Literature DB >> 25609983

Identification of highly conserved regions in L-segment of Crimean-Congo hemorrhagic fever virus and immunoinformatic prediction about potential novel vaccine.

Arafat Rahman Oany1, Shah Adil Ishtiyaq Ahmad1, Mohammad Uzzal Hossain1, Tahmina Pervin Jyoti2.   

Abstract

Crimean-Congo hemorrhagic fever (CCHF) is a tick-borne zoonotic viral disease with a disease fatality rate between 15% and 70%. Despite the wide range of distribution, the virus (CCHFV) is basically endemic in Africa, Asia, eastern Europe, and the Middle East. Acute febrile illness associated with petechiae, disseminated intravascular coagulation, and multiple-organ failure are the main symptoms of the disease. With all these fatal effects, CCHFV is considered a huge threat as no successful therapeutic approach is currently available for the treatment of this disease. In the present study, we have used the immunoinformatics approach to design a potential epitope-based vaccine against the RNA-dependent RNA polymerase-L of CCHFV. Both the T-cell and B-cell epitopes were assessed, and the epitope "DCSSTPPDR" was found to be the most potential one, with 100% conservancy among all the strains of CCHFV. The epitope was also found to interact with both type I and II major histocompatibility complex molecules and is considered nonallergenic as well. In vivo study of our proposed peptide is advised for novel universal vaccine production, which might be an effective path to prevent CCHF disease.

Entities:  

Keywords:  RNA-dependent RNA polymerase; epitope; immunoinformatics; single-stranded RNA

Year:  2015        PMID: 25609983      PMCID: PMC4293217          DOI: 10.2147/AABC.S75250

Source DB:  PubMed          Journal:  Adv Appl Bioinform Chem        ISSN: 1178-6949


Introduction

Crimean–Congo hemorrhagic fever virus (CCHFV) is the causative agent of the hemorrhagic fever, which was first described in Cremia in 1945.1 The virus consists of a negative-sense single-stranded RNA, and its tripartite genome comprises the small (S), medium (M), and large (L) segments, which encode the viral nucleocapsid (N), glycoprotein precursor, and polymerase-L proteins, respectively.2 Africa, Asia, eastern Europe, and the Middle East are the hotspots of this viral infection, with a high fatality rate between 15% and 70%.3,4 In case of human infection, the progression of this disease is very rapid and it causes acute febrile illness, associated with petechiae, ecchymosis, disseminated intravascular coagulation, and multiple-organ failure.5 A wide range of ticks that belong to the Hyalomma genus are considered the main vectors of this viral disease and the disease is spread through the bite of these ticks to humans or other domestic animals.6 Due to inadequate hospital care, the disease is also spread nosocomially and a case reported that, in South Africa, about 33% medical personnel are infected through needlestick injury.7 Alternate routes of infection, such as aerosol and droplet respiratory route of infection, were also suspected for several cases in Russia.8 With a broad geographic distribution, this virus already covers >30 countries across Africa, southeastern Europe, the Middle East, western Asia, and more recently, some places of southwestern Europe, particularly Spain.9–11 The wide distribution of this virus indicates the ability of the tick hosts to adapt across different environmental and geographic regions.12 Despite the outbreaks, there is no reliable vaccine or drug for the treatment of CCHFV infection in animals or humans.13 As a single-stranded-RNA-containing genome and due to the error-prone nature of its polymerase, the CCHFV incorporates random mutations into the genome. The rate of recombination in its RNA is also very high. As a consequence, the development of a vaccine or antiviral drug against CCHFV is very difficult.14 The design of epitope-based vaccines against some deadly viruses has gained much popularity due to its increased potency and safety.15,16 The application of bioinformatics in immunology, which is also termed immunoinformatics, is now widely accepted. Immunoinformatics can assist in designing new vaccines through the identification of potential T-cell epitope, B-cell epitope, and human leukocyte antigen (HLA) ligands.17–19 This novel approach has proven its efficacy in the case of multiple sclerosis,20 malaria,21 human immunodeficiency virus,22 and tuberculosis,23 with desired results. In our present study, we have proposed the design of a potential conserved epitope candidate through the immunoinformatics approaches in order to minimize the fatal effects of the CCHFV, with the expectation of finding a novel candidate for the vaccine via wet laboratory validation.

Materials and methods

Sequence retrieval and conserved region identification

UniProtKB24 database was used for the retrieval of the sequences of RNA-dependent RNA polymerase-L25 and the envelope glycoprotein26 of the CCHFV in the FASTA protein format. BioEdit v7.2.3 sequence alignment editor27 was used for the identification of the conserved region among the sequences through multiple-sequence alignment (MSA) with ClustalW.28 Finally, Jalview v2 tool29 was used to retrieve the alignment and the CLC Sequence Viewer v7.0.2 (http://www.clcbio.com) was used for analysis of the divergence among the different strains of the CCHFV.

Antigenicity determination of the conserved peptides

VaxiJen v2. 0, a Web-based server,30 was used for the determination of the antigenicity of the conserved sequences. Herein, we used the default parameters for the prediction, with a threshold value of 0.4.

T-cell epitope prediction

Two online servers were used for the prediction of the T-cell epitope. Initially, the NetCTL v1.2 server was used for the identification of the potential T-cell epitope.31 We used the default approach to predict the epitopes, including major histocompatibility complex class I (MHC-I) binding, proteasomal C terminal cleavage, and transporter of antigenic peptide (TAP) transport efficiency. The epitope prediction was restricted to 12 MHC-I supertypes. MHC-I binding and proteasomal cleavage were performed through artificial neural networks and the weight matrix was used for estimating TAP transport efficiency. The threshold for epitope identification was set at 0.5 to maintain sensitivity and specificity of 0.89 and 0.94, respectively. Finally, CTLPred32 was implemented additionally for further confirmation about the prediction with default parameters.

MHC-I and MHC-II restriction analysis

T Cell Epitope Prediction Tools from Immune Epitope Database and Analysis Resource (IEDB-AR) was used for the prediction of MHC-I33 and MHC-II34,35 binding of the peptide. The Stabilized Matrix Method36 was used to calculate the half-maximal inhibitory concentration (IC50) of peptide binding to MHC-I molecules from different prediction methods, with a preselected 9.0-mer epitope. In case of MHC-II binding analysis, the IEDB-recommended method was used for the specific HLA-DQ, HLA-DP, and HLA-DR loci. Here, we used specific peptides for the prediction of MHC-II interaction on the basis of the antigenic conservancy and MHC-I analysis.

B-cell epitope prediction

B-cell epitope initiates immunoresponse through the interaction with B lymphocytes and causes the differentiation of B lymphocytes into plasma and memory cells.37 IEDB-AR hosts a number of Web-based tools for the prediction of B-cell epitope. Multiple tools, including the Kolaskar and Tongaonkar antigenicity scale,38 Emini surface accessibility prediction39 and Bepipred linear epitope prediction analysis, were used for the B-cell epitope prediction with high accuracy.40

Homology modeling and protein variability determination of the conserved region

Homology model of the conserved region was obtained by MODELLER v9,41 and the predicted model was assessed by PROCHECK42 and QMEAN43 servers of the SWISS-MODEL Workspace.44 For the disorder prediction among the amino acid sequences, DISOPRED v345 was used. The Protein variability server was used to calculate protein variability index using Shannon variability coefficient.46

Allergenicity and epitope conservancy analysis

In order to predict the allergenicity of the proposed epitopes with high accuracy, a Web-based server AlgPred47 was used. Herein, we used a hybrid prediction (SVMc + IgEepitope + ARPs BLAST + MAST) approach to predict the allergenicity with an accuracy of about 86% at a threshold value of −0.4. The prediction procedure follows the guidelines of the Food and Agriculture Organization/World Health Organization, 2003. A Web-based tool from IEDB-AR48 was used in order to identify the specific conservancy of the proposed epitopes.

Results

Analysis of the retrieved sequences and their divergence

A total of 80 envelope glycoproteins and 34 RNA-dependent RNA polymerase-L molecules from different variants of the CCHFV were retrieved from the UniProt database. The MSA of two different types of proteins was retrieved from BioEdit tool through ClustalW with 1,000 bootstrap replicates (Figures S1 and S2). Conserved regions were grouped for the antigenic property analysis. CLC Sequence Viewer was used to construct phylograms for both proteins from the MSA obtained from BioEdit, in order to analyze the divergence among the retrieved sequences. Phylogram of RNA-dependent RNA polymerase-L is depicted in Figure 1 and the phylogram for the envelope glycoprotein is provided in Figure S3.
Figure 1

Phylogenetic tree showing the evolutionary divergence among the different RNA-dependent RNA polymerase-L molecules of the CCHFV.

Notes: Here, cladogram view is shown with appropriate distance among the different strains. The blue dotted view indicates the node of the tree.

Abbreviation: CCHFV, Crimean–Congo hemorrhagic fever virus.

Antigenic peptide identification

Initially, the conserved sequences (MSA number: 3,563–3,915) of RNA-dependent RNA polymerase-L were separated into four conserved peptides, according to their continuity in the MSA. Then the VaxiJen v2.0 server was used to predict the antigenicity of all the grouped conserved peptides (Table 1). On the basis of the VaxiJen score, the top two conserved peptides (MSA number: 3,563–3,658 and 3,694–3,773) were selected for further analysis. The peptide with second-best VaxiJen score (MSA: 3,694–3,773) showed better results during further analysis of T-cell epitope identification, MHC interaction analysis, and B-cell epitope identification. The conservancy of this region among the different viral strains is partially depicted in Figure 2.
Table 1

Antigenicity determination of the conserved peptide by Vaxijen server

Peptide numberPeptideRegionVaxijen score (threshold: 0.4)
1LIQTLFPDKFEDFLDRTQLHPEFRDLTPDFSLTQKVHFKRNQIPSVENVQISIDATLPESVEAVPVTERKMFPLPETPLSEVHSIERIMENFTRLM3,563–3,6580.6556
2DYGERGIVEENHMKFSGEDQLETRQLLLVEVGFQTDIDGKIRTDHKKWKDILKLLELLGIKCSFIACADCSSTPPDRWWI3,694–3,7730.4268
3EDRVRVLKNSVSFLFNKLSRNSPTEVTDIVVGAISTQKVRSYLKAGTATKTPVSTKDVLETWEK3,775–3,8380.3662
4MKEHILNRPTGLTLPTSLEQAMRKGLVEGVVISKEGSESCINMLKENLDRITDEFERTKFKHELTQNITTSEKML3,841–3,9150.1044
Figure 2

MSA of the conserved region of RNA-dependent RNA polymerase-L. Only the partial sequences containing the proposed epitope sequence are shown here.

Notes: Clustalx color is used here. Different colors indicate different amino acid residues.

Abbreviation: MSA, multiple-sequence alignment.

T-cell epitope identification and MHC interaction analysis

NetCTL v1.2 server predicted the T-cell epitopes through the combined approach for the 12 MHC-I supertypes. On the basis of the combined score, five epitopes with top scores (Table 2) were selected for further analysis. CTLPred server also predicted the T-cell epitopes based on an approach that combined artificial neural networks and support vector machines (Table 3). From the analysis, the common epitope–containing peptide, which was predicted by both servers, was selected and used for the MHC-binding analysis.
Table 2

Prediction of the T-cell epitope by NetCTL server on the basis of combined score

NumberEpitopeCombined score (nM)
1CSSTPPDRW1.7235
2DVLETWEKM1.6491
3WEKMKEHIL1.5089
4ERTKFKHEL1.4955
5VPVTERKMF1.4734
Table 3

Prediction of the T-cell epitope by CTLPred server

EpitopeStart positionScore (ANN/SVM)
LNRPTGLTL2461.00/−0.23718777
FSLTQKVHF300.99/−0.23718777
ADCSSTPPD1640.99/−0.23718777
LSRNSPTEV1940.99/−0.23718777
TSLEQAMRK2560.99/−0.23718777

Abbreviations: ANN/SVM, artificial neural networks/support vector machines; CTLP, Cytotoxic T Lymphocyte Prediction (CTLPred).

MHC-I-binding prediction, which was run through the Stabilized Matrix Method, predicted a wide range of MHC-I allele interactions for the proposed T-cell epitopes. The MHC-I alleles for which the epitope showed higher affinity (IC50 <200 nM) are listed in Table 4. The output of the MHC-II interaction analysis is also shown in Table 4.
Table 4

MHC-I and MHC-II interaction of the proposed sequence by IEDB-AR

EpitopeMHC interaction
MHC-I interaction analysis
DCSSTPPDRHLA-C*12:03, HLA-C*03:03, HLA-C*14:02, HLA-B*58:01, HLA-C*12:03, HLA-C*03:03, HLA-C*15:02, HLA-B*57:01
MHC-II interaction analysis
FIACADCSSTPPDRWHLA-DRB1*04:01, HLA-DRB1*03:01, HLA-DRB1*08:02, HLA-DRB3*01:01, DQB1*03:01, HLA-DRB1*09:01, HLA-DRB5*01:01, HLA-DRB1*04:05, DQB1*04:02, HLA-DRB1*11:01, HLA-DRB1*07:01, DQB1*02:01, HLA-DRB1*13:02, DQB1*03:02, DQB1*05:01, HLA-DRB4*01:01, HLA-DRB1*01:01, HLA-DRB3*02:02, DPB1*04:01, DQB1*06:02, DPB1*14:01, HLA-DRB1*15:01, DPB1*02:01, HLA-DRB1*12:01, DPB1*04:02, DPB1*05:01, DPB1*01:01

Abbreviations: IEDB-AR, Immune Epitope Database and Analysis Resource; MHC, major histocompatibility complex.

B-cell epitope identification

Amino acid–based methods were used for the prediction of potential B-cell epitope. Antigenic property of the peptides was assessed using the Kolaskar and Tongaonkar antigenicity scale. The average antigenic propensity score of the protein was 1.019, with a maximum of 1.197 and a minimum of 0.884. The threshold value for antigenic determination of the peptide was 1.0, where all epitopes with values >1.0 were potential antigenic determinants. We found that 14 epitopes satisfied the threshold value set prior to the analysis, and they had the potential to express the B-cell response. The results are summarized in Table 5 and Figure 3. Peptides with the potential to function as B-cell epitope must be surface accessible. For this reason, Emini surface accessibility prediction was employed, with a maximum propensity score of 4.946 at threshold 1.0. Results are summarized in Figure 4. Finally, Bepipred linear epitope prediction tool predicted the linear B-cell epitope with the most reliable results of prediction. Results are shown in Figure 5.
Table 5

Kolaskar and Tongaonkar antigenicity analysis

NumberStart positionEnd positionPeptidePeptide length
11623RTQLHPEF8
22839PDFSLTQKVHFK12
34367IPSVENVQISIDVTLPESVEAVPVT25
47285FPLPETPLSEVHSI14
5117130QSAVEHESPSISAF14
6154163TRQLLLVEVG10
7182204ILKLLELLGIKCSFIACADCSST23
8215229RVRVLKNSVSFLFNK15
9238246VTDIVVGAI9
10248258TQKVRSYLKAG11
11262273KTPVSTKDVLET12
12287295GLTLPASLE9
13302310LVEGVVISK9
14314319ESCINM6
Figure 3

Kolaskar and Tongaonkar antigenicity prediction of the conserved peptide, ranging from 3,563 to 3,915 MSA number.

Notes: The region from 197 to 202 is the proposed epitope. The X- and Y-axes represent the sequence position and antigenic propensity score, respectively. The threshold value is 1.0. The regions above the threshold are antigenic, shown in yellow.

Abbreviation: MSA, multiple-sequence alignment.

Figure 4

Emini surface accessibility prediction of the proposed epitope, with a minimum propensity score of 0.327 and maximum score of 1.488.

Notes: The X- and Y-axes represent the sequence position and surface probability, respectively. The threshold value is 1.0. The regions above the threshold are antigenic, shown in yellow.

Figure 5

Bepipred linear epitope prediction of the proposed epitope with a minimum propensity score of 1.631 and maximum score of 2.094.

Notes: The X- and Y-axes represent the sequence position and propensity score, respectively. The threshold is 0.350. The regions having beta turns are shown in yellow. The highest peak region indicates the most potent B-cell epitope.

Structure analysis and protein variability determination

Homology model of the conserved region was obtained by the MODELLER software, which is shown in Figure 6A. PROCHECK server validated the stereochemical quality of the model through Ramachandran Plot (Figure 6B), and Qmean server also assessed the tertiary structure, with a Qmean6 score of 0.268. DISOPRED v3 server predicted the disorder of the conserved peptide in order to get insight about the disorder among the conserved sequences, which is depicted in Figure 7. Protein variability server predicted the variability of the conserved region of the RNA-dependent RNA polymerase-L (Figure 8) to ensure that the proposed epitope is within the invariable region.
Figure 6

Three-dimensional structure prediction and validation.

Notes: (A) Three-dimensional model of the conserved region. Here, the epitope “DCSSTPPDR” is shown spherically. The outerside location of the epitope indicates its surface accessibility. (B) Ramachandran plot of the predicted model shows that most of the residues are in the allowed region of the plot, proving the validity of the model.

Figure 7

Disorder prediction of the conserved antigenic amino acid sequences. Here, our proposed epitope lies outside (197–202) of the disordered region to secure its potentiality as an effective epitope.

Notes: Amino acids in the input sequence are considered disordered when the blue line is above the gray dashed line, that is, when the confidence score is >0.5. The orange line shows the confidence score of the disordered protein-binding residue predictions.

Figure 8

Protein variability index of the conserved peptides of all the sequences. The prediction suggests that our proposed epitope (197–202) falls in the invariable region.

Notes: The conservancy threshold was 1.0 in this analysis. The X-axis indicates the amino acid positions in the sequences and the Y-axis indicates the Shannon variability score.

Epitope conservancy and allergenicity analysis

IEDB conservancy analysis tool analyzed the epitope conservancy of the proposed epitopes that are shown in Table 6. AlgPred predicted the allergenicity of the epitopes based on amino acid composition. The prediction score of AlgPred for the two epitopes in combination was 0.49752311 at threshold of −0.4.
Table 6

Epitope conservancy analysis

Peptide sequencePeptide lengthPercentage of protein sequence matchMaximum identity
DCSSTPPDR9100% (34/34)100%
FIACADCSSTPPDRW15100% (34/34)100%

Discussion

With a widely distributed endemically affected region and a randomly mutated genome, CCHFV imposes a great challenge to researchers in developing a successful therapeutic approach against it. The ability of an epitope-based vaccine to stimulate an effective specific immune response with a minute structure and without any unexpected side effects has made it a good choice for vaccine development.49 In this instance, we started with the preferable target, namely, the envelope glycoprotein, but failed to identify any unique conserved region (Figure S1; multiple-sequence alignment of the envelope glycoprotein of CCHFV.) to design a peptide vaccine against the envelope glycoprotein. This was also revealed by phylogeny analysis, which is shown in Figure S3; phylogenetic tree showing the evolutionary divergence among the different envelope glycoproteins of CCHFV. RNA-dependent RNA polymerase, a product of the L-segment of the genome, comprises a unique conserved region among all the available strains of CCHFV (Figure S2; multiple-sequence alignment of the RNA-dependent RNA polymerase-L of CCHFV). This was the pedestal to think about a novel vaccine candidate. To ensure a firm immune response, we looked for the activation of both T-cell and B-cell immunity with a single epitope.50 Antigenicity of the conserved peptides indicated their ability to provoke potential immune response and they were used for further analysis involving T-cell epitope prediction. Through the analysis of the output of both NetCTL and CTLPred, it was found that the epitope “DCSSTPPDR” would be the best candidate for the activation of T-cell immunity with potential antigenicity. Analysis of the MHC ligands for both type I and II revealed that the core epitope “DCSSTPPDR” would interact with the highest number of HLA molecules and that it would support the MHC molecules to present the epitope on the T-cell surface. The complete peptide for MHC-II restriction was FIACADCSSTPPDRW. The peptide DCSSTPPDR was also found to be the most potential candidate to raise B-cell immune response by amino acid–based B-cell epitope prediction, including Kolaskar and Tongaonkar antigenicity scale, Emini surface accessibility prediction, and Bepipred linear epitope prediction. In order to see the exact location of the proposed epitope of the protein (shown spherically in Figure 6A), the three-dimensional structure of the conserved peptide was modeled. This predicted model was validated with Ramachandran Plot (Figure 6B), whereby 89.8% amino acid residues were found within the favored region. The disorderliness of the peptide remains outside of the proposed epitope region, which would secure the functioning of our predicted epitope (Figure 7). The most important feature of an epitope enabling its use as a vaccine is its conservancy. Conservancy analysis of the proposed epitope found 100% conservancy among all the available sequences. Another important criterion of the peptide vaccine is its allergenicity51; our proposed epitope was examined in silico and found to be nonallergenic in nature. A recent study in designing a vaccine against CCHFV targeting the envelope glycoprotein showed a high success rate in a mouse model.52 But because it is a structural protein, the rate of mutation is higher than that of nonstructural proteins such as RNA polymerase,53 a phenomenon that has been evidenced in our study through sequence analysis. As our proposed epitope is shown to be 100% conserved among different CCHF strains, we suggest that it will be the best possible candidate for vaccine designing. Epitope-based vaccine designing is now becoming more popular and already has been established for rhinovirus,54 dengue virus,55 human corona virus,56 and some others. This type of work has also been proven in vitro.57 So, considering the above analysis,we predict that our proposed epitope would also trigger an immune response in vitro.

Conclusion

The findings from this study denote that integrated computational approaches are very much effective for designing vaccine candidates against some deadly viruses such as the CCHFV, with the formally delineated experimental procedure. Thus, computational studies save both time and cost for researchers and can lead the wet laboratory work with higher possibilities of getting the desired outcome.
  52 in total

1.  A synthetic malaria vaccine elicits a potent CD8(+) and CD4(+) T lymphocyte immune response in humans. Implications for vaccination strategies.

Authors:  J A López; C Weilenman; R Audran; M A Roggero; A Bonelo; J M Tiercy; F Spertini; G Corradin
Journal:  Eur J Immunol       Date:  2001-07       Impact factor: 5.532

2.  Prediction of CTL epitopes using QM, SVM and ANN techniques.

Authors:  Manoj Bhasin; G P S Raghava
Journal:  Vaccine       Date:  2004-08-13       Impact factor: 3.641

3.  The SWISS-MODEL workspace: a web-based environment for protein structure homology modelling.

Authors:  Konstantin Arnold; Lorenza Bordoli; Jürgen Kopp; Torsten Schwede
Journal:  Bioinformatics       Date:  2005-11-13       Impact factor: 6.937

4.  Seroepidemiology of Congo virus (related to the virus of Crimean haemorrhagic fever) in Nigeria.

Authors:  T S David-West; A R Cooke; A S David-West
Journal:  Bull World Health Organ       Date:  1974       Impact factor: 9.408

5.  A fatal case of Crimean-Congo haemorrhagic fever in Mauritania: virological and serological evidence suggesting epidemic transmission.

Authors:  J P Gonzalez; B LeGuenno; M Guillaud; M L Wilson
Journal:  Trans R Soc Trop Med Hyg       Date:  1990 Jul-Aug       Impact factor: 2.184

Review 6.  Crimean-Congo hemorrhagic fever virus: new outbreaks, new discoveries.

Authors:  Onder Ergonul
Journal:  Curr Opin Virol       Date:  2012-04       Impact factor: 7.090

7.  Jalview Version 2--a multiple sequence alignment editor and analysis workbench.

Authors:  Andrew M Waterhouse; James B Procter; David M A Martin; Michèle Clamp; Geoffrey J Barton
Journal:  Bioinformatics       Date:  2009-01-16       Impact factor: 6.937

Review 8.  Application of pharmacogenomics to vaccines.

Authors:  Gregory A Poland; Inna G Ovsyannikova; Robert M Jacobson
Journal:  Pharmacogenomics       Date:  2009-05       Impact factor: 2.533

9.  Induction of hepatitis A virus-neutralizing antibody by a virus-specific synthetic peptide.

Authors:  E A Emini; J V Hughes; D S Perlow; J Boger
Journal:  J Virol       Date:  1985-09       Impact factor: 5.103

10.  A novel vaccine against Crimean-Congo Haemorrhagic Fever protects 100% of animals against lethal challenge in a mouse model.

Authors:  Karen R Buttigieg; Stuart D Dowall; Stephen Findlay-Wilson; Aleksandra Miloszewska; Emma Rayner; Roger Hewson; Miles W Carroll
Journal:  PLoS One       Date:  2014-03-12       Impact factor: 3.240

View more
  10 in total

Review 1.  Immunobiology of Crimean-Congo hemorrhagic fever.

Authors:  Sergio E Rodriguez; David W Hawman; Teresa E Sorvillo; T Justin O'Neal; Brian H Bird; Luis L Rodriguez; Éric Bergeron; Stuart T Nichol; Joel M Montgomery; Christina F Spiropoulou; Jessica R Spengler
Journal:  Antiviral Res       Date:  2022-01-11       Impact factor: 10.103

2.  Finding Potential Therapeutic Targets against Shigella flexneri through Proteome Exploration.

Authors:  Mohammad Uzzal Hossain; Md Arif Khan; Abu Hashem; Md Monirul Islam; Mohammad Neaz Morshed; Chaman Ara Keya; Md Salimullah
Journal:  Front Microbiol       Date:  2016-11-22       Impact factor: 5.640

Review 3.  Development of vaccines against Crimean-Congo haemorrhagic fever virus.

Authors:  Stuart D Dowall; Miles W Carroll; Roger Hewson
Journal:  Vaccine       Date:  2017-07-04       Impact factor: 3.641

Review 4.  Epitope Prediction by Novel Immunoinformatics Approach: A State-of-the-art Review.

Authors:  Ehsan Raoufi; Maryam Hemmati; Samane Eftekhari; Kamal Khaksaran; Zahra Mahmodi; Mohammad M Farajollahi; Monireh Mohsenzadegan
Journal:  Int J Pept Res Ther       Date:  2019-08-20       Impact factor: 1.931

5.  Towards the first multi-epitope recombinant vaccine against Crimean-Congo hemorrhagic fever virus: A computer-aided vaccine design approach.

Authors:  Mokhtar Nosrati; Mandana Behbahani; Hassan Mohabatkar
Journal:  J Biomed Inform       Date:  2019-03-27       Impact factor: 6.317

6.  Vaccinomics approach for scheming potential epitope-based peptide vaccine by targeting l-protein of Marburg virus.

Authors:  Tahmina Pervin; Arafat Rahman Oany
Journal:  In Silico Pharmacol       Date:  2021-03-06

7.  Development of Multi-epitope Based Subunit Vaccine Against Crimean-Congo Hemorrhagic Fever Virus Using Reverse Vaccinology Approach.

Authors:  Md Ashik Imran; Md Rubiath Islam; Akash Saha; Shahida Ferdousee; Moshiul Alam Mishu; Ajit Ghosh
Journal:  Int J Pept Res Ther       Date:  2022-06-24       Impact factor: 2.191

8.  Highly conserved regions in Ebola virus RNA dependent RNA polymerase may be act as a universal novel peptide vaccine target: a computational approach.

Authors:  Arafat Rahman Oany; Tahmina Sharmin; Afrin Sultana Chowdhury; Tahmina Pervin Jyoti; Md Anayet Hasan
Journal:  In Silico Pharmacol       Date:  2015-08-08

9.  An Immunopharmacoinformatics Approach in Development of Vaccine and Drug Candidates for West Nile Virus.

Authors:  Mohammad Uzzal Hossain; Chaman Ara Keya; Keshob Chandra Das; Abu Hashem; Taimur Md Omar; Md Arif Khan; S M Rakib-Uz-Zaman; Md Salimullah
Journal:  Front Chem       Date:  2018-07-06       Impact factor: 5.221

10.  Design of novel viral attachment inhibitors of the spike glycoprotein (S) of severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2) through virtual screening and dynamics.

Authors:  Arafat Rahman Oany; Mamun Mia; Tahmina Pervin; Md Junaid; S M Zahid Hosen; Mohammad Ali Moni
Journal:  Int J Antimicrob Agents       Date:  2020-09-25       Impact factor: 5.283

  10 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.