, immunoblot; IP, immunoprecipitate; ROS, reactive oxygen species.
Effect of β3
AR agonism on sources of ROS and de‐glutathionylation enzymatic system in hyperglycemia. A and B, ACh‐induced relaxation in aortic rings from control and hyperglycemic rabbits with and without ex vivo incubation with gp91ds‐tat (5 μmol/L, 37°C, 1 hour) prior to vasomotor studies. n=5 control and 5 hyperglycemic rabbits with 3 rings pre‐incubated vs 3 rings not pre‐incubated with gp91ds‐tat (5 μmol/L, 37°C, 1 hour) in each rabbit. P=0.15 in controls and 0.01 in hyperglycemics on 2‐way repeated‐measures ANOVA. C and D, eNOS IB of glutathione IP from rabbit aorta with and without ex vivo exposure and α tubulin IB as loading control are shown. n=5. E, p47phox and eNOS IB of p47phox
IP from rabbit aorta n=5. F, Glutaredoxine‐1 (Grx1), β1 Na+‐K+ pump subunit (β1), and eNOS IB of Grx1 IP from rabbit aorta. n=5. Grx1/Grx1 co‐immunoprecipitation was unaltered between the groups. The panels show the mean of signal for eNOS‐ and β1 subunit coimmunoprecipitation with Grx1. *P<0.05 vs control and **P<0.05 vs hyperglycemia. β3
AR indicates β3 adrenergic receptors; ACh, acetylcholine; CL, CL316243; eNOS, endothelial nitric oxide synthase; GSS, glutathionylation; HG, hyperglycemia; IB, immunoblot; IP, immunoprecipitate; ROS, reactive oxygen species.Activation of NADPH oxidase depends on translocation of its cytosolic p47phox subunit to the membrane, a translocation that is blocked by the cell‐permeable peptide gp91ds‐tat. We examined co‐immunoprecipitation of p47phox subunit with eNOS as an index of p47phox translocation to the membrane. p47phox/eNOS co‐immunoprecipitation was increased in hyperglycemic rabbits, with CL treatment significantly reducing it (Figure 5E), thus pointing to a probable effect of CL in decreasing hyperglycemia‐induced activation of the oxidase.Glutathionylation is a reversible reaction, with de‐glutathionylation catalyzed by Grx1. Since activation of Grx1 is believed to occur via translocation to its targets,26 we examined association of Grx1 with eNOS and β1 Na+‐K+ pump subunit by co‐immunoprecipitation as a surrogate for its activation. While co‐immunoprecipitation of both eNOS/Grx1 and β1 pump subunit/Grx1 was markedly decreased in hyperglycemia, CL treatment significantly increased these associations without changing Grx1 abundance (Figure 5F), thus suggesting that CL might have enhanced de‐glutathionylation by Grx1.
Effect of β3 AR Agonism on eNOS Glutathionylation in Human Diabetes
To assess the relevance of our findings in the S961 model of hyperglycemia to humandiabetes, we examined the changes in eNOS glutathionylation in vessels harvested from diabeticpatients and their matched controls (both groups had hypertension, dyslipidemia, and ischemic heart disease with no differences in age [70±3 versus 69±4 years]). Similar to the experimental model, there was an increase in eNOS‐GSS in vessels of diabeticpatients (Figure 6A). CL stimulated NO release in human endothelial cells (Figure 6B) and it decreased the levels of eNOS‐GSS in the vessels of diabeticpatients (Figure 6C). In contrast to signaling in cardiac myocytes, β3 AR stimulation in human vessels was not mediated by differential phosphorylation of eNOS27, 28 (Figure 7A) nor through nNOS28 as we did not detect a signal for nNOS expression in human endothelial cells or vessels of diabetic and nondiabetic patients, regardless of exposure to CL (Figure 7B). This might be due to very low constitutive expression of nNOS in endothelial cells.29 Taken together, these human data suggest the presence and support the potential significance of the redox pathways that we have examined in detail in the S961 model.
Figure 6
eNOS glutathionylation in vessels of diabetic humans and effects of β3
AR stimulation in human endothelial cells and vascular tissue. A, Glutathione (GSH) and eNOS IB of eNOS IP from homogenates of the arteries from diabetic patients and their matched nondiabetic controls. There was a nonsignificant trend for increase in eNOS/eNOS co‐immunoprecipitation in diabetics (bottom bands). The values for eNOS‐GSS shown in the panel are the mean of densitometries normalized to the corresponding eNOS/eNOS bands. The median of the densitometries was 0.95 (IQR 0.8–1.0) in nondiabetics vs 1.87 (IQR 1.66–2.04) in diabetics. n=4. IP with a nonspecific IgG was used as negative control. B, The effect of CL (1 μmol/L, 37°C, 1 hour) on basal NO‐sensitive DAF‐FM fluorescence in HUVECs. The cell nuclei were counterstained with DAPI (blue). n=4. Cells from 2 to 3 randomly chosen areas of interest in each group were analyzed. C, Glutathione‐ and eNOS IB of eNOS IP from homogenates of the freshly harvested arteries from diabetic patients exposed to CL (1 μmol/L, 37°C, 1 hour) ex vivo. Mean densitometries are shown. The median of the densitometries was 1.0 (IQR 0.89–1.24) in −CL group vs 0.48 (IQR 0.36–0.66) in +CL group. n=4. IP with a nonspecific IgG was used as negative control. *P<0.05 vs control. β3
AR indicates β3 adrenergic receptors; CL, CL316243; DAF‐FM, 4‐amino‐5‐methylamino‐2',7'‐difluorofluorescein; DAPI, 4',6‐diamidino‐2‐phenylindole; DAPI,; eNOS, endothelial nitric oxide synthase; GSS, glutathionylation; HUVECs, human umbilical vein endothelial cells; IB, immunoblot; IP, immunoprecipitate; IQR, interquartile range.
Figure 7
Effects of CL on eNOS phosphorylation in human endothelial cells, and expression of nNOS in human endothelial cells or vessels. A, Immunoblot (IB) of peNOS at serine 114 and 1177 residues from eNOS immunoprecipitate of HUVECs with (+CL) and without (−CL) exposure to CL (n=4). B, Immunoblots of nNOS in HUVECs, human myocardium (positive control), and arterial segments from diabetic (DM) and nondiabetic (non DM) patients exposed to CL ex vivo. CL indicates CL316243; eNOS, endothelial nitric oxide synthase; peNOS, phosphorylated endothelial nitric oxide synthase; HUVECs, human umbilical vein endothelial cells; IB, immunoblot; IP, immunoprecipitate; nNOS, neuronal nitric oxide synthase.
eNOS glutathionylation in vessels of diabetichumans and effects of β3
AR stimulation in human endothelial cells and vascular tissue. A, Glutathione (GSH) and eNOS IB of eNOS IP from homogenates of the arteries from diabeticpatients and their matched nondiabetic controls. There was a nonsignificant trend for increase in eNOS/eNOS co‐immunoprecipitation in diabetics (bottom bands). The values for eNOS‐GSS shown in the panel are the mean of densitometries normalized to the corresponding eNOS/eNOS bands. The median of the densitometries was 0.95 (IQR 0.8–1.0) in nondiabetics vs 1.87 (IQR 1.66–2.04) in diabetics. n=4. IP with a nonspecific IgG was used as negative control. B, The effect of CL (1 μmol/L, 37°C, 1 hour) on basal NO‐sensitive DAF‐FM fluorescence in HUVECs. The cell nuclei were counterstained with DAPI (blue). n=4. Cells from 2 to 3 randomly chosen areas of interest in each group were analyzed. C, Glutathione‐ and eNOS IB of eNOS IP from homogenates of the freshly harvested arteries from diabeticpatients exposed to CL (1 μmol/L, 37°C, 1 hour) ex vivo. Mean densitometries are shown. The median of the densitometries was 1.0 (IQR 0.89–1.24) in −CL group vs 0.48 (IQR 0.36–0.66) in +CL group. n=4. IP with a nonspecific IgG was used as negative control. *P<0.05 vs control. β3
AR indicates β3 adrenergic receptors; CL, CL316243; DAF‐FM, 4‐amino‐5‐methylamino‐2',7'‐difluorofluorescein; DAPI, 4',6‐diamidino‐2‐phenylindole; DAPI,; eNOS, endothelial nitric oxide synthase; GSS, glutathionylation; HUVECs, human umbilical vein endothelial cells; IB, immunoblot; IP, immunoprecipitate; IQR, interquartile range.Effects of CL on eNOS phosphorylation in human endothelial cells, and expression of nNOS in human endothelial cells or vessels. A, Immunoblot (IB) of peNOS at serine 114 and 1177 residues from eNOS immunoprecipitate of HUVECs with (+CL) and without (−CL) exposure to CL (n=4). B, Immunoblots of nNOS in HUVECs, human myocardium (positive control), and arterial segments from diabetic (DM) and nondiabetic (non DM) patients exposed to CL ex vivo. CL indicates CL316243; eNOS, endothelial nitric oxide synthase; peNOS, phosphorylated endothelial nitric oxide synthase; HUVECs, human umbilical vein endothelial cells; IB, immunoblot; IP, immunoprecipitate; nNOS, neuronal nitric oxide synthase.
Discussion
We have established a model of persistent hyperglycemia by competitive antagonism of insulin receptor by S961 and describe the pathophysiological vascular phenotype of the model. We set out to determine the redox effects of β3 AR stimulation in experimental hyperglycemia and it was important to first examine whether diabetes‐inducing agents have confounding effects on the target proteins of interest. The most commonly used diabetogenic agent STZ, a glucosamine‐nitrosourea taken up by pancreatic β cells causing their necrosis,30 decreased the oxidative modification of β1 Na+‐K+ pump subunit in vitro. With short in vitro exposure time, this is likely due to the property of STZ to release NO,31 shown to reduce β1 subunit glutathionylation.11 When administered at high toxic doses in vivo, STZ increases cellular ROS levels and causes undesirable extrapancreatic genotoxic effects that further complicate differentiation of STZ direct molecular effects from effects of diabetes that it induces.30 Alloxan, the second most commonly used diabetogenic agent, increased β1 pump subunit glutathionylation both in vitro and in vivo independently of diabetogenesis. These effects are consistent with ROS generation and thiol oxidizing properties of alloxan.32 In contrast to STZ and alloxan, S961 peptide had no effect on oxidative modification of β1 pump subunit in vitro, suggesting that it did not have direct redox effects on the Na+‐K+ pump.Effects of single injections of S961 on blood glucose over a period of hours have been previously reported.18 Here we show that blood glucose rises rapidly and remains stable when S961 is administered at a constant rate, contrasting the early instability that often includes life‐threatening hypoglycemia after injection of STZ or alloxan. It is an advantage of this new model that blood glucose levels are readily titrated to a target range with a change in infusion rate.25 The model also allows cessation of infusion at any time and hence studying the reversibility of the effects caused by the hyperglycemic state. We detected no effect on metabolic variables except serum glucose for the duration of S961 infusion and, importantly, no effects on nutritional status or ketoacidosis, a complication often seen in alloxan‐ and STZ‐induced diabetes. Ketoacidosis increasesROS generation independently of hyperglycemia.30 Of mechanistic importance, S961 provides a model of hyperglycemia and insulin signaling blockade, central features in pathobiology of vascular disease in diabetes16, 17 as opposed to the commonly used insulinopenic hyperglycemia models where insulin signaling is usually unaltered. In this study we infused S961 for 7 days. However, in principle, it should be possible to use the model for the study of hyperglycemia for longer durations.In S961‐induced hyperglycemia, we show that activation of β3 ARs improves endothelial function through modulation of oxidative pathways that lead to recoupling of eNOS and re‐establishment of NO/redox balance (summarized in Figure 8). Although these effects are shown in relatively short‐term hyperglycemia, our recent report of protective effects of β3 AR agonism in the heart in hyperglycemic state,25, 33 the close similarities of β3 AR‐induced redox effects with angiotensin‐converting enzyme inhibitors,7 and presence of the β3 AR‐mediated effects in vascular tissue of diabeticpatients we show here point to potential therapeutic benefit of β3 AR agonists for cardiovascular protection in diabetes.
Figure 8
β3
AR stimulation, redox‐ and NO‐dependent signaling and endothelial function in hyperglycemia. A, NADPH oxidase (NOX) is activated in aorta of rabbits with S961‐induced hyperglycemia, increasing the levels of ROS. ROS can directly scavenge and decrease NO levels, increase eNOS glutathionylation (eNOS‐GSS) and, possibly, impair de‐glutathionylation by affecting the activity of glutaredoxin‐1 (Grx1) through yet unknown but likely redox‐dependent mechanism(s)26 (dashed line). Glutathionylation‐mediated eNOS uncoupling results in eNOS‐derived ROS generation, which might further increase eNOS‐GSS and reduce NO bioavailability in endothelial cells (ECs) and impair relaxation of vascular smooth muscle cells (VSMCs). B, The β3
AR agonist CL316243 (CL) increases NO. NO effect in reducing ROS by direct quenching may also decrease eNOS‐derived ROS by reducing ROS‐induced eNOS‐GSS (green cross). Additionally, NO may decrease NOX activity (dashed line). An increase in Grx1/eNOS association by CL suggests enhanced eNOS de‐glutathionylation by Grx1. These changes induced by CL culminate in enhanced vasodilatation, which my in turn reduce blood pressure (dotted arrow). A decrease in blood pressure per se may contribute to these beneficial changes (dotted line). β3
AR indicates β3 adrenergic receptors; eNOS, endothelial nitric oxide synthase; GSS, glutathionylation; ROS, reactive oxygen species.
β3
AR stimulation, redox‐ and NO‐dependent signaling and endothelial function in hyperglycemia. A, NADPH oxidase (NOX) is activated in aorta of rabbits with S961‐induced hyperglycemia, increasing the levels of ROS. ROS can directly scavenge and decrease NO levels, increase eNOS glutathionylation (eNOS‐GSS) and, possibly, impair de‐glutathionylation by affecting the activity of glutaredoxin‐1 (Grx1) through yet unknown but likely redox‐dependent mechanism(s)26 (dashed line). Glutathionylation‐mediated eNOS uncoupling results in eNOS‐derived ROS generation, which might further increase eNOS‐GSS and reduce NO bioavailability in endothelial cells (ECs) and impair relaxation of vascular smooth muscle cells (VSMCs). B, The β3
AR agonist CL316243 (CL) increases NO. NO effect in reducing ROS by direct quenching may also decrease eNOS‐derived ROS by reducing ROS‐induced eNOS‐GSS (green cross). Additionally, NO may decrease NOX activity (dashed line). An increase in Grx1/eNOS association by CL suggests enhanced eNOS de‐glutathionylation by Grx1. These changes induced by CL culminate in enhanced vasodilatation, which my in turn reduce blood pressure (dotted arrow). A decrease in blood pressure per se may contribute to these beneficial changes (dotted line). β3
AR indicates β3 adrenergic receptors; eNOS, endothelial nitric oxide synthase; GSS, glutathionylation; ROS, reactive oxygen species.S961 infusion increased vascular levels of ROS, recapitulating a central feature in the pathophysiology of diabetes‐induced vascular disease. The effects of gp91ds‐tat to increase endothelium‐dependent vasorelaxation and to reduce eNOS glutathionylation in aorta of hyperglycemic rabbits as opposed to no effects in controls suggest that NADPH oxidase is pathologically activated in the vasculature of hyperglycemic rabbits and that its activation is upstream to glutathionylation‐mediated eNOS uncoupling and endothelial dysfunction. This is consistent with NADPH oxidase as the major source of ROS in other experimental models of diabetes34 and vessels of diabetichumans.35 Since gp91ds‐tat prevents docking of the cytosolic p47phox subunit to the membranous gp91phox, the isoforms activated in S961 hyperglycemia are likely Nox1 or Nox2, which require p47phox translocation to membrane.2 Consistent with this, we detected an increase in co‐immunoprecipitation of p47phox with eNOS, a surrogate for association/translocation of the subunit to membrane, in aorta of hyperglycemic rabbits. Complex interactions between membrane and cytosolic sources of ROS such as mitochondria and xanthine oxidase in endothelial cells have been previously shown.36 Although we implicate NADPH oxidase‐mediated eNOS uncoupling as an upstream event in vessels of S961 hyperglycemic rabbits, a crosstalk with other sources of ROS and their activation in the vessel wall is also likely. The lower levels of NO in hyperglycemia can be the result of scavenging by NADPH oxidase‐derived ROS. Additionally, a shift in redox potential by ROS can promote eNOS glutathionylation and uncoupling. Thus, eNOS glutathionylation acts as a mechanism for amplification of ROS generation, exacerbating NO/redox imbalance in hyperglycemia.To examine the putative mechanisms for eNOS uncoupling, we focused on eNOS glutathionylation as it is an enzymatically reversible mechanism (like phosphorylation) and is likely to be involved in pathophysiological signaling, in particular in our model of relatively short‐term hyperglycemia. It is plausible that increased redox stress by eNOS glutathionylation‐mediated O2
•− generation may also lead to BH4 depletion that can play a role in eNOS uncoupling in S961‐induced hyperglycemia. Such a role might particularly be of more pathological significance over extended periods of hyperglycemia. Supportive evidence for a potential role of BH4 in S961 hyperglycemia is provided by our observations in isolated cardiac myocytes where incubation of the myocytes with L‐sepiapterin, a cell‐permeable immediate precursor of BH4 that is converted to BH4 intracellularly via the pterin salvage pathway,37 increased the electrogenic Na+‐K+ current in voltage clamped cardiomyocytes of rabbits with S961 hyperglycemia (unpublished data). This increase in pump current was abolished by L‐N
G‐nitroarginine methyl ester, showing that stimulation was mediated by eNOS‐derived NO production enhanced by ex vivo supplementation of BH4. In previous reports we have shown that NO generation from eNOS stimulates the Na+‐K+ pump,10, 38 and conditions that cause eNOS uncoupling inhibit the Na+‐K+ pump.24, 39This scheme shows a direct and physiologically important signaling interaction between these 2 important membrane biomolecules that colocalize in the structured membrane signaling microdomains40 where changes in redox milieu are sensed by eNOS and transduced to regulation of the Na+‐K+ pump function via redox‐dependent mechanisms. We have shown that eNOS glutathionylation is also increased in cardiac myocytes of S961 hyperglycemic rabbits and contributes to oxidative pump inhibition.25 The effect of L‐sepiapterin to stimulate Na+‐K+ pump from a basal inhibited state compared to controls suggests that decreased BH4 may coexist and play a role in eNOS uncoupling in the S961 model.Reversal of glutathionylation of proteins (ie, de‐glutathionylation) is catalyzed by Grx1. Grx1 is implicated in regulation of many intracellular processes related to homeostasis and stress response,26 including redox‐mediated regulation of eNOS function.41 Despite its important roles, mechanisms regulating cellular activity of Grx1 are poorly understood. It has been proposed that association of Grx1 with scaffolding proteins (eg, caveolae in membrane lipid rafts) may regulate Grx1 function, as the activity of the enzyme is thought to occur via an encounter reaction.26 Consistent with this proposal, we show that Grx1 co‐immunoprecipitates with eNOS in rabbit aorta. Interestingly, despite no change in the abundance of Grx1 in hyperglycemia, and an increase in glutathionylation of eNOS, we detected markedly lower signals for Grx1/eNOS co‐immunoprecipitation in aorta of hyperglycemic rabbits. This suggests that interaction of Grx1 with its substrate (ie, glutathionylated cysteines) is not determined by abundance of the substrate, but by other disease‐related mechanisms. ROS and reactive nitrogen species reduce Grx1 activity41; therefore, it is likely that hyperglycemia may impair the enzyme function through redox‐related mechanisms, leading to a decrease in de‐glutathionylation and thereby increase in eNOS glutathionylation.Infusion of CL restored NO levels in aorta of hyperglycemic rabbits. These effects of CL could be the result of less quenching of NO by the decreased levels of ROS, a reduction in ROS‐induced eNOS glutathionylation, and an increase in eNOS/Grx1 interaction promoting eNOS de‐glutathionylation and recoupling. The effect of CL to decrease eNOS glutathionylation is in agreement with higher eNOS glutathionylation in the hearts of β3 AR−/− mice we have recently reported,25 suggesting that both constitutive‐ and agonist‐induced activation of the receptor is necessary to maintain eNOS in coupled state. In contrast to NO release by β3 AR stimulation, in vivo treatment with an external NO donor increases eNOS glutathionylation,42 an effect that is consistent with NO donor‐induced endothelial dysfunction. These differential effects are likely due to regulated endogenous NO generation via receptor‐coupled pathway in the membrane signalosomes as opposed to general exposure of cells to uncontrolled levels by external NO donors. Although not examined, it is plausible that other antioxidant mechanisms in addition to the thiol reductase system are facilitated by treatment with CL, restoring NO levels in hyperglycemic rabbits. Since activation of insulin receptors is coupled to eNOS stimulation,17 blockade of insulin receptor by S961 might have also contributed to reduced NO bioavailability in hyperglycemic rabbits. Because of the marked counter‐regulatory increase in insulin levels, slightly higher affinity of insulin in binding to insulin receptor compared to S961 and competitive nature of antagonism of the insulin receptor by S961 shown previously,18 the blockade of insulin receptor–coupled signaling in S961 hyperglycemia is likely relative and not absolute. Moreover, near‐complete restoration of NO bioavailability by CL co‐administered with S961 suggests that insulin‐receptor‐coupled eNOS activation probably did not significantly contribute to lower NO levels in S961 hyperglycemic rabbits.The effect of CL in decreasing O2
•− levels is the result of recoupling of eNOS as well as a decrease in NADPH oxidase activation as suggested by reduction in p47/eNOS co‐immunoprecipitation. NO can directly inhibit NADPH oxidase by nitrosylation of p47, although this does not affect its membrane translocation.43 Other putative mechanisms are oxidative modification of cysteines on p47, important in downregulation of the enzyme,44 and, as recently reported by our group in cardiac myocytes, by NO signaling‐mediated dephosphorylation and inactivation of p47 subunit by protein phosphatase 2A.38CL decreased hyperglycemia‐induced glutathionylation of β1 Na+‐K+ pump subunit, a redox modification that inhibits the pump,23, 24 and enhanced pump activity as implied by increased K+‐induced vasorelaxation. This should largely reflect the signal from vascular smooth muscle cells as the media layer constitutes the major part of the vascular wall. We have previously shown that AngII inhibits the pump in vascular smooth muscle cells via an NADPH oxidase‐dependent increase in β1 subunit glutathionylation.23 CL restored NO bioavailability in aorta and we have shown that β3 AR stimulation in cardiac myocytes decreases glutathionylation of the Na+‐K+ pump via NO‐dependent mechanisms in vitro10 and in vivo in hyperglycemia.25 A reduction in NO bioavailability in endothelial cells of hyperglycemic rabbits diffusing into the subjacent vascular smooth muscle cells is a likely mechanism by which glutathionylation of β1 Na+‐K+ subunit is increased, and reversed by re‐establishment of NO levels by β3 AR agonism. Moreover, similar to what we observed with eNOS, CL also enhanced co‐immunoprecipitation of Grx1 with β1 subunit, which may indicate facilitation of β1 subunit de‐glutathionylation. Given the central role of the pump in regulation of cellular homeostasis, enhancement of Na+‐K+ pump function by CL is expected to contribute to improved vascular function in diabetes.23Vasodilatory effects of nebivolol, a highly selective β1 AR blocker, in arteries of normal animals have been reported to occur via β3 AR agonism.45 However, nebivolol has a weak affinity for human β3 AR and elicited no receptor‐coupled response in Chinese hamster ovary cells expressing β3 ARs.46 Using CL, with its high selectivity for β3 ARs47 and high efficacy,48 we show potent, novel antioxidant and vasoprotective effects of β3 AR stimulation in hyperglycemia. Glutathionylation of eNOS has been reported in STZ‐induced diabetes.49 Our recent report of eNOS glutathionylation as a critical switch in AngII‐induced endothelial dysfunction7 suggested a mechanistic rationale for renin–angiotensin system–mediated diabetes‐induced complications.17 The current study shows the central role of this oxidative modification of eNOS in the pathophysiology of vascular dysfunction, its cellular regulatory mechanisms, a novel therapy that modulates it in experimental hyperglycemia, and provides supportive evidence for potential significance of this pathway in humandiabetes.Early rodent models of diabetes and obesity showed promising effects of β3 AR agonists on glycemic control and weight loss. However, subsequent human trials were disappointing, at least in part due to major differences in pharmacology of the agonists between rodent and human receptors, differences in tissue‐dependent expression levels, poor selectivity of the agonists for β3‐ versus β1/β2 ARs, and unsatisfactory oral bioavailability and pharmacokinetic properties.50 Problems with pharmacological properties have been overcome51 and one compound, Mirabegron, is now in clinical use for overactive bladder syndrome.52 Evidence from experimental models that support beneficial effects of β3 AR agonists in failing heart is accumulating,10, 11, 52, 53, 54 and a phase 2 first‐in‐human clinical trial of Mirabegron in chronic heart failure has recently been completed.55 The protective effects of a β3 AR agonist in hyperglycemia we report suggest that they can be potentially useful in treating the vascular dysfunction and cardiovascular complications of diabetes. We believe such a use deserves further clinical investigation.
Sources of Funding
The project was supported by a project grant from Australian National Health & Medical Research Council (NHMRC grant 633252). Karimi Galougahi was supported by a Heart Research Australia Scholarship and Lucy Falkiner Fellowship from University of Sydney Medical School Foundation, Liu by a Heart Foundation Fellowship (PF 12S 6924), and Figtree by University of Sydney Medical School Foundation and a co‐funded NHMRC/Heart Foundation Fellowship.
Authors: Vabren L Watts; Fernando M Sepulveda; Oscar H Cingolani; Alice S Ho; Xiaolin Niu; Rosa Kim; Karen L Miller; Koenraad Vandegaer; Djahida Bedja; Kathleen L Gabrielson; Gerald Rameau; Brian O'Rourke; David A Kass; Lili A Barouch Journal: J Mol Cell Cardiol Date: 2013-05-02 Impact factor: 5.000
Authors: Kristen J Bubb; Dhanya Ravindran; Siân P Cartland; Meghan Finemore; Zoe E Clayton; Michael Tsang; Owen Tang; Mary M Kavurma; Sanjay Patel; Gemma A Figtree Journal: Front Pharmacol Date: 2021-04-22 Impact factor: 5.810
Authors: Stefania Schiavone; Giulia M Camerino; Emanuela Mhillaj; Margherita Zotti; Marilena Colaianna; Angelo De Giorgi; Antonello Trotta; Francesco P Cantatore; Elena Conte; Maria Bove; Paolo Tucci; Maria G Morgese; Luigia Trabace Journal: Front Pharmacol Date: 2017-11-08 Impact factor: 5.810
Authors: Kristen J Bubb; Jason A Harmer; Meghan Finemore; Sarah Joy Aitken; Zara S Ali; Laurent Billot; Clara Chow; Jonathan Golledge; Rebecca Mister; Michael P Gray; Stuart M Grieve; Naomi Hamburg; Anthony C Keech; Sanjay Patel; Vikram Puttaswamy; Gemma A Figtree Journal: BMJ Open Date: 2021-09-28 Impact factor: 2.692
Authors: Raffaele Altara; Mauro Giordano; Einar S Nordén; Alessandro Cataliotti; Mazen Kurdi; Saeed N Bajestani; George W Booz Journal: Front Endocrinol (Lausanne) Date: 2017-07-17 Impact factor: 5.555