Literature DB >> 24062950

Proteomic Analysis of the Ontogenetic Variability in Plasma Composition of Juvenile and Adult Bothrops jararaca Snakes.

Karen de Morais-Zani1, Kathleen Fernandes Grego, Aparecida Sadae Tanaka, Anita Mitico Tanaka-Azevedo.   

Abstract

The ontogenetic variability in venom composition of some snake genera, including Bothrops, as well as the biological implications of such variability and the search of new molecules that can neutralize the toxic components of these venoms have been the subject of many studies. Thus, considering the resistance of Bothrops jararaca to the toxic action of its own venom and the ontogenetic variability in venom composition described in this species, a comparative study of the plasma composition of juvenile and adult B. jararaca snakes was performed through a proteomic approach based on 2D electrophoresis and mass spectrometry, which allowed the identification of proteins that might be present at different levels during ontogenetic development. Among the proteins identified by mass spectrometry, antihemorrhagic factor Bj46a was found only in adult plasma. Moreover, two spots identified as phospholipase A2 inhibitors were significantly increased in juvenile plasma, which can be related to the higher catalytic PLA2 activity shown by juvenile venom in comparison to that of adult snakes. This work shows the ontogenetic variability of B. jararaca plasma, and that these changes can be related to the ontogenetic variability described in its venom.

Entities:  

Year:  2013        PMID: 24062950      PMCID: PMC3654370          DOI: 10.1155/2013/135709

Source DB:  PubMed          Journal:  Int J Proteomics        ISSN: 2090-2166


1. Introduction

Poisonous snakes are responsible for around 50,000 deaths among five million cases of ophidian accidents per year in the world, especially in the rural areas of tropical countries in Asia, Africa, and South America [1, 2]. Envenomation by Viperidae snakes causes local tissue damages such as edema, hemorrhage, and myonecrosis, which are not well neutralized by conventional antivenom serotherapy [3]. Bothrops jararaca (B. jararaca) snake belongs to the Viperidae family and is the main reason for ophidian accidents in the state of São Paulo, Brazil [4]. Its victims usually have, besides systemic reactions of envenomation such as bleeding and blood incoagulability, local effects at the bite site such as edema, ecchymoses, compartmental syndrome, blisters, and necrosis [5]. The envenomation symptomatology has always stimulated researches on snake venom composition and function. Unfortunately, the same is not observed for snake plasma. Despite extensive biochemical and molecular characterization of blood coagulation in mammals, little information is available about haemostasis in other vertebrates [6], although there is an increasing interest in the “natural resistance” of snakes towards the toxicity of its own venom and towards other snake venoms. The inter- and intraspecies resistibility can contribute to the development of new strategies for the treatment of snake envenomation and the discovery of proteins that can neutralize the toxic components of these venoms [7], making snake plasma a rich source of bioactive molecules. It has been proposed that there are two different mechanisms that may account for this “natural immunity” [8]: (i) mutation of the gene encoding the target of the venom toxin, providing target resistance to the toxin [9-12] or (ii) presence of proteins that neutralize hemorrhagins [13-16], neurotoxins [17-22], or myotoxins [23, 24] in the blood of resistant animals. Several studies have shown that these proteins are either metalloproteinase inhibitors (antihemorrhagic factors) or PLA2 inhibitors (PLIs) (antineurotoxic/antimyotoxic factors) [8, 25–28]. Our group has purified and characterized two proteins from the plasma of B. jararaca snake, probably involved in its self-defense against accidental envenomation: (i) BjI, a blood coagulation inhibitor that recognizes thrombin-like enzymes present in B. jararaca venom by western blotting, suggesting a protective role of this protein [29] and (ii) fibrinogen [30], which showed resistance to hydrolysis caused by snake venoms. Interestingly, while bovine thrombin coagulated both B. jararaca and human fibrinogen, B. jararaca venom clotted human fibrinogen, but not B. jararaca fibrinogen. In addition, C. durissus terrificus and Lachesis sp. venoms could also clot human fibrinogen, with no action upon B. jararaca fibrinogen [31]. Another interesting feature described in some snake species is the ontogenetic variability in venom composition, a well-documented phenomenon that has long been studied [32]. Ontogenetic variation in venom composition has been reported in a number of genera [33-37], including Bothrops snakes [32, 38–41], which accounts for the differences in the clinical manifestations and severity of envenomation by juvenile and adult B. jararaca [42]. All the peculiarities related to ontogenetic variation in B. jararaca venom raised the question of whether the plasma composition of snakes follows the same modifications described in the venom. Therefore, a comparative study of the plasma composition of juvenile and adult B. jararaca snake was carried out. The present study focused on the antivenom proteins, considering their importance for the self-protection of these animals and for the search of new proteins for antivenom treatment.

2. Material and Methods

2.1. Blood Collection

Six specimens of B. jararaca (3 juveniles and 3 adults) from the Laboratory of Herpetology, Butantan Institute, São Paulo, Brazil, were used for this analysis. All specimens were females, juveniles (<60 cm snout-vent length) or adults (>82 cm snout-vent length) [43, 44] (Figure 1). Blood was collected by caudal venipuncture. Citrated blood samples were collected in a 9 : 1 ratio of blood to 3.8% sodium citrate solution, and plasma was obtained by blood centrifugation for 15 min at 1,200 g at room temperature and stored at −20°C. The Committee for the Ethical Use of Animals of Butantan Institute approved the experimental protocols (Protocol no. 542/08).
Figure 1

Adult and juvenile B. jararaca specimens.

2.2. Protein Determination

Protein concentrations were determined using bicinchoninic acid (Sigma, St. Louis, MO, USA) and bovine serum albumin (BSA) (Sigma, St. Louis, MO, USA) as a standard, according to Smith et al. [45].

2.3. Two-Dimensional Electrophoresis (2D Electrophoresis)

Two-Dimensional electrophoresis was used to separate proteins in the first dimension by isoelectric focusing (IEF) and in the second dimension by molecular weight using SDS-PAGE electrophoresis. IEF was carried out using precast Immobiline DryStrip gels pH 3–10 gradient (24 cm—IPG strip) using an IPGphor unit (GE Healthcare, Uppsala, Sweden). On each gel, 1 mg of protein was loaded. The IPG strip and sample were covered with Dry Strip Cover Fluid (GE Healthcare, Uppsala, Sweden) and run at constant voltage of 100 V for 12 h and 500 V up to the accumulation of 500 Vh, followed by gradient voltage from 500 to 1,000 V up to the accumulation of 800 Vh, another gradient voltage from 1,000 to 10,000 Vh up to the accumulation of 16,500 Vh, and constant voltage of 10,000 V up to the accumulation of 22,200 Vh. IEF was followed by a SDS-PAGE using 10% resolving gels, according to Laemmli protocol [46], and DALTsix system (GE Healthcare, Uppsala, Sweden). The gels were run at constant amperage of 15 mA and constant voltage of 80 V for 1 h and then constant amperage of 60 mA and constant voltage of 500 V. Protein spots were visualized using Coomassie Blue R350 staining procedure according to GE Healthcare (Uppsala, Sweden) protocol. Each sample was analyzed in triplicate. Image acquisition of gels was performed using the ImageScanner III densitometer (GE Healthcare, Uppsala, Sweden) and the gels were analyzed using ImageMaster Platinum 7.0 software (GE Healthcare, Uppsala, Sweden). The spots were quantified using the % of spot volume criterion, which is automatically calculated by the ImageMaster software. The match analysis was performed in an automatic mode, and further manual editing was performed to correct mismatched and unmatched spots. A criterion of P < 0.05 was used to define the significant difference when analyzing the paired spots between the two groups (n = 3) according to ANOVA.

2.4. Protein Identification

For identification of spots with quantitative variation by mass spectrometry, gel spots were excised and in-gel trypsin digestion was performed according to Shevchenko et al. [47]. An aliquot (4.5 μL) of the peptide mixture was separated by C18 (100 μm × 100 mm) RP-nano UPLC (nanoAcquity UPLC, Waters, Milford, MA, USA) coupled with a Q-TOF Ultima mass spectrometry (Waters, Milford, MA, USA) with a nanoelectrospray source at flow rate of 600 nL/min. The gradient condition was 15–90% acetonitrile in 0.1% formic acid over 10 min. The instrument was operated in the “top three” mode, in which one MS spectrum is acquired followed by MS/MS of the top three most-intense peaks detected. The resulting spectra were acquired using MassLynx v. 4.1 software, and the raw data files were converted into a peak list format (mgf) without summing the scans using Mascot Distiller 2.2.1.0, 2008, Matrix Science (Matrix Science Ltd., London, UK) and searched against nonredundant protein database (NCBI) using Mascot, with carbamidomethylation as fixed modification and oxidation of methionine as variable modifications, one trypsin missed cleavage and tolerance of 20 ppm for both precursor and fragment ions.

3. Results and Discussion

It is known that many venomous snakes are resistant to their own venoms and that this natural resistance is due to the neutralizing factors present in their plasma. In the last years, studies on animals that resist the action of snake venoms have led to the discovery and characterization of proteins responsible for this resistance. The result of these studies was the structural and functional characterization of protein inhibitors of hemorrhagic metalloproteinases, as well as myotoxic and neurotoxic PLA2 [7]. Although specific endogenous inhibitors for snake venom have been widely described in the literature and have been the subject of review articles [25, 48, 49], the correlation between venom and plasma ontogenetic development has not been reported yet. Plasma from juvenile and adult B. jararaca were analyzed by 2D electrophoresis and were compared using ImageMaster Platinum 7.0 software (see experimental section for details). Figure 2 shows that the proteomic profile of juvenile and adult snakes is similar, suggesting minor ontogenetic differences between the plasma protein content of these two stages of development. The number of matches represents the spots identified in juvenile and adult plasma and exclusive spots were considered those present in only one group, juvenile or adult plasma. The results showed 1,250 matches between juvenile and adult plasma, with only 45 spots showing quantitative variation (P < 0.05). Taking into account these 45 spots, 18 are exclusive for juvenile and 16 for adult snakes. In addition, 5 spots were increased in juvenile and 6 in adults (Table 1), suggesting that the ontogenetic development is associated to little changes in the protein content of the plasma.
Figure 2

Analysis of juvenile and adult B. jararaca plasma by 2D electrophoresis. Plasma proteins (1 mg) from (a) juvenile and (b) adult were submitted to isoelectric focusing on 3–10 IPG strips (24 cm) followed by 10% SDS-PAGE. Gels were stained with Coomassie Blue R350. Spots present at different levels were indicated with arrows and identified by nanoESI-Q-TOF.

Table 1

Number of matches and spots present at different levels in juvenile and adult B. jararaca plasma. 2D electrophoresis were analyzed by ImageMaster Platinum 7.0 software (GE Healthcare).

Number of matches Spots showing quantitative
variation
Exclusive spotsIncreased spots
Juvenile B. jararaca 1,250185
Adult B. jararaca 166

Total: 45
In order to identify spots present in different levels and correlate these differences to the snake development, the corresponding spots were excised, in-gel digested with trypsin, and submitted to mass spectrometry (MS/MS) (Table 2 and Figure 2). It is important to emphasize that only spots showing quantitative variation were submitted to MS/MS analysis. In addition, out of 45 spots analyzed, only 17 were identified, 7 in juvenile and 10 in adult plasma. During this process, we faced the limited available information about reptilian genome and proteome, described by other authors [50, 51]; thus, this study identified proteins by sequence homologies through the National Center for Biotechnology Information database (NCBI). Among the proteins identified, transferrin was classified as increased in adult plasma (spot no. 18). This could be due to a differential iron transport mechanism across the development stage of snakes, as also reported for humans [52]. The complement system of snakes is of particular interest because the venom of Naja naja and related Asian snakes of the genus Naja [53] and the venom of Austrelaps superbus [54], an Australian elapid, contain a C3 structural and functional analog, cobra venom factor (CVF). Functionally, CVF resembles the C3 activation product C3b as it forms a complex with B factor in the presence of Mg2+ [55]. CFV and its analogs have become an important research tool in order to study the role of complement in host defense, immune response, and disease pathogenesis [53]. In B. jararaca plasma, C3 complement was identified in juvenile and adult plasma (Figure 2—spots 39 and 29, resp.) with a slight difference concerning the molecular weights. MS/MS analysis identified these spots as C3 complement by sequence homology to C3 from Naja naja (gi |399269). This protein, described in Naja naja, has molecular weight of 185 kDa and theoretical pI of 5.9. In this work, the two spots identified as C3 complement have molecular mass around 75 kDa and pI around 10, suggesting the presence of fragments in our samples. Another protein present in adults, according to analysis by 2D electrophoresis, is the antihemorrhagic factor Bj46a (Figure 2—spot 41). Bj46a is a glycoprotein isolated from B. jararaca plasma that inhibits the snake venom metalloproteinases atrolysin C and jararhagin and B. jararaca venom hemorrhagic activity [56]. Interestingly, Antunes et al. [57] demonstrated that the venom of adult B. jararaca specimens was more hemorrhagic than the venom of newborn snakes. The hemorrhagic activity present in B. jararaca venom is generally credited to P-III metalloproteinases, like jararhagin [58, 59]. The reduced hemorrhagic activity present in the newborn B. jararaca venom described by Antunes et al. [57] appears to be correlated with the lack of jararhagin in newborn venom. This work showed the sequence of about 35% of Bj46a (data not shown). All of the 122 amino acids identified showed identity to the corresponding sequence present in the databank. However, Bj46a was also identified in juvenile B. jararaca plasma submitted to 1D electrophoresis and analyzed by Fourier Transform Ion Cyclotron Resonance mass spectrometry (data not published), suggesting the presence of this inhibitor in juvenile and adult snakes. One hypothesis to explain this finding is that Bj46a might be present in low levels in juvenile B. jararaca plasma and could not be identified by 2D electrophoresis. This finding linked to our results suggests a correlation between the ontogenetic development of the venom and the plasma composition of B. jararaca. The high incidence of PLI identified among spots with quantitative variation is noteworthy. This protein corresponds to 71 and 30% of the total proteins identified in juvenile and adult plasma, respectively, and the present work showed that PLIs are increased in juvenile snakes (Figure 2—spots, nos. 16 and 22). Forty-nine percent of γ-PLI sequence was obtained in this study (data not shown). Out of 99 amino acids identified, only one has no identity to the corresponding sequence present in the databank. This is the first time that this protein is shown in B. jararaca, since the protein sequence described in UNIPROT databank (http://www.uniprot.org) was derived from DNA data. Moreover, α-PLI was also possible to be identified, and about 48% of its sequence was obtained (data not shown). As seen for Bj46a, all of the 122 amino acids identified showed identity to the corresponding sequence present in the databank. It is noteworthy the high variability of PLIs found in juvenile or adult plasma, probably not only due to different glycosylation pattern but also to the amino acid sequence, as illustrated by spots 14 and 20 (Figure 2), which are similar to Trimeresurus flavoviridis PLIs. This peculiarity is related to the high incidence of PLIs isoforms present in snake plasma, showing the physiological importance of these inhibitors for the physiology of these animals [60, 61]. The role played by PLIs has been the physiological protection of snakes against accidental envenomation or due to the feeding habits of ophiophagous specimens [8, 28, 60]. In the last two decades, the number of reports on endogenous PLIs in the plasma of snakes has increased, motivated by the need to develop potentially selective inhibitors for human PLA2. Snake venom PLA2 exhibits a wide variety of pharmacological effects and is involved in the envenomation pathophysiology, presenting myotoxic and neurotoxic activities [62]. Antunes et al. [57] demonstrated that newborn B. jararaca venom shows catalytic PLA2 activity almost twice higher than that of the adult venom, and our results showed that the same occurs regarding γ-PLI, indicating a connection between venom and plasma components. In addition, besides the antivenom role of PLI, these proteins can be a favorable therapeutic approach in the treatment of inflammatory processes, once γ-PLI has been studied as a potential model for the development of selective inhibitors of proinflammatory PLA2 in humans [60, 63]. In short, the results showed that there are some differences in plasma protein composition between juvenile and adult B. jararaca and that these differences could be related to the ontogenetic variation of the venom composition. This is the first comparative study of protein profiles of juvenile and adult snake plasma. This approach is important for a better understanding of the ontogenetic development of B. jararaca. Moreover, associated with the knowledge of ontogenetic changes in venom composition and snakebite clinical reports, the differences identified could be used for the development of more specific antivenoms. It has been suggested that antiophidian serum could be enriched with natural antitoxins in order to increase the serum ability to neutralize snake venom [63]. Thus, the results presented here in this paper can contribute to the knowledge of antivenom mechanisms against ophidian accidents.

(a)  

Juvenile Bothrops jararaca snake
Spot numbera Protein name (organism)ScoreProtein accession numberb Peptide sequencesc Volumed (%)
1 γ-phospholipase A2 inhibitor(Bothrops jararaca)556gi∣157885066KCIDIVGHRKNCFSSSICKLSCDFCHNIGKVFLEISSASLSVRHEHFPGDIAYNLKLGQIDVNIGHHSYIRDCDGYQQECSSPEDVCGKCIDIVGHRHEHFPGDIAYNLK1.6137

14 γ-phospholipase A2 inhibitor subunit B (Trimeresurus flavoviridis)120gi∣155676753RACCVGDECKGCATESLCTLLQK1.6347

16 γ-phospholipase A2 inhibitor (Bothrops jararaca)467gi∣157885066KCIDIVGHRNCFSSSICKVFLEISSASLSVRHEHFPGDIAYNLKTVHKNCFSSSICKLGQIDVNIGHHSYIRDCDGYQQECSSPEDVCGKKCIDIVGHRHEHFPGDIAYNLK0.5292

20 γ-phospholipase A2 inhibitor subunit B (Trimeresurus flavoviridis)284gi∣155676753ACCVGDECKRACCVGDECKDTENQCLSLTGKGCATESLCTLLQK0.5687

22 γ-phospholipase A2 inhibitor (Bothrops jararaca)496gi∣157885068INCCEKKCIDIVGHRGRINCCEKNCFSSSICKVFLEISSASLSVRHEHFPGDIAYNLKTVHKNCFSSSICKLGQIDVNIGHHSYIRKCIDIVGHRHEHFPGDIAYNLK3.5287

39C3 complement(Naja naja)221gi∣399269RVGLVAVDKIWDTIEKIQKPGAAMKGIYTPGSPVRIKLEGDPGARAVYVLNDKYKEYVLPSFEVR0.1644

44Albumin(Trimeresurus flavoviridis)92gi∣56790036LVEDIQNDHIIQIIPQAPTSNLIEITKR0.3461

(b)  

Adult Bothrops jararaca snake
Spot numbera Protein name (organism)ScoreProtein accession numberb Peptide sequencesVolumec (%)
7 γ-phospholipase A2 inhibitor (Bothrops jararaca)511gi∣157885066KCIDIVGHRNCFSSSICKVFLEISSASLSVRHEHFPGDIAYNLKLGQIDVNIGHHSYIRDCDGYQQECSSPEDVCGKKCIDIVGHRHEHFPGDIAYNLK0.5813  

16 γ-phospholipase A2 inhibitor (Bothrops jararaca)470gi∣157885066KCIDIVGHRNCFSSSICKSCDFCHNIGKVFLEISSASLSVRHEHFPGDIAYNLKLGQIDVNIGHHSYIRDCDGYQQECSSPEDVCGK0.0990

18Transferrin (Lamprophis fuliginosus)220gi∣108792441IVWCAVGKVCTFHTHDWEADAITLDGGHIYTAGK0.4829

24Transferrin (Lamprophis fuliginosus)232gi∣108792441LVLEQQKIVWCAVGKVCTFHTHDWEADAITLDGGHIYTAGK0.2124

29C3 complement(Naja naja)363gi∣399269VGLVAVDKLEGDPGARIWDTIEKIQKPGAAMKGIYTPGSPVRIKLEGDPGARDTCMGTLVVKAVYVLNDKYKEYVLPSFEVR0.2256

38 α-phospholipase A2 inhibitor precursor (Bothrops jararaca)383gi∣167547111LYVTNKREFANLRKNFEALRRSFGSGSERGAFLTVHKAKAFANVLERKVLNSLIDALMHLQREQICEQAEGHIPSPQLENHNK0.1067

40 β-Actin (Rachycentron canadum)867gi∣161376754AGFAGDDAPRDLTDYLMKGYSFTTTAEREITALAPSTMKAVFPSIVGRPRDSYVGDEAQSKRIWHHTFYNELRQEYDESGPSIVHRLDLAGRDLTDYLMKSYELPDGQVITIGNEREEEIAALVVDNGSGMCKVAPEEHPVLLTEAPLNPKDLYANTVLSGGTTMYPGIADRTTGIVMDSGDGVTHTVPIYEGYALPHAILR0.0060

41Antihemorrhagic factor Bj46a (Bothrops jararaca)68gi∣48428681YALNVIKNEGHAHSHLIQQHVEKNCPKCPILLPSNNPQVVDSVEYVLNKHNEK HNEKLSDHVYEVLEISR GDLECDEKDAKEWTDTGVR IMFNVDTFKEDVFAKLSDHVYEVLEISR VPVAFVK ELPKDISDRVHHFEL EWTDTGVR 0.09264

43Albumin (Trimeresurus flavoviridis)234gi∣56790036ECFDTKYGINDCCAKLVEDIQNDHIIQQLCHCCDSSFISRLEDHVQCLHTGEEQLK0.0497

44Albumin (Trimeresurus flavoviridis)235gi∣56790036FIETHEKNNCDNYKLVEDIQNDHIIQQLCHCCDSSFISRLEDHVQCLHTGEEQLK0.3964

aSpot number refers to that shown in Figure 2.

bNCBI accession number.

cObtained by MS/MS analysis.

d P < 0.05.

  54 in total

1.  The effects of metal ions and temperature on the interaction of cobra venom factor and human complement factor B.

Authors:  P Hensley; M C O'Keefe; C J Spangler; J C Osborne; C W Vogel
Journal:  J Biol Chem       Date:  1986-08-25       Impact factor: 5.157

2.  Biochemical and pharmacological similarities between the venoms of newborn Crotalus durissus durissus and adult Crotalus durissus terrificus rattlesnakes.

Authors:  J M Gutiérrez; M C dos Santos; M de F Furtado; G Rojas
Journal:  Toxicon       Date:  1991       Impact factor: 3.033

3.  Cleavage of structural proteins during the assembly of the head of bacteriophage T4.

Authors:  U K Laemmli
Journal:  Nature       Date:  1970-08-15       Impact factor: 49.962

Review 4.  Natural inhibitors of toxic phospholipases A(2).

Authors:  G Faure
Journal:  Biochimie       Date:  2000 Sep-Oct       Impact factor: 4.079

Review 5.  Snake envenomation and protective natural endogenous proteins: a mini review of the recent developments (1991-1997).

Authors:  M M Thwin; P Gopalakrishnakone
Journal:  Toxicon       Date:  1998-11       Impact factor: 3.033

6.  A phospholipase A2 inhibitor from the plasma of the South American rattlesnake (Crotalus durissus terrificus). Protein structure, genomic structure, and mechanism of action.

Authors:  C L Fortes-Dias; Y Lin; J Ewell; C R Diniz; T Y Liu
Journal:  J Biol Chem       Date:  1994-06-03       Impact factor: 5.157

7.  Purification, characterization and binding interactions of the Chinese-cobra (Naja naja atra) serum antitoxic protein CSAP.

Authors:  J Shao; H Shen; B Havsteen
Journal:  Biochem J       Date:  1993-07-15       Impact factor: 3.857

8.  Molecular structure and mechanism of action of the crotoxin inhibitor from Crotalus durissus terrificus serum.

Authors:  J Perales; C Villela; G B Domont; V Choumet; B Saliou; H Moussatché; C Bon; G Faure
Journal:  Eur J Biochem       Date:  1995-01-15

9.  A new blood coagulation inhibitor from the snake Bothrops jararaca plasma: isolation and characterization.

Authors:  Anita M Tanaka-Azevedo; Aparecida S Tanaka; Ida S Sano-Martins
Journal:  Biochem Biophys Res Commun       Date:  2003-09-05       Impact factor: 3.575

10.  Ontogenetic variations in the venom proteome of the Amazonian snake Bothrops atrox.

Authors:  Rafael A P Guércio; Anna Shevchenko; Andrej Shevchenko; Jorge L López-Lozano; Jaime Paba; Marcelo V Sousa; Carlos A O Ricart
Journal:  Proteome Sci       Date:  2006-05-11       Impact factor: 2.480

View more
  4 in total

1.  PepExplorer: a similarity-driven tool for analyzing de novo sequencing results.

Authors:  Felipe V Leprevost; Richard H Valente; Diogo B Lima; Jonas Perales; Rafael Melani; John R Yates; Valmir C Barbosa; Magno Junqueira; Paulo C Carvalho
Journal:  Mol Cell Proteomics       Date:  2014-05-30       Impact factor: 5.911

2.  The red seaweed Plocamium brasiliense shows anti-snake venom toxic effects.

Authors:  Geisiane Alves da Silva; Thaisa Francielle Souza Domingos; Rainiomar Raimundo Fonseca; Eladio Flores Sanchez; Valéria Laneuville Teixeira; André Lopes Fuly
Journal:  J Venom Anim Toxins Incl Trop Dis       Date:  2015-02-10

3.  Differential transcript profile of inhibitors with potential anti-venom role in the liver of juvenile and adult Bothrops jararaca snake.

Authors:  Aparecida Sadae Tanaka; Anita Mitico Tanaka-Azevedo; Cícera Maria Gomes; Karen de Morais-Zani; Stephen Lu; Diego de Souza Buarque; Glória Regina Cardoso Braz; Kathleen Fernandes Grego
Journal:  PeerJ       Date:  2017-04-27       Impact factor: 2.984

4.  Comparative compositional and functional analyses of Bothrops moojeni specimens reveal several individual variations.

Authors:  Weslei da Silva Aguiar; Nathália da Costa Galizio; Caroline Serino-Silva; Sávio Stefanini Sant'Anna; Kathleen Fernandes Grego; Alexandre Keiji Tashima; Erika Sayuri Nishiduka; Karen de Morais-Zani; Anita Mitico Tanaka-Azevedo
Journal:  PLoS One       Date:  2019-09-12       Impact factor: 3.240

  4 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.