| Literature DB >> 26661793 |
Makoto Hirayama1, Hiromi Shibata1, Koji Imamura2, Takemasa Sakaguchi3, Kanji Hori4.
Abstract
We previously reported that aEntities:
Keywords: Alga; Anti-viral lectin; Carageenophyta; HIV; Kappaphycus alvarezii
Mesh:
Substances:
Year: 2015 PMID: 26661793 PMCID: PMC7088246 DOI: 10.1007/s10126-015-9684-2
Source DB: PubMed Journal: Mar Biotechnol (NY) ISSN: 1436-2228 Impact factor: 3.619
Fig. 1A diagram of recombinant KAA-1 (rKAA-1) expression vector pET28a-rKAA1. rKAA-1 was expressed as a 6-His- and thrombin cleavage site-fused protein
Fig. 2Isolation of PE-KAA-2 and PE-ESA-2 by reverse-phase HPLC. PE-KAA-2 (a) and PE-ESA-2 (b) were purified by RP-HPLC on YMC-Pack PROTEIN-RP column. The eluate was monitored by absorbance at 280 nm and the active fraction represented by a bar was recovered. Deconvoluted mass spectra of purified PE-KAA-2 (a) and PE-ESA-2 (b) using ESI-MS (LCQ) are also represented. c SDS-PAGE of PE-KAA-2 (lane 1) and PE-ESA-2 (lane 2). Five micrograms of protein was loaded in each lane. M molecular weight marker
Fig. 3Peptide fragments generated by trypsin digestion of PE-KAA-2 and PE-ESA-2. Peptide fragments produced by trypsin digestion of PE-KAA-2 (a) and PE-ESA-2 (b) were purified by RP-HPLC on TSKgel ODS-120T column, and their enlarged images (c) are shown to compare the peak patterns. The peaks were numbered in serial order of retention time. Peaks 11, 12, 15, 16, and 23, and peaks 13, 20, and 21 were unique for PE-KAA-2 and PE-ESA-2, respectively
The molecular masses of peptide fragments produced by digesting PE-KAA-2 and PE-ESA-2 with trypsin and their corresponding sequence in ESA-2
| PE-KAA-2 | PE-ESA-2 | Sequence in ESA-2 | |||
|---|---|---|---|---|---|
| Peak no. | Determined molecular mass | Peak no. | Determined molecular mass | Calculated molecular mass | |
| 1 | 1023.6 | 1 | 1023.6 | 1024.1 | 230HNQNITAVK238 |
| 2 | 1275.4 | 2 | 1275.6 | 1276.3 | 247NLDGTCTYER256 |
| 3 | 1069.9 | 3 | 1069.5 | 1070.2 | 180TLEGTMQYK188 |
| 4 | 1171.4 | 4 | 1170.8 | 1172.3 | 113TLTGTMTYER122 |
| 5 | 746.2 | 5 | 746.3 | 746.9 | 123EGPIGFK129/257EGPIGFK263 |
| 6 | 831.3 | 6 | 831.3 | 831.9 | 189GEGPIGFR196 |
| 7 | 1588.7 | 7 | 1588.7 | 1589.7 | 96SGQGVLAVNITSSDGGK112 |
| 8 | 2539.5 | 8 | 2540.7 | 2540.6 | 130GTQSGGDTYNVENQWGGSSAPWNK153 |
| 9 | 2540.3 | 9 | 2539.5 | 2540.6 | 130GTQSGGDTYNVENQWGGSSAPWNK153 |
| 10 | 2550.8 | 10 | NDa | ||
| 11 | 2364.7 | –b | |||
| 12 | 1001.5 | – | |||
| – | 13 | 3403.5 | 3402.7 | 28GNQNVMAVDVNSSDGGANLNGTMTYSGEGPIGFK61 | |
| 14 | 957.4 | 14 | 957.4 | 958.1 | 154AGIWALGDR162 |
| 15 | 3490.5 | – | |||
| 16 | 3450.1 ± 3.96c | – | |||
| 17 | 3348.2 | 17 | 3348.5 | 3348.6 | 65RGESNVYDVENQWGGSSAPWHAGGQFVIGSR95 |
| 18 | 3347.3 | 18 | 3347.5 | 3348.6 | 65RGESNVYDVENQWGGSSAPWHAGGQFVIGSR95 |
| 19 | 3375.3 | 19 | 3375.9 | ||
| – | 20 | 3293.9 | 3293.5 | 199LSGANNYSVENQWGGSSAPWNAAGDWLIGDR229 | |
| – | 21 | ND | |||
| 22 | ND | 22 | 3293.0 | 3293.5 | 199LSGANNYSVENQWGGSSAPWNAAGDWLIGDR229 |
| 23 | 2759.8 ± 10.99c | – | |||
| 24 | 2763.3 | 24 | 2763.9 | 2764.0 | 3YTVQNQWGGSSAPWNDAGLWILGSR27 |
| 25 | 2763.2 | 25 | 2763.1 | 2764.0 | 3YTVQNQWGGSSAPWNDAGLWILGSR27 |
| 26 | 2800.2 | 26 | 2796.2 | 2764.0 | 3YTVQNQWGGSSAPWNDAGLWILGSR27 |
aNot determined
bNo consistent peak
cStandard error of >1.0 are represented
Fig. 4The predicted amino acid sequence of native KAA-2. The results of sequence prediction by peptide mapping in KAA-2 are shown using ESA-2 sequence as a template. The peptide fragments produced by trypsin digestion of PE-KAA-2 are represented with arrows. The peak numbers examined by Edman degradation and their determined sequences are underlined. The sequences whose peptide masses were consistent with those of ESA-2 are represented in bold. Unidentified amino acids in KAA-2 are represented as lowercase letter of corresponding sequence in ESA-2. Shaded regions in the sequence were used to design the degenerated primers for cDNA cloning
Fig. 5Nucleotide and deduced amino acid sequences of KAA-1. a Nucleotide and deduced amino acid sequences of the cDNA encoding KAA-1. The stop codon is shown as an asterisk. The italicized and nonitalicized numbers represent the positions of nucleotides and amino acids, respectively. Initiating methionine is indicated in italic. The 20 N-terminal amino acid sequence elucidated in Kawakubo et al. (1999) is underlined. b Comparison among deduced amino acid sequences of KAA-1 and KAA-2, and the sequence predicted by peptide mapping for native KAA-2 (see Fig. 2). Lowercase letters in native KAA-2 sequence represent the corresponding sequences in ESA-2. Amino acid substitutions among KAAs were boxed. The nucleotide sequence data of KAA-1 and KAA-2 appear in the DDBJ, EMBL, and GenBank databases under accession number LC007080 and LC007081, respectively
Fig. 6Alignment of amino acid sequences from KAAs and related proteins. Identical and similar residues among all proteins are indicated with black and gray backgrounds, respectively. Amino acids that interact with mannopentaose (Manα1-6(Manα1-3)Manα1-6(Manα1-3)Man) of M8/9 core unit in Burkholderia oklahomensis agglutinin (BOA) are indicated with asterisks. Data were cited from the following: Eucheuma serra agglutinin-2 (ESA-2, GenBank accession no. P84331), Burkholderia oklahomensis agglutinin (BOA, AIO69853), Myxococcus xanthus agglutinin (myxobacterial hemagglutinin (MBHA), M13831), Oscillatoria agardhii agglutinin (OAA, P84330), and Pseudomonas fluorescens lectin (PFL, ABA72252)
Fig. 7Preparation of rKAAs. a Nonreducing SDS-PAGE for purified His-rKAA-1 (lane 1) and rKAA-1 (lane 2). Five micrograms of each protein was loaded. M molecular weight marker. ESI-MS multiply charged spectra of purified His-rKAA-1 (b) and rKAA-1 (c) were shown
Hemagglutination-inhibition test of native and recombinant KAAs with sugar compounds
| Sugars and glycoproteins | Minimum inhibition concentration | |||
|---|---|---|---|---|
| KAA-1 | KAA-2 | His-rKAA-1 | rKAA-1 | |
| Monosaccharides and disaccharide (mM)a | >100 | >100 | >100 | >100 |
| Glycoproteins (mg/ml) | ||||
|
| ||||
| High-mannose type | ||||
| Yeast mannan | 31.3 | 62.5 | 31.3 | 62.5 |
| High-mannose and complex types | ||||
| Porcine thyroglobulin (PTG) | 15.6 | <7.8 | 15.6 | 31.3 |
| Asialo-PTG | <7.8 | <7.8 | <7.8 | 15.6 |
| Complex type | ||||
| Transferin | >1000 | >1000 | 1000 | >1000 |
| Asialo-transferin | 500 | 250 | 250 | 500 |
|
| ||||
| Fetuin | >1000 | >1000 | >1000 | >1000 |
| Asialo-fetuin | 250 | 250 | 250 | 500 |
|
| ||||
| Bovine submaxirally mucin (BSM) | 62.5 | 125 | 125 | 250 |
| Asialo-BSM | 31.3 | 31.3 | 62.5 | 125 |
aMonosaccharides (100 mM) (Glc, Man, Gal, GlcNAc, GalNAc, Rha, Fuc, Xyl, NeuAc) and a disaccharide (lactose) did not inhibit hemagglutination activities of four lectins
Fig. 8Structures of PA-oligosaccharides used in this study. Closed circle, galactose; open circle, mannose; closed triangle, glucose; open triangle, fucose; closed square, N-acetylglucosamine; open square, N-acetylgalactosamine; closed diamond, N-acetylneuraminic acid
Fig. 9Interaction analysis between rKAAs and various oligosaccharides by a centrifugal ultrafiltration-HPLC method. a Binding activities of rKAAs to PA-oligosaccharides. Binding activity was expressed as a ratio (%) of the amount of a bound oligosaccharide to that of an added oligosaccharide. The assay was performed in duplicate for each PA-oligosaccharide, and the activity is expressed as the average value from duplicate assays. The activities less than 10 % were cut off for their insignificance. b The detailed binding activities of rKAAs with high-mannose-type N-glycans. Dashed boxes represent the nonreducing terminal α1-2 linked mannose residue in the D2 arm
Fig. 10Interaction of KAAs with an HIV envelope glycoprotein gp120. SPR analyses for interaction between gp120 and His-rKAA-1 (a) or rKAA-1 (b) were analyzed with BIAcore2000. Each sensorgram represents the binding activity of rKAAs to gp120 on sensor chip. Ninety microliters of rKAAs solutions of each represented concentration were injected into the flow cells at 30 μl/min for 3 min. The binding response (black line) in resonance units is plotted against time (s). Binding kinetics of the interactions between rKAAs and gp120 (overlaid red line) were calculated by fitting the data to Langmuir model for 1:1 binding. c Comparison of binding activity to gp120 among KAAs including His-rKAA-1, rKAA-1, KAA-1, and KAA-2. SPR analysis was performed using 0.98 nM of each lectin solution by the same method as described above (color figure online)
Summary of binding kinetics of the interactions between rKAAs and gp120
| Lectin | ka (M−1s−1) | kd (s−1) | KA (M−1) | KD (M) |
|---|---|---|---|---|
| His-rKAA-1 | 8.71 × 105 | 5.90 × 10−4 | 1.48 × 109 | 6.77 × 10−10 |
| rKAA-1 | 8.50 × 105 | 5.29 × 10−4 | 1.61 × 109 | 6.22 × 10−10 |
k association rate constant, k dissociation rate constant, K association constant, K dissociation constant
Neutralization of HIV-1 by native KAAs and a recombinant KAA-1
| Lectin | IC50 (nM) (± SD) |
|---|---|
| KAA-1 | 9.2 ± 2.2 |
| KAA-2 | 7.3 ± 1.9 |
| His-rKAA-1 | 12.9 ± 2.2 |
SD standard deviation