Literature DB >> 25940225

Enhancing the light-driven production of D-lactate by engineering cyanobacterium using a combinational strategy.

Chao Li1, Fei Tao1, Jun Ni1, Yu Wang1, Feng Yao1, Ping Xu1.   

Abstract

It is increasingly attractive to engineer cyanobacteria for bulk production of chemicals from CO2. However, cofactor bias of cyanobacteria is different from bacteria that prefer NADH, which hampers cyanobacterial strain engineering. In this study, the key enzyme d-lactate dehydrogenase (LdhD) from Lactobacillus bulgaricus ATCC11842 was engineered to reverse its favored cofactor from NADH to NADPH. Then, the engineered enzyme was introduced into Synechococcus elongatus PCC7942 to construct an efficient light-driven system that produces d-lactic acid from CO2. Mutation of LdhD drove a fundamental shift in cofactor preference towards NADPH, and increased d-lactate productivity by over 3.6-fold. We further demonstrated that introduction of a lactic acid transporter and bubbling CO2-enriched air also enhanced d-lactate productivity. Using this combinational strategy, increased d-lactate concentration and productivity were achieved. The present strategy may also be used to engineer cyanobacteria for producing other useful chemicals.

Entities:  

Mesh:

Substances:

Year:  2015        PMID: 25940225      PMCID: PMC4419521          DOI: 10.1038/srep09777

Source DB:  PubMed          Journal:  Sci Rep        ISSN: 2045-2322            Impact factor:   4.379


Due to heavy use of fossil resources, atmospheric CO2 levels have increased approximately by 25% during the past 150 years1. The increased CO2 level has greenhouse effects and has altered the emissions of methane and nitrous oxide, which have a much higher global warming potential than CO22. Because of these concerns, biomass resources such as sugars are considered as the major substitutes for fossil resources3. However, using biomass as fossil substitutes leads to direct competition for resources between energy and food supplies. Therefore, it is necessary to develop biosynthetic processes which don’t need to use edible biomass as feedstocks. Direct conversion of CO2 to biofuels and carbohydrates using photoautotrophic organisms such as cyanobacteria can resolve the issues regarding both CO2 emission and resources shortage simultaneously1. d-Lactate, an isomeric form of lactate, is used as basic feedstock of biodegradable polylactide, a well-known sustainable bioplastic material with lots of commercial applications4. d-Lactate is a chiral chemical, which is also used in the pharmaceutical industry and as a precursor for industrial chemicals such as cosmetics5. Moreover, its ester derivatives can be used to produce perfumes, coatings, adhesives, and printing ink, and have applications in the electronics industry567. Generally, d-lactate is produced by lactic acid bacteria from foods containing hexoses and pentoses or from sugar-containing raw materials789. To reduce utilization of food-related biomass resources, it is necessary to design cell factories that can directly use CO2 as the carbon source. More importantly, the cell factories consume CO2, thereby relieving material shortage and retarding climate change110. As lactate biosynthesis in cyanobacteria is attractive, several studies have investigated lactate production in cyanobacteria1112131415161718. However, engineering of cyanobacteria for d-lactate production is limited by relatively low productivity, although efforts have been made to enhance its biosynthesis through both genetic engineering and optimization of culture conditions141617. Low productivity may be attributed to cofactor imbalance (insufficient supply of NADH), because cyanobacteria produce NADPH as the major carrier of reducing equivalents19. This hypothesis was confirmed by previous studies where soluble transhydrogenase (sth) was introduced into cyanobacteria during d-lactate synthesis111617. Other studies using native NADPH-dependent enzymes were successful with high titers of target products320212223. However, considering that bacterial NADH-dependent oxidoreductases are more abundant than NADPH-dependent ones, it would be interesting to reverse coenzyme specificity using protein engineering242526272829. Recently, Angermayr et al.13 reported that genetically engineered l-lactate dehydrogenase (coenzyme specificity changed from NADH to NADPH) resulted in increased l-lactate production in Synechocystis sp. PCC6803. Therefore, rational creation of efficient d-lactate dehydrogenase features a high preference for NADPH, and it is promising to utilize NADPH in cyanobacteria for d-lactate production. In this study, a combinational strategy was used for construction of a cyanobacterial strain for d-lactate production. Firstly, the comparison of cyanobacterial genomes was performed. Then Synechococcus elongatus PCC7942 was selected as the host strain because it lacks l- and d-lactate dehydrogenases, ethanol dehydrogenase, and formate-lyase genes (GenBank ID, CP000100), and could grow to high density within enclosed bioreactors30. Secondly, the coenzyme specificity of the key d-lactate producing enzyme, LdhD, was switched from NADH to NADPH by protein engineering. Thirdly, codon usage of LdhD was optimized. Furthermore, as photoautotrophs, cyanobacteria generally lack transporters to move hydrophilic organic molecules across cell membranes31. Therefore, a lactate transporter was integrated into S. elongatus PCC7942. Finally, CO2 bubbling was used to enhance d-lactate production by the constructed S. elongatus strain.

Results

Switching the coenzyme specificity of LdhD

Bacteria are important gene sources for cyanobacterial engineering. For example, bacteria possess a large number of NADH-dependent oxidoreductases, which are crucial enzymes in metabolic pathways. Unfortunately, the concentration of NADPH in cyanobacteria is much higher than that of NADH19; this limits the application of NADH-dependent oxidoreductases in cyanobacteria. A previous study has shown that it is possible to reverse the coenzyme specificity of xylitol dehydrogenase (XDH) from NADH to NADPH using site-directed mutagenesis25. To design NADPH-dependent enzymes for cyanobacterial engineering, several key enzymes in bacterial pathways were analyzed. As shown in Table S1, there are sequence gaps around the putative coenzyme binding regions of the first four enzymes, but Asp176-Asn180 in LdhD and its corresoponding regions in XDH and other enzymes are obviously homologous, indicating that aspartate, asparagine, and the hydrophobic residues are conserved. Therefore, these enzymes may be engineered to utilize NADPH as the preferred cofactor. D-Lactate is a bio-based chemical that can be produced by fermentation. The key enzyme for d-lactate production in Lactobacillus bulgaricus ATCC1184232 has the same discriminatory sites between NADH and NADPH (Asp176, Ile177, Phe178, and Asn180) as XDH (Table 1). Thus, this enzyme was selected to investigate the applications of LdhD in cyanobacterial engineering. To evaluate the effect of single substitution mutation on cofactor specificity, four single mutants, LdhDnA (D176A), LdhDnR (I177R), LdhDnS (F178S), and LdhDnR2 (N180R), were constructed and were expressed in recombinant Escherichia coli BL21(DE3) (Table S2). All four single mutations produced positive effects on NADPH kinetics, compared with wild-type LdhD, suggesting that these single substitutions might contribute independently to cofactor reversal in LdhD (Table 2). However, these single mutants still preferred NADH to NADPH.
Table 1

Partial amino acid sequences alignment of NAD(P)H-binding regions.

EnzymeAmino acid sequence
 SiteCoenzyme
XDHa181VFGAGPVGLLAAAVAKTFGAKGVIVVDIFDNKLKMAKDIGAATHTFNSK
XDHARSdR b181VFGAGPVGLLAAAVAKTFGAKGVIVVARSDRKLKMAKDIGAATHTFNSK
LdhDa150GVIGTGHIGQVFMQIMEGFGAKVIAYDIFRNPELEKKGYYVDSLDDLYK
LdhDnARSdR b150GVIGTGHIGQVFMQIMEGFGAKVIAYARSRRPELEKKGYYVDSLDDLYK

aXDH, xylitol dehydrogenase; LdhD, d-lactate dehydrogenase.

bXDHARSdR, cofactor altered xylitol dehydrogenase; LdhDnARSdR, cofactor altered d-lactate dehydrogenase. The coenzyme binding regions are underlined and in bold.

Table 2

Kinetic parameters of purified LdhDs for NADH, NADPH, and pyruvate

 Specific activitya
Kinetic parameters
EnzymeNADHNADPHNADH
NADPH
   Kmkcatkcat/KmKmkcatkcat/Km
 unit mg1mMs1M1s1mMs1M1s1
LdhD361 ± 29.3NDb2.3 ± 0.1*561 ± 41.9*(2.4 ± 0.2) × 105 *ND*ND*ND*
   1.1 ± 0.1**441 ± 31.8**(4.0 ± 0.3) × 105 **ND**ND**ND**
LdhDA156 ± 13.252.5 ± 4.85.9 ± 0.4*190 ± 15.2*(3.2 ± 0.3) × 104 *6.4 ± 0.7*33.0 ± 2.2*(5.2 ± 0.6) × 103 *
   6.2 ± 0.5**270 ± 21.1**(4.3 ± 0.3) × 104 **5.9 ± 0.5**3.1 ± 0.4**(1.9 ± 0.1) × 103 **
LdhDR268 ± 21.32.7 ± 0.23.0 ± 0.2*439 ± 34.8*(1.5 ± 0.1) × 105 *20.0 ± 1.5*42.8 ± 4.4*(2.1 ± 0.2) × 103 *
   7.2 ± 0.6**1048 ± 89.9**(1.5 ± 0.2) × 105 **210 ± 20.7**29.9 ± 3.0**(1.4 ± 0.1) × 102 **
LdhDS564 ± 55.80.3 ± 0.042.7 ± 0.2*500 ± 43.3*(1.9 ± 0.2) × 105 *23.3 ± 2.1*8.6 ± 0.8*(3.7 ± 0.3) × 102 *
   2.4 ± 0.2**833 ± 65.6**(3.5 ± 0.2) × 105 **82.5 ± 7.9**21.7 ± 2.0**(2.6 ± 0.2) × 102 **
LdhDR2318 ± 30.23.4 ± 0.43.0 ± 0.3*594 ± 50.8*(2.0 ± 0.2) × 105 *29.0 ± 3.1*3.8 ± 0.3*(1.3 ± 0.1) × 102 *
   2.8 ± 0.3**916 ± 92.4**(3.3 ± 0.3) × 105 **137 ± 9.3**28.8 ± 2.5**(2.1 ± 0.2) × 102 **
LdhDnARSdR35.0 ± 1.8150 ± 10.515.1 ± 0.8*129 ± 7.6*(8.5 ± 0.3) × 103 *3.8 ± 0.2*163 ± 12.1*(4.4 ± 0.5) × 104 *
   10.3 ± 0.5**447 ± 35.6**(4.3 ± 0.2) × 104 **2.25 ± 0.2**335 ± 27.4**(1.5 ± 0.1) × 105 **

*Kinetic parameters for NADH or NADPH; **Kinetic parameters for pyruvate.

Values represent mean ± S.D. (n = 3).

aUnder standard assay conditions as described under “Methods”.

bND, the kinetic parameters were not determined because the enzymes showed no activity towards the substrate.

To further increase the cofactor specificity of LdhD towards NADPH, a quadruple mutant LdhDnARSdR (D176A/I177R/F178S/N180R) was generated and was expressed in E. coli (Table S2). As shown in Table 2, the k/KNADH value of LdhDnARSdR dropped approximately 28.2-fold compared to LdhD; the K of the enzyme for NADH increased while the k decreased. Interestingly, k/KNADPH was approximately 5.2-fold higher than k/KNADH, suggesting that there might be a synergistic effect in the quadruple mutant, leading to improved catalytic efficiency for NADPH. Although the k/KNADPH value of LdhDnARSdR did not reach the k/KNADH value of LdhD, the mutations drove a fundamental shift in cofactor preference toward NADPH. Furthermore, the kinetic constants for pyruvate were measured (Table 2). Kpyruvate with NADH was 1.1 ± 0.1 mM for wild type LdhD and 10.3 ± 0.5 mM for LdhDnARSdR; Kpyruvate with NADPH was 2.25 ± 0.2 mM for LdhDnARSdR. This result suggested that the K for pyruvate had not changed significantly. Moreover, the catalytic activity of LdhDnARSdR did not decrease after incubation at 30 °C for 24 h, suggesting that the enzyme is stable (data not shown).

Construction of d-lactate-producing S. elongates strains

The biosynthetic pathway of d-lactate uses pyruvate, a central metabolic intermediate that can be reduced to lactate. To engineer S. elongatus PCC7942 for d-lactate production, LdhDnARSdR was then introduced into the strain to facilitate direct utilization of the NADPH pool (Fig. 1). The original enzyme, LdhD, was used to construct a control strain (Fig. 1). To enhance expression in Synechococcus, codon-optimized versions of the above two genes, termed as ldhDc and ldhD, were also synthesized (Table S2). These four genes were all expressed under the control of the IPTG-inducible promoter, P (Fig. 2a–d; Table S3). To further enhance d-lactate production, LldP, a lactate transporter, was expressed under the same promoter (Fig. 2e; Table S3). Neutral site I of S. elongates PCC7942 chromosome was used to integrate the cassettes that contained in the constructed plasmids pYLW11, pYLW12, pYLW13, pYLW14, and pYLW24. The resulting strains were named as YLW01, YLW02, YLW03, YLW04, and YLW05, respectively (Table S3). Integration of the inserted genes into the chromosome was verified with PCR and DNA sequencing (Fig. 2f).
Figure 1

Engineering strategy for enhancing light-driven production of A combinational strategy is taken into account: (i) the engineered S. elongates PCC7942 contains ldhDs for the conversion of pyruvate to d-lactate (the traditional lactate synthesis pathway is in blue; alternative route with recycling of NADPH is in red); (ii) a lactate transporter encoded lldP transports d-lactate extracellularly; and (iii) bubbling CO2-enriched air into the culture medium. ldhDs, represents ldhD, ldhDc, ldhDn and ldhD.

Figure 2

Construction of d-lactate-producing S. elongates strains. (a-e) The integration of genes ldhD, ldhDc, ldhDn into the chromosome of S. elongates PCC7942. (f) Polymerase chain reaction (PCR) confirmed the integration of each gene into the genomic DNA of mutants YLW01, YLW02, YLW03, YLW04 and YLW05. The wild-type strain PCC7942 was used as controls. Cropped gel/blot is used in (f).

d-Lactate production from CO2 by S. elongates

To determine the optimal IPTG concentration required for d-lactate production, all the engineered Synechococcus strains were grown in the presence of 0.1, 0.5, 1, and 2 mM of IPTG. d-Lactate yields were highest at 1 mM IPTG for strains YLW01, YLW02, YLW03, YLW04, and YLW05 (titers of d-lactate were 101 ± 5.3, 104 ± 5.7, 362 ± 17.1, 452 ± 18.7, and 798 ± 30.3 mg/L, respectively; Figure S1a). d-Lactate synthesis was reduced when the concentration of IPTG was above 1 mM. Therefore, 1 mM IPTG was chosen as the optimal concentration for all subsequent experiments. In addition, reverse transcription (RT)-PCR was performed to investigate the expression of ldhD, ldhDc, ldhDn, ldhD, and lldP (Figure S1b). The result revealed that the transcription of all genes was detectable at this IPTG concentration. As controls, the five mutant strains were cultured in the BG-11 medium20 in the absence of IPTG. A small amount of d-lactate was detected in all the strains, indicating slight leaky expression of the LdhDs (data not shown). It is notable that the difficulty in obtaining the transformants (YLW03, YLW04, and YLW05) harboring ldhDn and ldhDproved to be quite difficult, suggesting that leaky expression of LdhDnARSdR might have resulted in low growth rate and transformation efficiency. YLW01, YLW02, YLW03, YLW04, and YLW05 were cultured for d-lactate production under constant light exposure (100 μE·s−1·m−2); the wild type strain S. elongates 7942 was used as the control. After induction for 10 days, d-lactate was not detected in the wild type strain (Fig. 3a). Upon introduction of NADPH-utilizing LdhDnARSdR, d-lactate production increased by 3.6-fold and 4.2-fold in YLW03 (37.9 mg/L per day) and YLW04 (46.1 mg/L per day), compared with YLW01 and YLW02 (which harbor native LdhD), respectively (Fig. 3a). The enzymatic activities of the LdhDs in crude S. elongatus cell lysate were estimated to confirm the expression of the introduced lactate dehydrogenase genes. As shown in Table 3, although high LdhD activity for NADH was detected in both YLW01 and YLW02, d-lactate production remained low (Fig. 3). This may be attributed to the insufficient concentration of intracellular NADH in cyanobacteria. Conversely, although the activity of LdhDnARSdR in YLW03 and YLW04 was significantly low, d-lactate production was enhanced in these strains, attributable to the abundant NADPH pool for LdhDnARSdR in these strains. These results are consistent with a recent report that l-lactate productivity was enhanced by introducing a mutated l-lactate dehydrogenase that could co-utilize NADPH13. In addition, to determine the effect of codon optimization on d-lactate production, the relative protein expression profiles of LdhDs were measured. Higher protein levels were observed in YLW02 and YLW04 (~0.80 and ~0.38 × 10−1 mg/mg in YLW02 and YLW04, respectively; compared with ~0.56 and ~0.13 × 10−1 mg/mg in YLW01 and YLW03, respectively). However, d-lactate production increased only by 1.04- and 1.21-fold in YLW02 and YLW04, compared with YLW01 and YLW03, respectively (Table 2; Table 3). This indicated that codon optimization of ldhD and ldhDn increased d-lactate production only marginally. Overall, our results reinforce the importance of using cofactor-altered LdhDnARSdR for d-lactate production in S. elongatus PCC7942.
Figure 3

(a) Cumulative production of d-lactate by the wild-type 7942 and mutants YLW01, YLW02, YLW03, YLW04, and YLW05 under constant light exposure. (b) Time courses for the growth of wild-type PCC7942 and mutants YLW01, YLW02, YLW03, YLW04, and YLW05. Values are the averages of biological replicates; error bars indicate the standard deviations (n = 3); if errors bar are not visible, they are smaller than the respective data point symbol. OD730, optical density at 730 nm.

Table 3

Activities of LdhD and LdhDnARSdR of crude extracts of S. elongates.

StrainActivitya
Enzyme
 NADHNADPH 
unit
PCC7942NDbNDc
YLW01201.1 ± 2.3NDLdhD
YLW02289.4 ± 2.6NDLdhD
YLW030.21 ± 0.021.96 ± 0.08LdhDnARSdR
YLW040.68 ± 0.035.76 ± 0.25LdhDnARSdR
YLW050.53 ± 0.034.34 ±  0.21LdhDnARSdR

Values represent mean ± S.D. (n = 3).

aUnder standard assay conditions as described under “Methods”.

bND, the enzymes showed no activity towards the substrate.

cNot exist.

It is notable that the growth rate of strains containing LdhDnARSdR was different from that of other strains. There was no significant difference in cell growth among the wild type, YLW01, and YLW02 strains, which had not reached stationary phase at the tenth day and seemed to be able to continue (Fig. 3b). On the other hand, the cell growth rate of strains YLW03, YLW04, and YLW05 was impaired (maximum OD730 values of 0.95, 0.99, and 1.07, respectively). A similar phenomenon was also observed in previous reports in which a soluble transhydrogenase or NADPH co-utilizing l-lactate dehydrogenase was introduced1113 (Fig. 3b). The hydrophobic cell membrane is the main barrier for the production and secretion of hydrophilic products such as lactate by genetically engineered cyanobacteria33. An l-lactate transporter, LldP, has been described as a nonspecific d-lactate transporter that efficiently transports d-lactate by using proton motive force in E. coli and cyanobacteria1634. With the expression of the additional lldP gene, YLW05 secreted 829 mg/L of d-lactate in 10 days with an average productivity of 82.9 mg/L per day (Fig. 3a). Although the activity of LdhDnARSdR was lower in YLW05 (compared with that in YLW04), probably because of downregulation of the two genes upon co-expression (Table 3), d-lactate titer in YLW05 was approximately 1.8-fold higher than that in YLW04. This indicates that the transporter efficiently translocated lactate in YLW05, thereby improving d-lactate productivity.

Effect of aerating CO2 on d-lactate production

In order to test if lactate production by the Synechococcus mutant strain could be enhanced, strain YLW05 was grown in a bubble column photobioreactor by continuously aerating CO2-enriched air (5%, v/v; Fig. 4). As expected, aeration with CO2 increased d-lactate production in YLW05 (~1.6-fold), reaching a titer of 1.31 g/L in 10 days with a maximum productivity of 221 mg/L per day. Moreover, d-lactate production did not cease after the ninth day, although productivity decreased slightly. As for cell growth, the YLW05 culture with CO2-enriched air exhibited slight increase in cell density (Fig. 3; Fig. 4). To further simulate natural production conditions, S. elongatus mutant YLW05 was maintained at alternating dark and light periods (at an interval of 12 h) instead of constant light exposure. Under the conditions employed, cell growth was limited to the light period, and cell density decreased slightly in the dark period (Fig. 4b). This result suggests that d-lactate production in Synechococcus strains might be promoted by light and inhibited in the dark. This hypothesis is consistent with a previous report stating that cyanobacterial cultures accumulate polysaccharides when they are exposed to light, and they mobilize these intracellular reserve materials in the dark35. Finally, strain YLW05 produced a mere 563 mg/L of d-lactate (maximum production rate is 75.1 mg/L per day) after 10 days (Fig. 4b). Nevertheless, these results (productivity of 56.3 mg/L per day) under the day-night cycle conditions suggest that Synechococcus strains may be applied to d-lactate production.
Figure 4

Effect of aerating CO (a) Concentration of secreted d-lactate and growth curve of S. elongates YLW05 under constant light exposure. (b) Concentration of accumulated d-lactate and cell density of YLW05 under alternating dark and light periods. The gray areas represent the dark periods. Values are the averages of biological replicates; error bars indicate the standard deviations (n = 3); if errors bar are not visible, they are smaller than the respective data point symbol. OD730, optical density at 730 nm.

Discussion

Cofactor preference of enzymes is important for microbial organisms to produce metabolites36. In this study, to directly use the abundant NADPH pool in cyanobacteria for d-lactate production, a cyanobacterial cell factory was designed by introducing an NADPH-utilizing enzyme, LdhDnARSdR. Significant changes in the kinetic constants of LdhDnARSdR suggested that the increased d-lactate productivity in YLW03 and YLW04 might stem from the increased activity with NADPH (Table 2). Multiple strategies were tested to optimize lactate production. Altering the cofactor preference of LdhD resulted in over 3.6-fold increase while introducing the transporter, LldP, resulted in approximately 1.8-fold increase, and bubbling CO2 resulted in approximately 1.6-fold increase, in d-lactate production. These results show that altering cofactor specificity contributes mostly in enhancing the d-lactate production, which indicates the feasibility of altering the cofactor specificity. In addition, altering the cofactor preference of an existing enzyme has the following possible advantages. First, the cofactor-altered enzyme could directly utilize NADPH, which might be more efficient for product synthesis. Second, compared to the use of a transhydrogenase, it simplifies the metabolic pathways using just one enzyme. Third, altering cofactor specificity might be faster than the process of identifying NADPH-dependent enzymes. Use of the cofactor-altered LdhDnARSdR resulted in impaired cell growth. This might be attributed to the high rate of d-lactate production, resulting in decreased NADPH level and activation of the oxidative pentose phosphate cycle. This cycle is the major route of carbon metabolism in cyanobacteria37. To confirm this hypothesis, the intracellular levels of NADPH/NADH in both wild type S. elongatus PCC7942 and mutant strains were determined during the cultivation process. The ratio of NADPH/NADH slightly decreased in strain YLW04, compared with that in S. elongatus PCC7942 (Figure S2). This suggested that the NADPH/NADH ratio altered in the mutant strains, which might have affected the cell growth of strains YLW03, YLW04, and YLW05 (Fig. 3b), respectively. Another possible reason is that redirection of carbon flux from cellular biomass toward synthesis of d-lactate disrupts cell growth. Therefore, the intracellular pyruvate concentration in the wild type and mutant strains was measured. Pyruvate concentration was slightly higher in the wild type strain than that in YLW04 (Figure S3). To overcome this problem of attenuated cell growth, it is necessary to maintain the balance between growth and lactate production by precisely controlling the expression of mutated ldhD. This result is also consistent with the above IPTG concentration optimization. As photoautotrophs, cyanobacteria lack many of the transporters found in E. coli or yeast16. In two previous studies in which a transporter was introduced into a cyanobacterium for the secretion of lactate, significant improvement in lactate production was observed1516. Here, strain YLW05 expressing the ldhD and lldP genes secreted relatively high levels of d-lactate into the medium, suggesting that integration of the lactate transporter aids lactate secretion. Moreover, the substrate transport process was mediated by proton translocation, resulting in the accumulation of H + —a necessary material for the synthesis of NADPH34. Therefore, introduction of LldP might contribute to the high yield of d-lactate in strain YLW05 by promoting NADPH production, which can then be used by LdhDnARSdR. Biosynthesis of d-lactate from CO2 has been achieved and is characterized in cyanobacteria, such as Synechocystis sp. PCC6803, through genetic engineering111213141516171832. As shown in Table S4, both Hollinshead et al.14 and Varman et al.17 have reported the enhanced d-lactate production using Synechocystis sp. PCC6803 by adding acetate as an organic carbon source. Herein, the concentration and average productivity of d-lactate increased by approximately 90% using S. elongatus strain YLW05, compared with strain AV101417, within 10 days. It should be noted that the production in this case was purely photosynthetic. Apparently, the titer values and average productivity of YLW05 were considerably higher than those of other reported strains (10 days), without the addition of an additional carbon source. Based on the above results, it is reasonable to conclude that our combinational strategy for the production of d-lactate might be more effective. Furthermore, to examine whether S. elongates PCC7942 was superior, the actual partitioning of carbon between cellular biomass and d-lactate production was evaluated at the late log phase of growth (6 to 8 days for YLW05; 18 to 21 days for AV10). The results revealed that the values for strains YLW05 and AV10 were approximately 80.7 mg/L/OD730 and 5.9 mg/L/OD730 per day, respectively. This result suggests that strain YLW05 might be more efficient than strain AV1017. In summary, LdhD, a key enzyme in the d-lactate production pathway, was successfully engineered for cofactor reversal, and was used in engineered cyanobacteria for efficient production of d-lactate. Other methods, including introducing a lactate transporter and optimizing codon usage were also adopted in the construction. Under conditions of constant light exposure and bubbling CO2-enriched air, the resulting strain (YLW05) achieved the highest lactate concentration and productivity reported for engineered cyanobacteria within 10 days (Table S4). This indicates that the systematic combination of different methods is promising in cyanobacteria engineering. This method of cyanobacterial engineering might have applications in the efficient biosynthesis of other chemicals as well.

Methods

Chemicals and reagents

The d-lactate standard, NADH, NADPH, and isopropyl-β-d-thiogalactoside (IPTG) were obtained from Sigma-Aldrich (St. Louis, MO). Oligonucleotides and gene synthesis were carried out by Sangon Biotech Co., Ltd. (Shanghai, China). All other chemicals and reagents were of at least analytical grade and were available commercially.

Strains and growth conditions

Lactobacillus bulgaricus ATCC11842 and Escherichia coli K-12 strain MG1655 were used as the sources of ldh (GenBank no. 103422405) and the l-lactate transporter gene (lldP) (GenBank no. 1790031), respectively. E. coli strain DH5α was used as the host for vector construction. S. elongates PCC7942 (ATCC33912) was from ATCC (American Type Culture Collection). The S. elongates strain was cultured in the BG-11 medium20 unless otherwise stated, and cells were incubated statically, at 30 °C and at an illumination intensity of 100 μE·s−1·m−2, as described elsewhere14. Cell growth was monitored by measuring the optical density at 730 nm (OD730). For d-lactate production, S. elongatus cells in the exponential phase were diluted to 0.05 (OD730) in 100 mL BG-11 medium containing 20 mg/L spectinomycin in 300 mL flasks. Cultures were induced with a suitable concentration of IPTG after growing to an OD730 of 0.4–0.6. Daily, 1 mL of each sample was collected for analysis, and equivalent BG11 was supplemented.

Site-directed mutagenesis and plasmid construction

All primers used for plasmid construction are listed in Table S5. The constructed plasmids are listed in Table S3. A neutral site I (NSI) in S. elongates PCC7942 chromosome was used for inserting an expression cassette. To construct the overexpression vector for the single mutant LdhDA (D176A), the primer pairs ARSR-F/A-R and A-F/ARSR-R (Table S5) were used to amplify the LdhD coding gene from the genomic DNA of L. bulgaricus ATCC11842. The PCR products were ligated by splicing with overlapping extension polymerase chain reaction (SOE-PCR)38 using primers ARSR-F/A-R and A-F/ARSR-R, and then cloned into the BamHI/SacI site of pETDuet-1, creating pETDuet-ldhD (Table S3). Similarly, other single mutants LdhDR (I177R), LdhDS (F178S), and LdhDR2 (N180R) were acquired, and cloned into the BamHI/SacI site of pETDuet-1 (Table S5). The resulting plasmids were named as pETDuet-ldhD, pETDuet-ldhD, and pETDuet-ldhD, respectively (Table S3). To obtain the quadruple mutant (D176A/I177R/F178S/N180R), two pairs of primers (O4_F and C_R, C_F and O4_R) were used to amplify the fragments of ldh from the genomic DNA of L. bulgaricus ATCC11842. These two DNA fragments were then ligated by SOE-PCR using primers O4_F and O4_R (Table S5). The resulting gene ldhDn was cloned into pMD18-T for verification by DNA sequencing. Then, ldhD and ldhDn were optimized with codon usage (termed as ldhDcand ldhD, respectively), synthesized with PCR39, and also cloned into pMD18-T for sequencing. The primers, O4_F and O4_R, AB_F and AB_R, ARSdR_F and ARSdR_R, were then designed to clone ldhDn, ldhDc and ldhD, respectively (Table S5). Two primers, mcs12_F and mcs12_R, were designed for cloning MCS1 and MCS2 fragments (MCS12) from pETDuet-1. For plasmid construction, the PCR product of MCS12 was firstly cloned into the EcoRI/BamHI site of plasmid pAM29911 to introduce cloning sites AflII, BglII, and XhoI, creating plasmid pAM-MCS12. The PCR product of ldhD was then cloned into the EcoRI/XhoI site of plasmid pAM-MCS12, creating plasmid pYLW11. Similarly, ldhDc was cloned into the BamHI/AflII site of plasmid pAM-MCS12, resulting in plasmid pYLW12. Then, ldhDn and ldhD were cloned into the AflII/XhoI site of plasmid pAM-MCS12, resulting in plasmid pYLW13 and pYLW14, respectively. The Shine-Dalgarno (SD) sequence of ldhD, ldhDc, ldhDn and ldhD was obtained from pET28a( + ). lldP was obtained via PCR amplification from E. coli MG1655 using two primers, lldP_3 F and lldP_2 R, it was cloned into the XhoI/BamHI site of pYLW14, resulting in plasmid pYLW24. The Shine-Dalgarno (SD) sequence of lldP was obtained from E. coli MG1655.

Transformation of Synechococcus

Transformation of Synechococcus host cells was carried out by using a double homologous-recombination procedure as previously described16. Integration of vectors into neutral site I was verified by PCR using gene-specific primers (Table S5) to demonstrate the presence of appropriate novel chromosome-transgene junctions and the absence of uninserted sites. The genetic stability of the mutant strains was evaluated by the serial subcultivation. Table S3 lists the strains that were constructed and used in this study. Briefly, mutant strains were obtained via integrating the aimed DNA fragments harbored by plasmids pYLW11, pYLW12, pYLW13, pYLW14, and pYLW24 to Synechococcus chromosome, respectively.

Culture conditions of Synechococcus cells

To investigate the effect of the initial concentration of IPTG on d-lactate production, IPTG concentration was adjusted in the culture media to 0.1, 0.5, 1, and 2 mM. To determine the effect of aeration on d-lactate production, a bubble column photobioreactor equipped with a glass column was used. S. elongatus strains were separately suspended in BG11 medium by aerating CO2-enriched air under constant light exposure as described in a previous study10. To study the effect of the day-night cycle on d-lactate production, S. elongatus strain was grown under the aerating condition with day and night periods that alternated every 12 h.

Enzyme assays

S. elongatus cells were harvested via centrifugation (6,000 × g, 5 min) 72 h after induction, washed twice with 50 mM Tris-HCl buffer (pH 7.0), and resuspended in the same buffer containing 2 mM dithiothreitol. Crude extracts were prepared via bead beating22. Total protein concentration was determined according to the method of Bradford10 using bovine serum albumin as the standard. The standard reaction mixture (1 mL) contained 50 mM Tris-HCl buffer (pH 7.0), 0.2 mM NAD(P)H, and 0.05 mM pyruvate. One unit of protein activity was calculated as micromoles of pyruvate consumed per minute per milligram of the total protein at 30 °C. To characterize the kinetic constants of LdhDnARSdR after the reversal of coenzyme specificity, the enzyme was expressed in E. coli BL21(DE3), with the wild-type LdhD as a control. The purification of the two enzymes were performed using the method of Wang et al.40 The reduction activity of purified LdhD and LdhDnARSdR on pyruvate were assayed at 30 °C. Oxidation of NADPH/NADH (ε;340 = 6220 m−1 cm−1) was monitored by the decrease in absorbance at 340 nm41. One unit of protein activity was defined as the amount enzyme that catalyzed the consumption of 1 μmol pyruvate per minute. The reaction mixture (1 mL) contained 50 mM Tris-HCl buffer (pH 7.0), 0.2 mM NAD(P)H, and different concentrations of substrate. The Michaelis-Menten equation was used for determination of the kinetic parameters. To determine the stability of LdhDnARSdR, the purified LdhDnARSdR were incubated at 30 °C for 24 h.

Reverse transcription PCR (RT-PCR)

RT-PCR was performed as previously described21. Total RNA of the various cyanobacteria strains was extracted using an RNAprep Pure Cell/Bacteria Kit (TIANGEN Biotech Co., Ltd, Beijing, China). RNA was quantified using a NanoVue (GE Healthcare Bio-Sciences AB, Sweden). Residual DNA in RNA preparations was treated with RNase-free DNase I (Thermo Scientific, Shanghai, China). Reverse transcription using random primers was performed with SuperScriptTM Ш Reverse Transcriptase (Invitrogen, Shanghai, China). Reverse transcription products were amplified using the specific primers listed in Table S5. The expression of rnpB was used as a positive control, and the wild-type S. elongates PCC7942 was used as the negative control. PCR products were analyzed with electrophoresis on 2% (w/v) agarose gels.

Quantification of d-lactate

For d-lactate measurement, 1 mL of the sample was centrifuged (13,000 × g, 2 min), cell debris was removed, and the supernatant was boiled for 10 min and centrifuged at 13,000 × g for 5 min. The final supernatant was used to determine d-lactate content. Thereafter, d-lactate assay kit (Megazyme) was used to determine d-lactate concentration according to the manufacturer’s instructions16. As a control, d-lactate was also assayed in the cell-free supernatant of the wild type strain. Assays were performed in triplicate, and standard deviations were determined.

Author Contributions

F. T. and P. X. conceived and designed the project and experiments. C. L., F. T., J. N., Y. W., and F. Y. performed the experiments. F. T., C. L., and P. X. analyzed the data. C. L., F. T., and P. X. wrote the paper.

Additional Information

How to cite this article: Li, C. et al. Enhancing the light-driven production of D-lactate by engineering cyanobacterium using a combinational strategy. Sci. Rep. 5, 09777; doi: 10.1038/srep09777 (2015).
  38 in total

1.  The unique cyanobacterial protein OpcA is an allosteric effector of glucose-6-phosphate dehydrogenase in Nostoc punctiforme ATCC 29133.

Authors:  K D Hagen; J C Meeks
Journal:  J Biol Chem       Date:  2001-01-04       Impact factor: 5.157

Review 2.  Lactic acid production from lignocellulose-derived sugars using lactic acid bacteria: overview and limits.

Authors:  Mohamed Ali Abdel-Rahman; Yukihiro Tashiro; Kenji Sonomoto
Journal:  J Biotechnol       Date:  2011-06-23       Impact factor: 3.307

3.  Relative catalytic efficiency of ldhL- and ldhD-encoded products is crucial for optical purity of lactic acid produced by lactobacillus strains.

Authors:  Zhaojuan Zheng; Binbin Sheng; Cuiqing Ma; Haiwei Zhang; Chao Gao; Fei Su; Ping Xu
Journal:  Appl Environ Microbiol       Date:  2012-02-17       Impact factor: 4.792

4.  The Calvin cycle in cyanobacteria is regulated by CP12 via the NAD(H)/NADP(H) ratio under light/dark conditions.

Authors:  Masahiro Tamoi; Takashi Miyazaki; Tamo Fukamizo; Shigeru Shigeoka
Journal:  Plant J       Date:  2005-05       Impact factor: 6.417

5.  Cyanobacterial conversion of carbon dioxide to 2,3-butanediol.

Authors:  John W K Oliver; Iara M P Machado; Hisanari Yoneda; Shota Atsumi
Journal:  Proc Natl Acad Sci U S A       Date:  2013-01-07       Impact factor: 11.205

6.  In vitro enhancement of lactate esters on the percutaneous penetration of drugs with different lipophilicity.

Authors:  Jianhua Zhang; Mei Liu; Hongjian Jin; Liandong Deng; Jinfeng Xing; Anjie Dong
Journal:  AAPS PharmSciTech       Date:  2010-05-22       Impact factor: 3.246

7.  Effect of the reversal of coenzyme specificity by expression of mutated Pichia stipitis xylitol dehydrogenase in recombinant Saccharomyces cerevisiae.

Authors:  J Hou; Y Shen; X P Li; X M Bao
Journal:  Lett Appl Microbiol       Date:  2007-08       Impact factor: 2.858

8.  Engineering a cyanobacterial cell factory for production of lactic acid.

Authors:  S Andreas Angermayr; Michal Paszota; Klaas J Hellingwerf
Journal:  Appl Environ Microbiol       Date:  2012-08-03       Impact factor: 4.792

9.  Efficient production of optically pure D-lactic acid from raw corn starch by using a genetically modified L-lactate dehydrogenase gene-deficient and alpha-amylase-secreting Lactobacillus plantarum strain.

Authors:  Kenji Okano; Qiao Zhang; Satoru Shinkawa; Shogo Yoshida; Tsutomu Tanaka; Hideki Fukuda; Akihiko Kondo
Journal:  Appl Environ Microbiol       Date:  2008-11-14       Impact factor: 4.792

10.  Utilization of lactic acid bacterial genes in Synechocystis sp. PCC 6803 in the production of lactic acid.

Authors:  Ancy Joseph; Shimpei Aikawa; Kengo Sasaki; Yota Tsuge; Fumio Matsuda; Tsutomu Tanaka; Akihiko Kondo
Journal:  Biosci Biotechnol Biochem       Date:  2013-05-07       Impact factor: 2.043

View more
  10 in total

1.  Chirality Matters: Synthesis and Consumption of the d-Enantiomer of Lactic Acid by Synechocystis sp. Strain PCC6803.

Authors:  S Andreas Angermayr; Aniek D van der Woude; Danilo Correddu; Ramona Kern; Martin Hagemann; Klaas J Hellingwerf
Journal:  Appl Environ Microbiol       Date:  2015-12-18       Impact factor: 4.792

2.  Development of a High-Throughput, In Vivo Selection Platform for NADPH-Dependent Reactions Based on Redox Balance Principles.

Authors:  Linyue Zhang; Edward King; Ray Luo; Han Li
Journal:  ACS Synth Biol       Date:  2018-06-29       Impact factor: 5.110

3.  Engineering a d-lactate dehydrogenase that can super-efficiently utilize NADPH and NADH as cofactors.

Authors:  Hengkai Meng; Pi Liu; Hongbing Sun; Zhen Cai; Jie Zhou; Jianping Lin; Yin Li
Journal:  Sci Rep       Date:  2016-04-25       Impact factor: 4.379

Review 4.  Advances in Metabolic Engineering of Cyanobacteria for Photosynthetic Biochemical Production.

Authors:  Martin C Lai; Ethan I Lan
Journal:  Metabolites       Date:  2015-10-27

5.  Engineering Bacillus licheniformis as a thermophilic platform for the production of l-lactic acid from lignocellulose-derived sugars.

Authors:  Chao Li; Zhongchao Gai; Kai Wang; Liping Jin
Journal:  Biotechnol Biofuels       Date:  2017-10-11       Impact factor: 6.040

6.  Over-expression of an electron transport protein OmcS provides sufficient NADH for D-lactate production in cyanobacterium.

Authors:  Hengkai Meng; Wei Zhang; Huawei Zhu; Fan Yang; Yanping Zhang; Jie Zhou; Yin Li
Journal:  Biotechnol Biofuels       Date:  2021-04-29       Impact factor: 6.040

7.  Autotrophic lactate production from H2 + CO2 using recombinant and fluorescent FAST-tagged Acetobacterium woodii strains.

Authors:  Alexander Mook; Matthias H Beck; Jonathan P Baker; Nigel P Minton; Peter Dürre; Frank R Bengelsdorf
Journal:  Appl Microbiol Biotechnol       Date:  2022-01-29       Impact factor: 4.813

Review 8.  Exploitation of Hetero- and Phototrophic Metabolic Modules for Redox-Intensive Whole-Cell Biocatalysis.

Authors:  Eleni Theodosiou; Adrian Tüllinghoff; Jörg Toepel; Bruno Bühler
Journal:  Front Bioeng Biotechnol       Date:  2022-04-13

9.  Substrate Specificity and Allosteric Regulation of a D-Lactate Dehydrogenase from a Unicellular Cyanobacterium are Altered by an Amino Acid Substitution.

Authors:  Shoki Ito; Masahiro Takeya; Takashi Osanai
Journal:  Sci Rep       Date:  2017-11-08       Impact factor: 4.379

Review 10.  Genetic, Genomics, and Responses to Stresses in Cyanobacteria: Biotechnological Implications.

Authors:  Corinne Cassier-Chauvat; Victoire Blanc-Garin; Franck Chauvat
Journal:  Genes (Basel)       Date:  2021-03-29       Impact factor: 4.096

  10 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.