LC3 is widely used marker for macroautophagy assays. After translation pro-LC3 is processed by Atg4 to expose C-terminal glycine residue for downstream conjugation reactions to accomplish the conversion of LC3-I to LC3-II. SDS-PAGE based Western blot (Wb) is generally utilized to quantify LC3-II levels where the LC3-I band migrates slower than LC3-II. We found that pro-human LC3B migrated at similar rate as LC3B-II in SDS-PAGE. The carboxyl-terminal five amino acids, particularly Lysine(122) and Leucine(123) of human LC3B play a major role in the faster migration of unprocessed LC3B, rendering it indistinguishable from LC3B-II in Wb assays. The unique faster migration of unprocessed LC3B than LC3B-I is also revealed in mouse LC3B, rat LC3B and rat LC3 but not in human LC3C. Our findings for the first time define pro-LC3 migration patterns for LC3 family member from human, mouse and rat species in SDS-PAGE. These findings provide a reference for pro-LC3 band patterns when Atg4 function is inhibited.
LC3 is widely used marker for macroautophagy assays. After translation pro-LC3 is processed by Atg4 to expose C-terminal glycine residue for downstream conjugation reactions to accomplish the conversion of LC3-I to LC3-II. SDS-PAGE based Western blot (Wb) is generally utilized to quantify LC3-II levels where the LC3-I band migrates slower than LC3-II. We found that pro-humanLC3B migrated at similar rate as LC3B-II in SDS-PAGE. The carboxyl-terminal five amino acids, particularly Lysine(122) and Leucine(123) of humanLC3B play a major role in the faster migration of unprocessed LC3B, rendering it indistinguishable from LC3B-II in Wb assays. The unique faster migration of unprocessed LC3B than LC3B-I is also revealed in mouseLC3B, ratLC3B and ratLC3 but not in humanLC3C. Our findings for the first time define pro-LC3 migration patterns for LC3 family member from human, mouse and rat species in SDS-PAGE. These findings provide a reference for pro-LC3 band patterns when Atg4 function is inhibited.
Macroautophagy (simply referred to as autophagy) is a highly conserved cellular degradation process. In contrast to the ubiquitin-proteasome degradation system, two ubiquitin-like conjugation systems are essential for autophagy: Atg12-Atg5 and Atg8/LC3- phosphatidylethanolamine (PE) [1], [2].Atg8/LC3 lipidation involves a cysteine protease, Atg4, to process pro-LC3 exposing a C-terminal glycine residue to generate LC3-I. LC3-I is activated by Atg7 as a thioester bond is formed between a catalytic cysteine residue of Atg7 and the C-terminal glycine of LC3-I. LC3-Atg7 intermediate afterward exchanges with Atg3, an E2-like enzyme, to form a second thioester intermediate, LC3-Atg3 [3]. Finally, the lipidation process is completed by the putative E3-like enzyme Atg16L1•Atg5-Atg12 complex to form LC3-II, as LC3-Atg3 is exchanged with PE [4].Mammalian cells have several LC3 isoforms (MAP1LC3A, B, B2 and C, simply referred as to LC3A, B, B2 and C) and paralogues (GABARAP, GABARAPL1, and GATE-16) [5]. Four Atg4 homologues (Atg4A, Atg4B, Atg4C, and Atg4D) are identified in mammalian cells. Atg4B cleaves LC3, GATE-16, and GABARAP, with the highest affinity for LC3 [5]. Atg4A is preferential for GABARAP and GATE-16 [6].Although mammalian cells contain several variants of LC3 and paralogues, LC3B is the most widely used marker in autophagic assays as LC3B is expressed in nearly all tissues [7]. If not specifically described, most of LC3 Wb assays are based up LC3B in the publications. Indeed, most LC3 antibodies commercially available for LC3-I/LC3-II conversion assays are generated based on LC3B. By Wb assay, there are two distinguishable bands recognized as LC3-I (slower moving band) and LC3-II (faster moving band) [8]. The ratio between LC3-II and LC3-I or an appropriate loading control is generally regarded as an indicator and measure for the overall cellular process of autophagy.Replacement of the Glycine120 residue within LC3B (G120A) abolishes LC3B cleavage by Atg4B [9]. Of interest, we have found that the G120A mutation of humanLC3B actually migrated to a similar site as LC3B-II by SDS-PAGE. Initially, we considered that LC3BG120A might be cleaved by an unknown enzyme in vivo explaining its altered migration behavior; however, after sequencing purified LC3BG120A by MALDI ISD, we found that it proved to be the full-length protein. We question whether unprocessed humanLC3B migrates at a similar rate to that of LC3BG120A in SDS- polyacrylamide gel. We found that the last five amino acids in humanLC3B alter unprocessed LC3B migration behavior in SDS-PAGE. The consequence of this unique property of humanLC3B leads to pro-LC3B indistinguishable from LC3B-II in Wb assay. The unique character of C-terminal amino acids after the Glycine conjugation site renders pro-LC3B faster migration than LC3B-I was furthermore revealed in mouseLC3B, ratLC3B, and ratLC3.
Materials and Methods
Reagent and Antibodies
Cell culture reagents were purchased from LONZA (Walkersville, MD). The following antibodies were used: Rabbit anti- LC3B antibody (Cell Signaling, raised by a synthetic peptide from N-terminal 2-25aa); Rabbit anti- LC3A antibody (abcam, raised by a synthetic peptide from N-terminal 2-15aa); Rabbit anti- LC3C antibody (Abnova, raised by a synthetic peptide from N-terminal 2-30aa); mouse anti-GFP antibody (Santa Cruz biotech); mouse anti- FLAG M2 and β-actin antibodies (Sigma-Aldrich); and Goat anti-rabbit IgG (HRP-conjugated) and Goat anti-mouse IgG (HRP-conjugated) (Jackson ImmunoResearch). Recombinant His6-Atg4B was from R&D system (E-400). Atg4B siRNA and Control siRNA are from Cell Signaling. All other reagents were purchased from Sigma-Aldrich.
Cell Culture
HEK293 (ATCC), A549 cells (ATCC), wild-type MEF cell (MEFwt) and Atg7 knockout MEF cell (MEFatg7KO) were provided by Dr. Masaaki Komatsu, and have been described [10]. Cells were grown in DMEM supplemented with 10% fetal bovine serum, 2 mM L-glutamine, and 100 U/ml penicillin/streptomycin in a 5% CO2 incubator at 37°C.
LC3 Gene Expression Vectors
HumanMAP1LC3B Open Reading Frame (ORF) with N-terminal Myc-tag, 3xFlag tag or GFP tag was cloned into an expression vector by PCR using cDNA from HEK293 cell. Point mutations were generated by site-directed mutagenesis (Invitrogen) on these vectors as described in the results section. Truncates of LC3B were generated based on 3xFlag tagged LC3B vector by introducing a stop codon after indicated amino acid at C-terminal as described in the results section by site-directed mutagenesis. 3xFlag tagged LC3B and its mutant ORFs were sub-cloned into pTriEx-1.1 (Novagen) to analyze their expression patterns in mammalian and E.coli cells, respectively. None tagged ORFs for HumanLC3B and LC3C, and mouseLC3B and LC3A, and RatLC3B and RatLC3 and the correspondent mutants were inserted into pTriEx1.1. All inserts were validated by DNA sequencing.Adenoviral vectors Ad-GFP-LC3B, Ad-GFP-LC3BG120A, Ad-GFP-LC3BG120E and Ad-GFP-LC3BG120D were generated using pAdlox system and purified as described [11].
Recombinant Protein Purification and Sequencing
3xFlag-LC3BG120Aexpression plasmid was transfected into HEK293 cells by lipofectamine 2000 (Invitrogen). 3xFlag-LC3BG120A recombinant proteins were purified 48 hours later post transfection using total cell lysate by Flag antibody (M2) based affinity column, according to the suggested protocol. Eluted 3xFlag-LC3BG120A proteins were analyzed by 12% of SDS-PAGE and stained with PageBlue Protein Staining Solution (Thermo Scientific). The N-terminal and C-terminal sequences of the purified proteins were determined by top-down protein sequencing by MALDI ISD mass spectrometry of intact proteins (Laboratory for Proteomic Mass Spectrometry, University of Massachusetts Medical School). Analyses were performed on a Shimadzu Biotech Axima TOF2 (Shimadzu Instruments) matrix-assisted-laser desorption/ionization Time-of-Flight (MALDI-TOF) mass spectrometer. Proteins were analyzed in positive ion Linear mode. For intact protein mass measurement the instrument was set with a mass range extending to 50 kd using a pulsed extraction setting of 16952. Apomyoglobin MH+ of 16952 and MH2+ of 8476 were used as the standard to calibrate the instrument. A 0.5 µl aliquot was applied to the MALDI target followed by the addition of 0.5 µl of Sinapinic acid as the desorption matrix (10 mg/ml in 0.1%TFA: Acetonitrile 50∶50) followed by air drying prior to insertion into the vacuum source. For In-Source-Decay (ISD) sequencing the instrument was set to Linear positive ion mode with a pulsed extraction setting of 2500. Spectra were acquired using 1, 5-Diaminonaphthalene (10 mg/ml in 0.1%TFA: Acetonitrile 50∶50) as the matrix. Samples were applied in the same way as the Sinapinic acid matrix. For database searching selected ISD fragments (* in the spectra) were used as virtual precursors and submitted to the Mascot search engine MS/MS ion search program (Matrix Science, Ltd. Version 2.3) through the Shimadzu Biotech Launchpad software. For Z ion series a Mascot modification of “amino loss N-term” was created to accommodate the structure of the Z ion when selecting fragment precursors.
Expression of Flag Tagged or None Tagged LC3B and its Mutants in HEK293 and E.coli
pTriEx 1.1 expression vector based Flag tagged LC3B and none tagged LC3B and its mutants were expressed in HEK293 for 24 hours or in Tuner™(DE3)pLacI E. coli (Clontech) by induction of expression with 1 mM of IPTG for four hours. Cell lysates were separated by15% of SDS-polyacrylamide gels and analyzed by immunoblotting with Flag or LC3B antibodies.
Atg4B Cleavage Assay
Flag tagged humanLC3B, LC3B and its mutants in pTriEX1.1 expression vectors were transformed into Tuner™(DE3) pLacI cells. Colonies were picked and incubated in 4 ml of LB media with 1% of glucose overnight in a shaker at 37°C. 500 µl of overnight bacteria culture was then added into a new tube with 3 ml fresh LB media and incubated in shaker at 37°C for three hours. 1 mM of IPTG was added to induce LC3Bexpression for three hours. Bacteria were then collected and washed once with ice cold phosphate-buffered saline. Pellets were resuspended in RIPA buffer (50 mM TrisHCl pH8, 150 mM NaCl and 1% NP-40) and sonicated. Cell lysate was centrifuged at 10,000g for 15 min at 4°C. 10 µg of supernatant was used for Atg4B cleavage assay in 50 µl digestion buffer (25 mM Tris-HCl, pH7.4, 50 mM KCl) with 0.2 µg of Atg4B at 37°C. Digestion mixture was collected at different time point and analyzed by immunoblotting using15% of SDS-polyacrylamide gels.
Fluorescence Microscopy
A549, MEFwt or MEFatg7KO cells were infected with adenoviral vectors expressing GFP-LC3B, GFP-LC3BG120A, GFP-LC3BG120E, or GFP-LC3BG120D at 5 MOI. Twenty four hours post infection cells were treated with 100 µM of Chloroquine for two hours to induce GFP-LC3B punctation. Images were then recorded using EVOSfl fluorescence microscopy.
Western Blotting
Cells were transfected or infected with expression plasmid vectors or viral vectors. Cells were rinsed with ice-cold phosphate-buffered saline twenty-four hours later, scraped, and collected by centrifugation at 4°C and lysed in RIPA lysis buffer (Cell Signaling) with protease inhibitor cocktails (Sigma Aldrich). Cell lysates were centrifuged at 15,000 g for 15 min at 4°C, and supernatants were collected. 15 µg of cell lysates were separated by 15% of SDS-polyacrylamide gels and transferred to reinforced NC membrane (Whatman GmbH). Blots were probed with primary antibodies and detected with horseradish peroxidase (HRP)-conjugated anti-mouse or anti-rabbit IgG (Jackson ImmunoResearch). Bands were visualized using SuperSignal West Pico Substrate (Thermo Scientific).
Results
Human LC3BG120A Migrates at a Similar Rate as LC3B-II Specie in SDS-PAGE
Expression vectors of humanLC3B used in this study are listed in Figure 1. Other expression vectors used in this study are described in Materials and Methods section and Results section, respectively. HumanLC3B must be cleaved at the Gycine 120 position by Atg4B prior to the sequential formation of conjugates with Atg7 and Atg3 in the process of LC3B-PE conjugation. N-terminal Myc-tagged humanLC3B demonstrated two bands in SDS-PAGE based Wb assay (Fig. 2Aa, lane 1) corresponding to Myc-LC3B-I (cleaved form) and Myc-LC3B-II (lipidated form). A truncated Myc-LC3BG120 also demonstrated Myc-LC3B-II species (Fig. 2Aa, lane3) indicating both wild-type and G120 mutant of Myc tagged LC3B undergo the expected steps for lipidation with PE. We unexpectedly observed the Myc-LC3BG120A mutant migrated at a similar rate as Myc-LC3B-II (Fig. 2Aa, lane 2). This was confirmed utilizing alternate 3xFlag tagged humanLC3B and LC3BG120A vectors (Flag-LC3B and Flag-LC3BG120A, respectively). Again, Flag-LC3BG120A migrated at a similar rate as Flag-LC3B-II (Fig. 2Ab).
Figure 1
Schematic diagram of expression plasmid constructs.
Myc, GFP, or 3xFlag tag is fused to human MAP1LC3B ORF at its N- terminus. The box bars on the left represent the N-terminal tags. The dashed lines represent MAP1LC3B with 27 amino acids sequence shown at the carboxyl terminus. The arrow points to Glycine 120 conjugation site. The last five amino acids at the C-terminal are underlined. Mutant amino acid or last amino acid of LC3B is bolded. Human LC3C, Rat LC3, Rat LC3B, Mouse LC3A, Mouse LC3B and the related mutants are described in Result section.
Figure 2
G120A mutant of human LC3B has similar mobility to LC3B-II in SDS-polyacrylamide gel.
, plasmids expressing Myc-LC3B, myc-LC3BG120A or Myc-LC3BG120 was expressed in HEK293 cells for 24 hours. Cells were harvested and lysed by sonication, and 10 µg of total protein of each lysate were separated by 15% of SDS-polyacrylamide gel, followed by immunoblotting with anti-LC3B antibody. plasmids expressing Flag-LC3B or Flag-LC3BG120A was expressed in HEK293 cells for 24 hours. Cells were lysed followed by immnuoblotting using Flag-antibody. plasmids expressing LC3B, LC3BG120A or LC3BA120 was expressed in HEK293 cells for 24 hours. Cells were treated with 50 µM of CQ for 2 hours before collection. Transient expressed proteins were analyzed by immunoblotting using LC3B antibody. plasmids expressing GFP-LC3B or GFP-LC3G120A was expressed in HEK293 cells for 24hours. Cells were then treated with 50 µM of Chloroquine (CQ) for 2 hours. Wb assays were performed using anti-GFP antibody. A549 cells infected with Adenoviral vectors expressing GFP-LC3B or GFP-LC3BG120A at 5 MOI for 24 hours. Cells were then treated with 50 µM of CQ for two hours. GFP-LC3B punctuation was recorded by fluorescence microscopy. CM, complete media, CQ, complete media plus CQ. Scale bar: 25 micron.
Schematic diagram of expression plasmid constructs.
Myc, GFP, or 3xFlag tag is fused to humanMAP1LC3B ORF at its N- terminus. The box bars on the left represent the N-terminal tags. The dashed lines represent MAP1LC3B with 27 amino acids sequence shown at the carboxyl terminus. The arrow points to Glycine 120 conjugation site. The last five amino acids at the C-terminal are underlined. Mutant amino acid or last amino acid of LC3B is bolded. HumanLC3C, RatLC3, RatLC3B, MouseLC3A, MouseLC3B and the related mutants are described in Result section.
G120A mutant of human LC3B has similar mobility to LC3B-II in SDS-polyacrylamide gel.
, plasmids expressing Myc-LC3B, myc-LC3BG120A or Myc-LC3BG120 was expressed in HEK293 cells for 24 hours. Cells were harvested and lysed by sonication, and 10 µg of total protein of each lysate were separated by 15% of SDS-polyacrylamide gel, followed by immunoblotting with anti-LC3B antibody. plasmids expressing Flag-LC3B or Flag-LC3BG120A was expressed in HEK293 cells for 24 hours. Cells were lysed followed by immnuoblotting using Flag-antibody. plasmids expressing LC3B, LC3BG120A or LC3BA120 was expressed in HEK293 cells for 24 hours. Cells were treated with 50 µM of CQ for 2 hours before collection. Transient expressed proteins were analyzed by immunoblotting using LC3B antibody. plasmids expressing GFP-LC3B or GFP-LC3G120A was expressed in HEK293 cells for 24hours. Cells were then treated with 50 µM of Chloroquine (CQ) for 2 hours. Wb assays were performed using anti-GFP antibody. A549 cells infected with Adenoviral vectors expressing GFP-LC3B or GFP-LC3BG120A at 5 MOI for 24 hours. Cells were then treated with 50 µM of CQ for two hours. GFP-LC3B punctuation was recorded by fluorescence microscopy. CM, complete media, CQ, complete media plus CQ. Scale bar: 25 micron.These data are furthermore verified in non-tagged humanLC3Bexpression vectors. Transient expression of un-tagged wild-type LC3B demonstrated the expected LC3B-I (major band) and LC3B-II (minor band) species in untreated HEK293 cells (Fig. 2 B, Lane 3) and increased LCB-II band intensity following treatment with chloroquine (CQ) (lane 4). In contrast, the G120A mutant of LC3B demonstrated a major band at a similar migration point to LC3B-II (Fig. 2B, Lanes 5 and 6). As the migration patterns of LC3B-II and LC3BG120A bands are relatively indistinguishable, the increased band intensity observed in LC3BG120ACQ treatment is likely due to the endogenous increase in LC3B-II as demonstrated in the untransfected control (Figure 2B, lane 2).In consideration that LC3BG120A has the same number of amino acids as the uncleaved LC3B, we hypothesized that LC3BG120A could be cleaved or alternatively processed in vivo by an unspecified enzyme causing its faster migration. The truncated LC3BA120 represents a hypothetical G120A mutant “cleaved” at the A120 position similar to wild type LC3B cleavage at glycine 120 and serves as a control. Expression of LC3BA120 demonstrated band signal at a position similar to that of LC3B-I (Fig. 2B, Lane 7). Again, the increased signal at the point of LC3B-II migration observed in LC3BA120 CQ treatment is likely the result of endogenous increase in LC3B-II.To determine whether LC3BG120A can be lipidated and target autophagosome membrane, GFP tagged LC3Bexpression vectors were constructed. GFP-LC3B responded to treatment with CQ by demonstrating GFP-LC3B-II accumulation (Fig. 2Ca, lane 2). In contrast, the GFP-LC3BG120A mutant demonstrated a similar SDS-PAGE migration rate as GFP-LC3B-II (Fig. 2Ca, lane3). CQ treatment had no effect on GFP-LC3BG120A (Fig. 2 Ca, lane 4). As shown in Figure 2 Cb, CQ induced multiple punctae of GFP-LC3B while GFP-LC3BG120A did not respond to CQ treatment. This finding indicates that GFP tagged wild-type LC3B passes normally through the lipidation process; however, the G120A mutant form is not associated with a lipidation process marked by the absence of puncta accumulation with CQ treatment.Altogether, these data demonstrate that the G120A mutant of humanLC3B migrates at a similar rate as LC3B-II in SDS-PAGE and this phenomenon is independent of N-terminal tags. Further, the faster migration of the G120A mutant does not likely represent an unexpected lipidation process.
Analysis of Alternative Point Mutation at G120 Site and LC3B Truncates in SDS-PAGE
The unexpected humanLC3BG120ASDS-PAGE migration behavior prompted us to characterize LC3B in Wb assays. A series Flag tagged humanLC3B wild-type and mutant expressing vectors were generated. As expected, Flag-LC3B showed clear Flag-LC3B-I and Flag-LC3B-II bands (Fig. 3A, WT). A Flag-LC3BG120 vector was generated by removing the C-terminal five amino acids of humanLC3B. This recombinant protein bypasses Atg4B cleavage and undergoes expected downstream reactions with Atg7 and Atg3 as LC3B-I. Flag-LC3BG120 demonstrated two bands by Wb immunoassay (Fig. 3A, G120). The upper band corresponds to Flag-LC3BG120 (size equivalent to Flag-LC3B-I). The lower band corresponds to Flag-LC3B-II. CQ treatment increased Flag-LC3B-II level. This result demonstrates that Flag-LC3BG120 is lipidated in a normal fashion. A Flag-LC3BA120 vector was constructed by removing the last five amino acids of humanLC3B and replacing Glycine 120 with Alanine. Thus, this recombinant protein would be anticipated to not pass through the lipidation process. Flag-LC3BA120 is equal in size to Flag-LC3B-I or Flag-LC3BG120 and migrates similarly by Wb (Fig. 3A, A120). CQ treatment did not induce Flag-LC3B-II accumulation with the Flag-LC3BA120 recombinant protein. Again, Flag-LC3BG120A (Fig. 3A, G120A) migrated to a similar position as Flag-LC3B-II. As CQ had no effect on band intensity of Flag-LC3BG120A this indicates Flag-LC3BG120A does not pass through the lipidation process. Overall, these data confirmed the finding already shown in Figure 2.
Figure 3
Analysis of different group amino acid replacement of Glycine 120 of human LC3B and LC3B truncates effect on their mobility in SDS-polyacrylamide gel.
plasmids expressing Flag-LC3B, Flag-LC3BG120A, Flag-LC3BG120 or Flag-LC3A120 was expressed in HEK293 cells for 24 hours. Cells were treated with 50 µM of CQ for two hours and harvested and lysed. Total cell lysates (10 µg) was used for immunoblotting by Flag antibody. G120 point mutant plasmids were expressed in HEK293 cells for 24 hours. Immunoblotting was conducted to compare the band’s mobility with Flag-LC3B, Flag-LC3BG120A or Flag-LC3BG120A as indicated. Flag-LC3BG120D and Flag-LC3BG120E were expressed in HEK293 cells for 24 hours. Cells were then treated with 50 µM of CQ for 2 hours. Expression patters of Flag-LC3BG120D and Flag-LC3BG120E were compared with endogenous LC3B by immunoblotting with LC3B antibody (upper panels). Adenoviral vector expressing GFP-LC3B, GFP-LC3BG120D or GFP-LC3BG120E was used to infect A549 cells for 24 hours. Cells were then treated with 50 µM of CQ for 2 hours. Images were recorded using fluorescence microscopy. Scale bar: 25 micron. Truncates of LC3B (see Fig. 1) were expressed in HEK293 for 24hours. Cells were treated with 50 µM of CQ for two hours before harvesting. Total cell lysates were used for Wb assay to compare the mobility with Flag-LC3B-I and Flag-LC3B-II. Flag antibody was used to detect the recombinant proteins.
Analysis of different group amino acid replacement of Glycine 120 of human LC3B and LC3B truncates effect on their mobility in SDS-polyacrylamide gel.
plasmids expressing Flag-LC3B, Flag-LC3BG120A, Flag-LC3BG120 or Flag-LC3A120 was expressed in HEK293 cells for 24 hours. Cells were treated with 50 µM of CQ for two hours and harvested and lysed. Total cell lysates (10 µg) was used for immunoblotting by Flag antibody. G120 point mutant plasmids were expressed in HEK293 cells for 24 hours. Immunoblotting was conducted to compare the band’s mobility with Flag-LC3B, Flag-LC3BG120A or Flag-LC3BG120A as indicated. Flag-LC3BG120D and Flag-LC3BG120E were expressed in HEK293 cells for 24 hours. Cells were then treated with 50 µM of CQ for 2 hours. Expression patters of Flag-LC3BG120D and Flag-LC3BG120E were compared with endogenous LC3B by immunoblotting with LC3B antibody (upper panels). Adenoviral vector expressing GFP-LC3B, GFP-LC3BG120D or GFP-LC3BG120E was used to infect A549 cells for 24 hours. Cells were then treated with 50 µM of CQ for 2 hours. Images were recorded using fluorescence microscopy. Scale bar: 25 micron. Truncates of LC3B (see Fig. 1) were expressed in HEK293 for 24hours. Cells were treated with 50 µM of CQ for two hours before harvesting. Total cell lysates were used for Wb assay to compare the mobility with Flag-LC3B-I and Flag-LC3B-II. Flag antibody was used to detect the recombinant proteins.Utilizing a set of Flag tagged LC3B vectors, we investigated the effect of amino acid replacement at the G120 position on LC3B migration by SDS-PAGE. A series of amino acid replacements at the Glycine 120 position were constructed. Flag-LC3BG120Q, -LC3BG120N, -LC3BG120S, -LC3BG120W, and -LC3BG120R demonstrated migration rates similar to Flag-LC3BG120A (Fig. 3B). However, Flag-LC3BG120E and -LC3BG120D appeared to be cleaved and resulted in a major band similar to Flag-LC3B-I with the addition of a faster migration band between that of Flag-LC3B-I and Flag-LC3B-II. This indicates that LC3B with acidic group amino acids (D or E) at the G120 site were also likely cleaved.The characteristics of the faster moving species in Flag-LC3BG120D and Flag-LC3BG120E were analyzed. Should cleaved Flag-LC3BG120D or –LC3BG120E pass through a lipidation process, one should observe the accumulation of the faster moving species with CQ treatment. The faster migration species should target autophagosome membrane and form puncta under stimulation. As shown in Fig. 3C, there was no discernable increase in the faster migration species with either Flag-LC3BG120D or –LC3BG120E under CQ treatment; whereas, endogenous LC3B-II clearly accumulated, indicating that Flag-LC3BG120D or –LC3BG120E do not pass through downstream lipidation reactions even though it can be cleaved. This conclusion was further supported by GFP tagged LC3BG120D or LC3BG120E showing absence of puncta formation with CQ treatment compared to puncta formation in the GFP tagged wild-type LC3B control (Fig. 3 C, lower panels).A systematic series of Flag-LC3B truncates were constructed by removing C-terminal amino acids to experimentally predict a potential “cleavage site” for Flag-LC3BG120A should its faster migration actually represent an aberrant cleavage processing event. The LC3B truncates followed expected principles of denatured protein electrophoresis by SDS-PAGE and migration was mitigated by their respective sizes (Fig. 3D), i.e., the longer the truncated protein, the slower the migration. Flag-LC3BE102 with 23 amino acids removed from C-terminal of LC3B demonstrated a similar migration rate to that of Flag-LC3BG120A.Altogether, these results demonstrate that in general alteration of the amino acid residue at G120 changed the migration of LC3B in SDS-PAGE and should this alteration induce an unexpected alternate protein cleavage it approximates around the site of E102 of humanLC3B.
Sequencing of Flag-LC3BG120A Reveals it to be a Full Length Protein without Cleavage
To determine whether Flag-LC3BG120A is cleaved in vivo, we purified Flag-LC3BG120A recombinant protein from HEK293 cells by Flag antibody-based affinity purification. Flag-LC3BG120A was purified to a high degree as demonstrated by SDS-PAGE (Figure 4A, arrows). Elutions 2 and 3 were combined, concentrated and subsequently analyzed by top-down protein sequencing utilizing MALDI ISD mass spectrometry of intact proteins. MALDI ISD can confirm the amino acid sequence of 20–70 residues from both the N-terminal and the C-terminal ends of a purified protein [12]. The results of the Mascot software MS/MS ion search for the ISD spectrum of Flag-LC3BG120A are shown in Fig. 4B–G. Sequencing of Flag-LC3BG120A demonstrates that the faster migration band observed by Wb assay is indeed the full-length protein without cleavage.
Figure 4
Sequence analysis of Flag-LC3BG120A by MALDI ISD.
Flag-LC3BG120A expression vector was transfected into HEK293 cell for 48 hours. Cells were harvested and lysed with protease inhibitor cocktail. The lysates were centrifuged at 10,000 g for 30 min. Supernatants were then used for affinity purification of Flag-LC3BG120A by Flag antibody conjugated beads in column according to the proposed protocol. 20 µl of elution (from total 1 ml) from Flag antibody based affinity column was loaded onto 12.5% of SDS-polyacrylamide gel. Gel was stained with PageBlue Protein Staining Solution. Elution number 2 and 3 were combined and concentrated. Purified Flag-LC3BG120A was used to run MALDI ISD. Intact mass spectra are shown in and in-source decay spectra are shown in . For database searching selected ISD fragments (* in the spectra) were used as virtual precursors and submitted to the Mascot search engine MS/MS ion search program (Matrix Science, Ltd. Version 2.3) through the Shimadzu Biotech Launchpad software. peptide view of Mascot Search results MS/MS Fragmentation of N-terminal: MDYKDHDGDYKDHDIDYKDDDDKLQVDPSEKTFKQRRTFEQRVED (Found in IPI00953817; Data file: Automatically uploaded data; Average mass of neutral peptide Mr(calc): 5622.8801; Ions Score: 168 Expect: 2.1e-012; Matches : 28/88 fragment ions using 47 most intense peaks.). peptide view of Mascot Search results: MS/MS Fragmentation of C-terminal: LLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFAMKLSV(Found in IPI00953817; Data file Automatically uploaded data; Average mass of neutral peptide Mr(calc): 5017.6143; Ions Score: 34 Expect: 53;Matches : 30/88 fragment ions using 134 most intense peaks.). Theoretical fragment ions for the peptide sequence. The matched fragment ions are highlighted in red typed. Protein view: Match to: IPI00953817 Score: 297. Found in search of Automatically uploaded data. Nominal mass (Mr): 17870; Calculated pI value: 5.38. NCBI BLAST search of IPI00953817 against nr Unformatted sequence string for pasting into other applications. Sequence Coverage: 59%. Matched peptides shown in Bold Red. The N-terminal 3xFlag tag and C-terminal last five amino acids of Flag-LC3BG120A are underlined. The downward pointing arrow shows the LC3B start amino acid in the recombinant protein (first amino acid methionine was removed in the fusion protein). The arrow pointing upward shows the G120A point mutation in the Flag-LC3BG120A.
Sequence analysis of Flag-LC3BG120A by MALDI ISD.
Flag-LC3BG120Aexpression vector was transfected into HEK293 cell for 48 hours. Cells were harvested and lysed with protease inhibitor cocktail. The lysates were centrifuged at 10,000 g for 30 min. Supernatants were then used for affinity purification of Flag-LC3BG120A by Flag antibody conjugated beads in column according to the proposed protocol. 20 µl of elution (from total 1 ml) from Flag antibody based affinity column was loaded onto 12.5% of SDS-polyacrylamide gel. Gel was stained with PageBlue Protein Staining Solution. Elution number 2 and 3 were combined and concentrated. Purified Flag-LC3BG120A was used to run MALDI ISD. Intact mass spectra are shown in and in-source decay spectra are shown in . For database searching selected ISD fragments (* in the spectra) were used as virtual precursors and submitted to the Mascot search engine MS/MS ion search program (Matrix Science, Ltd. Version 2.3) through the Shimadzu Biotech Launchpad software. peptide view of Mascot Search results MS/MS Fragmentation of N-terminal: MDYKDHDGDYKDHDIDYKDDDDKLQVDPSEKTFKQRRTFEQRVED (Found in IPI00953817; Data file: Automatically uploaded data; Average mass of neutral peptide Mr(calc): 5622.8801; Ions Score: 168 Expect: 2.1e-012; Matches : 28/88 fragment ions using 47 most intense peaks.). peptide view of Mascot Search results: MS/MS Fragmentation of C-terminal: LLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFAMKLSV(Found in IPI00953817; Data file Automatically uploaded data; Average mass of neutral peptide Mr(calc): 5017.6143; Ions Score: 34 Expect: 53;Matches : 30/88 fragment ions using 134 most intense peaks.). Theoretical fragment ions for the peptide sequence. The matched fragment ions are highlighted in red typed. Protein view: Match to: IPI00953817 Score: 297. Found in search of Automatically uploaded data. Nominal mass (Mr): 17870; Calculated pI value: 5.38. NCBI BLAST search of IPI00953817 against nr Unformatted sequence string for pasting into other applications. Sequence Coverage: 59%. Matched peptides shown in Bold Red. The N-terminal 3xFlag tag and C-terminal last five amino acids of Flag-LC3BG120A are underlined. The downward pointing arrow shows the LC3B start amino acid in the recombinant protein (first amino acid methionine was removed in the fusion protein). The arrow pointing upward shows the G120A point mutation in the Flag-LC3BG120A.
Human Pro-LC3B Migrates to a Similar Position as LC3BG120A and LC3B-II by SDS-PAGE
The unexpected results thus far challenged our earlier hypothesis. To revise, we considered that should the LC3BG120A band by Wb represent an unprocessed/uncleaved form of the protein, we expect that unprocessed humanLC3B should have the same migration rate as LC3BG120A as the only difference between these two forms of LC3B is the replacement of Glycine 120 by an alanine. As already demonstrated in this study, Flag-LC3BG120 migrates to the same position as Flag-LC3BA120 (Fig. 3A), in which Glycine 120 was replaced by an alanine. To validate our hypothesis, we sub-cloned Flag-LC3B, Flag-LC3BG120A, and Flag-LC3BA120 into pTriEX1.1 expression plasmid. This plasmid is equipped with promoters which can drive gene expression in both E.coli and mammalian cells. Flag-LC3B should not be cleaved when expressed in E.coli cell due to the absence of Atg4s in a bacterial cell. We expressed Flag-LC3B series recombinants in both HEK293 cell and E.coli. As shown in Figure 5A, Flag-LC3B demonstrates two bands in the HEK293 cells, which corresponds to Flag-LC3B-I and Flag-LC3B-II. Flag-LC3B expressed in E.coli migrated to be the same position as Flag-LC3B-II (Figure 5, WT/Tuner). Flag-LC3BG120A migrated similarly as Flag-LC3B-II or unprocessed Flag-LC3B regardless of its expression in the HEK293 or E.coli (Fig. 5A, G120A). Flag-LC3BA120 expressed as same size bands in HK293 and E.coli cells as Flag-LC3B-I, verifying that Flag-LC3BA120 is not modified, which is consistent with the results already shown in this study.
Figure 5
Pro-human LC3B migrates at similar rate as G120A mutant and lipidated form in SDS-polyacrylamide gel.
pTriEX.1.1 plasmids encoding Flag-LC3B, Flag-LC3BG120A, or Flag-LC3BA120 was expressed in HEK293 or E.coli cells (Tuner cell), respectively. Recombinant protein expression in E.coli cells were induced with 1 mM of IPTG for four hours before harvesting. 10 µg of HEK293 or E.coli lysates were loaded onto SDS-polyacrylamide gel. Immunoblotting was conducted using Flag-antibody. 10 µg of E.coli lysates with Flag-LC3B or Flag-LC3BG120A recombinant proteins was digested with recombinant Atg4B at 37°C for indicated time and analyzed by immunoblotting with LC3B antibody and Atg4B antibody as indicated.
Pro-human LC3B migrates at similar rate as G120A mutant and lipidated form in SDS-polyacrylamide gel.
pTriEX.1.1 plasmids encoding Flag-LC3B, Flag-LC3BG120A, or Flag-LC3BA120 was expressed in HEK293 or E.coli cells (Tuner cell), respectively. Recombinant protein expression in E.coli cells were induced with 1 mM of IPTG for four hours before harvesting. 10 µg of HEK293 or E.coli lysates were loaded onto SDS-polyacrylamide gel. Immunoblotting was conducted using Flag-antibody. 10 µg of E.coli lysates with Flag-LC3B or Flag-LC3BG120A recombinant proteins was digested with recombinant Atg4B at 37°C for indicated time and analyzed by immunoblotting with LC3B antibody and Atg4B antibody as indicated.As expected, these results reveal that human pro-LC3B is the same “size” as LC3BG120A. Of particular interest, the unprocessed humanLC3B migrates at similar rate as LC3B-II by SDS-PAGE. Thus, the C-terminal five amino acids in humanLC3B may affect the migration rate of LC3B rendering its faster movement than the smaller cleaved LC3B-I by SDS-PAGE.To confirm the relative maintenance of function of the recombinant protein as expressed in a bacterial model, we incubated Flag-LC3B and Flag-LC3BG120A bacterially expressed recombinants with recombinant Atg4B protein at 37°C for intervals as indicated in Figure 5B. Wb assay demonstrated the cleavage of Flag-LC3B by Atg4B as it gave rise to two distinct bands. The slower migrating band was actually the cleaved Flag-LC3B (Flag-LC3B-I) band and the faster migrating band was unprocessed Flag-LC3B. As a control, Flag-LC3BG120A was not cleaved by Atg4B consistent with the data already shown in this study.
The Last Five Amino Acids Determine Faster Migration of Human LC3B by SDS-PAGE
LC3B of human, mouse and rat origin have five amino acid residues after the Glycine at the 120 position. Investigation as to whether these five amino acids play a key role in pro-humanLC3B migration behavior by SDS-PAGE was a subsequent experimental aim. Each individual amino acid after Glycine120 was replaced with Alanine to dissect the effect each amino acid residue had on Flag-LC3B migration. Expression of these mutant recombinant proteins in bacteria was analyzed by SDS-PAGE. Among the last five amino acids, Lysine122 and Leucine123 had the most significant effect on Flag-LC3B migration (Fig. 6A). K122A resulted in the slowest migration of Flag-LC3B followed by the L123A mutant and likely, therefore contribute the most to accelerated migration. M121A, S124A and V125A demonstrated less effect on Flag-LC3B migration. Exchange of all five amino acid residues to Alanine resulted in the slowest migration of Flag-LC3B (Fig. 6A, A5). This data supports the idea that all five amino acids likely contribute the faster migration behavior of Flag-LC3B. Of interest, the A5 mutant demonstrate a similar migration rate (Fig. 6A, A120) but not necessarily slower than Flag-LC3B-I. Such data suggests that the additional last five amino acids do not render unprocessed humanLC3B to migrate slower than Flag-LC3B-I.
Figure 6
Last five amino acids determine human LC3B faster migration in SDS-PAGE.
Flag-LC3B and indicated mutants were expressed in E.coli. 10 µg of cell lysates were then separated in 15% of SDS-polyacrylamide gel. Transferred membrane was stained with Ponceau S before immunoblotting with LC3B antibody. human LC3B and indicated mutants were expressed in HEK293 cells for 24 hours. Cells were then treated with 50 µM of CQ for 2 hours. Expression patters were analyzed by Wb using LC3B antibody. Same sets of expression plasmids were then expressed in E.coli cells. 10 µg of cell lysates were then separated in 15% of SDS-polyacrylamide gel. Transferred membrane was stained with Ponceau S before immunoblotting with LC3B antibody. Arrows point to wild-type and mutant LC3B recombinant protein band expressed in E. coli.
Last five amino acids determine human LC3B faster migration in SDS-PAGE.
Flag-LC3B and indicated mutants were expressed in E.coli. 10 µg of cell lysates were then separated in 15% of SDS-polyacrylamide gel. Transferred membrane was stained with Ponceau S before immunoblotting with LC3B antibody. humanLC3B and indicated mutants were expressed in HEK293 cells for 24 hours. Cells were then treated with 50 µM of CQ for 2 hours. Expression patters were analyzed by Wb using LC3B antibody. Same sets of expression plasmids were then expressed in E.coli cells. 10 µg of cell lysates were then separated in 15% of SDS-polyacrylamide gel. Transferred membrane was stained with Ponceau S before immunoblotting with LC3B antibody. Arrows point to wild-type and mutant LC3B recombinant protein band expressed in E. coli.To exclude the possibility that the N-terminal tag influenced the previous findings, the K122A and A5 mutant were analyzed in the context of non-tagged humanLC3B. Expression patterns of humanLC3B, LC3BG120A and LC3BA120 in HEK293 as previously illustrated in Figure 2C are used as band size references for LC3BG120, LC3BK122A and LC3BA5 (Fig. 6B). LC3BG120, LC3BK122A and LC3BA5 demonstrated similar band patterns and represent LC3B-I and LC3B-II as seen with wild-type LC3B (Fig. 6B, LC3B). All recombinant proteins showed an accumulation response following treatment with CQ. As such, these data demonstrate the amino acid residue exchange in K122A and A5 mutants do not affect its cleavage by Atg4B nor prevent normal passage through the lipdiation process.These non-tagged LC3B were then expressed in E.coli cells to compare their size of unprocessed forms in SDS-PAGE gel. LC3BG120A had the same size as wild-type LC3B (Fig. 6C, upper panel, G120A and WT). K122A mutant moved significant slower than pro-LC3B (wild-type) and A5 mutant migrated even more slowly with size similar to LC3B-I (Fig. 6C, upper panel, K122A and A5). Those LC3B expressed in E.coli cells were verified by immunoblotting with LC3B antibody (Fig. 6C, lower panel).Altogether, these data demonstrate that the last five amino acids determine the accelerated migration rate of unprocessed humanLC3B with Lysine 122 being a major contributing factor.
Pro-mouse LC3B, -rat LC3B and -rat LC3 Migrate Faster than their Cleaved form by SDS-PAGE
Has been demonstrated pro-humanLC3B faster migration in SDS-PAGE, we further investigated whether the faster migration is conserved in murine and ratLC3B. We used G120A mutant to present uncleaved/pro-LC3B of rodent species in SDS-PAGE. MurineLC3B differs by only one amino acid from RatLC3B as illustrated in Figure 7 (M123 versus L123), both share high amino acid sequence identity with humanLC3B. Expression plasmids encoding ratLC3B, rat LC3BA120 and ratLC3BG120A mutants, mouseLC3B and mouseLC3BG120A mutant were constructed. As rat LC3BA120 and mouse LC3BA120 have the exact same amino acid sequence, rat LC3BA120 was used as a reference for both ratLC3B-I and mouseLC3B-I. Following expression of wild-type and mutant forms of human, mouse and ratLC3B in HEK293 cells, the cell lysates were separated by 15% of SDS-PAGE and probed using LC3B antibody. HumanLC3B-I was found to migrate slower than both rat and mouseLC3B-I (Fig. 8A). MouseLC3B-I and ratLC3B-I demonstrate equivocal band position by Wb which is consistent to their similar C-terminal amino acid sequence. RatLC3BG120A represents an uncleaved ratLC3B in size and demonstrated slightly more rapid migration than that of mouseLC3BG120A (equal to pro-mouseLC3B in size). Again, this data supports the previous finding in humanLC3B that L123 as found in Rat pro-LC3B contributes accelerated migration.
Figure 7
Sequence comparison of LC3 family member from human, mouse and rat origins.
Pairwise alignments of LC3A, LC3B and LC3C of human and rodent origin are generated by ClustalW2. The glycine conjugation sites are boxed and C-terminal amino acids after glycine conjugation site are underlined. A “*” presents identity of amino acids; “:” presents these amino acids in a same amino acid group (similarity); “⋅” presents different group of amino acids.
Figure 8
The faster migration is conserved in pro-LC3B of rodent species but not in human LC3C.
Compare pro-human LC3B with pro-mouse LC3B, pro-rat LC3B and their cleaved and lipidated forms’ band patterns by 15% of SDS-polyacrylamide gel. Indicated expression plasmids were expressed in HEK293 cells. compare pro-rat LC3B with pro-rat LC3 and cleaved forms by 15% of SDS-polyacrylamide gel. Correspondent expression plasmids were expressed in HEK293 cells. Note: human LC3B-I band is close to RatLC3B-I/RatLC3-I as indicated by arrows. pro-LC3A and its cleaved form comparison by 15% of SDS-polyacrylamide gel. Indicated expression plasmids were expressed in HEK293 cells. compare pro-human LC3B and LC3C species by 15% of SDS-polyacrylamide gel. Indicated expression plasmids were expressed in HEK293 cells for 24 h. HEK293 cells transient expressing Human LC3C were treated with 50 µM of CQ for 2 h to induce accumulation of human LC3B-II and LC3C-II. Total cell lysates were separated by a 15% of SDS-polyacrylamide gel. Protein transferred membrane was cut between human LC3B group and human LC3C group and immunoblotting by LC3B and LC3C antibody, respectively. The immunoblotting membrane was re-aligned before developing with chemiluminescent substrate in order to compare human LC3B species and human LC3C species in Wb.
Sequence comparison of LC3 family member from human, mouse and rat origins.
Pairwise alignments of LC3A, LC3B and LC3C of human and rodent origin are generated by ClustalW2. The glycine conjugation sites are boxed and C-terminal amino acids after glycine conjugation site are underlined. A “*” presents identity of amino acids; “:” presents these amino acids in a same amino acid group (similarity); “⋅” presents different group of amino acids.
The faster migration is conserved in pro-LC3B of rodent species but not in human LC3C.
Compare pro-humanLC3B with pro-mouseLC3B, pro-ratLC3B and their cleaved and lipidated forms’ band patterns by 15% of SDS-polyacrylamide gel. Indicated expression plasmids were expressed in HEK293 cells. compare pro-ratLC3B with pro-ratLC3 and cleaved forms by 15% of SDS-polyacrylamide gel. Correspondent expression plasmids were expressed in HEK293 cells. Note: humanLC3B-I band is close to RatLC3B-I/RatLC3-I as indicated by arrows. pro-LC3A and its cleaved form comparison by 15% of SDS-polyacrylamide gel. Indicated expression plasmids were expressed in HEK293 cells. compare pro-humanLC3B and LC3C species by 15% of SDS-polyacrylamide gel. Indicated expression plasmids were expressed in HEK293 cells for 24 h. HEK293 cells transient expressing HumanLC3C were treated with 50 µM of CQ for 2 h to induce accumulation of humanLC3B-II and LC3C-II. Total cell lysates were separated by a 15% of SDS-polyacrylamide gel. Protein transferred membrane was cut between humanLC3B group and humanLC3C group and immunoblotting by LC3B and LC3C antibody, respectively. The immunoblotting membrane was re-aligned before developing with chemiluminescent substrate in order to compare humanLC3B species and humanLC3C species in Wb.RatLC3 is an isoform of RatLC3B with 22 amino acids long tail after G120 (Fig. 7). RatLC3 has been widely used in GFP or RFP fusion expression vectors to monitor autophagy process [13]. As shown in Fig. 8 B, wild-type ratLC3 showed two bands in SDS-PAGE, slower migration band presents cleaved form ratLC3(ratLC3-I), which has equal size with rat LC3BA120 (equal to ratLC3B-I in size). Both rat LC3BA120 and ratLC3-I migrates slower than human LCB-I, consistent to the finding presented in the Figure 8A. RatLC3BG120A (equal to pro-RatLC3B in size) migrated faster than rat LC3BA120 (equal to ratLC3B-I in size). Of note, ratLC3G120A with 22 amino acids long tail and equal to pro-ratLC3 in size migrated faster than cleaved ratLC3-I/ratLC3B-I (Fig. 8.B).Altogether, pro-mouseLC3B,-ratLC3B and –ratLC3 migrate faster than their cleaved forms. The faster migration is conversed in LC3B subfamily. However, compared to pro-humanLC3B, pro-LC3B of rodent species migrate much slower than LC3B-II.
Pro-LC3A has Same Migration Rate as LC3A-I by SDS-PAGE
Human, mouse and ratLC3A share same amino acid sequence. LC3A has a Phenylalanine (F) after G120 (Fig. 7). We compared murineLC3A (variant 1), LC3AA120 and LC3AG120A (equal to pro-LC3A in size) recombinants with humanLC3B expressed in HEK293 cells. As shown in Fig. 8.C, LC3A specific antibody detects only LC3A species (upper panels), while LC3B antibody recognizes LC3B and LC3A (middle panels). Transient expressed wild-type LC3A responded well to CQ treatment demonstrated by increase in LC3A-II band intensity. LC3AA120 (representing LC3A-I) and LC3AG102A (representing pro-LC3A) showed band size equal to LC3A-I and LC3B-I. This result demonstrates that human, mouse and rat pro-LC3A migrates at same rate as LC3A-I; LC3A-I demonstrated same size to humanLC3B-I by SDS-PAGE; and LC3A-II has no difference from LC3B-II in size by SDS-PAGE.
Faster Migration Character is Not Conserved in Pro-human LC3C
HumanLC3C shares less sequence similarity with LC3A (identity: 71/147; similarity: 90/147) and LC3B (identity: 67/147; similarity: 88/147). It has 21 amino acids long tail after glycine conjugation site (G126) (Fig. 7). No rodent version of LC3C was identified. To analyze whether the faster migration is preserved in pro-humanLC3C, we transiently expressed wild-type humanLC3C, LC3CA126 and LC3CG126A mutants in HEK293 cells. We compared humanLC3B species and LC3C species migration patterns in one 15% of SDS-polyacrylamide gel by immunoblotting with LC3B and LC3C specific antibodies. LC3C-I migrated dramatic faster than humanLC3B-I and closed to LC3C-II (Fig. 8D). Of interest, LC3CG126A mutant (Glycine 126 replaced by Alanine and equal in size to pro-LC3C) migrated much slower than LC3B-I and LC3C-I. This result demonstrates that LC3C species (pro-LC3C, LC3C-I and LC3C-II) have a unique migration patterns in SDS- polyacrylamide gel: LC3C-I migrates faster than all other LC3-I form in LC3 family and is close to LC3C-II. In contrast, pro-LC3C demonstrated the slowest migration specie in LC3 family. PE conjugation of LC3C does not render its significant faster migration than LC3C-I as found in other LC3 family members. It should be noted that LC3C-I and LC3C-II migrate too close to separate even by 15% of SDS- polyacrylamide gel. Thus, LC3C-I to LC3C-II conversion assay may not be an ideal marker for quantity assay in autophagy study. Of note, conjugation with PE renders LC3A-II, LC3B-II and LC3C-II a similar migration rate in SDS-PAGE independent on their primary amino acid sequences (Fig. 8A, B, C and D).
Effect of Atg4B Expression Level on Pro-LC3B Cleavage in vivo
Pro-LC3B is efficiently cleaved by Atg4B following translation. To examine the possibility that Atg4B may not fully process over-expressed LC3B, we utilized an Atg7 knockout MEF cell model. Without the ability to form LC3-Atg7 intermediates within MEFatg7KO cells, the LC3B lipidation process is terminated at the LC3B-I stage. As expected, no LC3B-II was detected in MEFatg7KO cell when compared to wild-type MEF cell (Figure 9A). Unprocessed/uncleaved GFP-LC3B was clearly visible at the expected GFP-LC3B-II band location in MEFatg7KO cells following transduction with an adenoviral human GFP-LC3B vector (Figure 9B; D1 to D4). Despite the increase in unprocessed GFP-LC3B in MEFatg7KO cells there was no discernable GFP-LC3B punctation when compared to GFP-LC3B punctuation in wild-type MEF cells (Figure 9C), demonstrating unprocessed GFP-LC3B migrates similar as GFP-LC3B-II and distributes in the cytosol.
Figure 9
Effect of Atg4B on LC3B processing.
MEFwt and MEFatg7KO cells were treated with 50 µM of CQ for 2 hours. LC3B expression patterns were then analyzed in 15% of SDS-PAGE by immunoblotting with LC3B antibody. Adenoviral vector expressing GFP-LC3B was used to infect MEFatg7KO cells in series double diluted doses for 24 hours (D1 = 20MOI). Ad-GFP-LC3B (20MOI) infected wild-type MEF cells were used as control or treated with 50 µM of CQ for 2 hours.GFP-LC3B expression patterns were analyzed by 15% of SDS-PAGE. Ad-GFP-LC3B infected MEFwt and MEFatg7KO cells were treated with 50 µM of CQ for 2 hours and images were recorded by fluorescence microscopy. HEK293 cells were transfected with Atg4B siRNA and Control siRNA for 48 h. 15 µg of total cell lysates were analyzed by immunoblotting with Atg4B, LC3B, and β-actin antibodies. Image J software was used to quantify band density using β-actin as loading control. Diagram of LC3 species migration patterns in 15% of SDS-polyacrylamide gel. The diagram summarizes LC3 species (pro-LC3, LC3-I and LC3-II) band patterns from human, mouse and rat origins. Refer to the result section for description in details.
Effect of Atg4B on LC3B processing.
MEFwt and MEFatg7KO cells were treated with 50 µM of CQ for 2 hours. LC3Bexpression patterns were then analyzed in 15% of SDS-PAGE by immunoblotting with LC3B antibody. Adenoviral vector expressing GFP-LC3B was used to infect MEFatg7KO cells in series double diluted doses for 24 hours (D1 = 20MOI). Ad-GFP-LC3B (20MOI) infected wild-type MEF cells were used as control or treated with 50 µM of CQ for 2 hours.GFP-LC3Bexpression patterns were analyzed by 15% of SDS-PAGE. Ad-GFP-LC3B infected MEFwt and MEFatg7KO cells were treated with 50 µM of CQ for 2 hours and images were recorded by fluorescence microscopy. HEK293 cells were transfected with Atg4B siRNA and Control siRNA for 48 h. 15 µg of total cell lysates were analyzed by immunoblotting with Atg4B, LC3B, and β-actin antibodies. Image J software was used to quantify band density using β-actin as loading control. Diagram of LC3 species migration patterns in 15% of SDS-polyacrylamide gel. The diagram summarizes LC3 species (pro-LC3, LC3-I and LC3-II) band patterns from human, mouse and rat origins. Refer to the result section for description in details.Reversely, low Atg4B level may negatively affect pro-LC3processing. HEK293 cells were transfected with Atg4B siRNA to knockdown Atg4B. As shown in Fig. 9D, Atg4B was reduced by 55% at 48 hours post transfection which resulted in 45% decrease in LC3-I and 540% increase in “LC3-II”. These increased “LC3-II” are from unprocessed LC3B.Taken as a whole, these data demonstrate that unprocessed LC3B can be detected in certain conditions such as over-expression of LC3B and lower level expression of Atg4B. These findings are particularly important for Atg4 inhibitor assays in which blocking Atg4 activity should lead to accumulation of pro-LC3B.
Discussion
In this study, we demonstrated that unprocessed humanLC3B migrates at a similar rate as LC3B-II in SDS- polyacrylamide gel. The faster migration behaviors were conserved in pro-mouse and pro-ratLC3B although they do not shift to LC3B-II location as found in humanLC3B. Dramatically, even with 22 amino acids long C-terminus after Glycine 120 (about 18.3% longer than ratLC3-I, Fig. 7), pro-ratLC3 migrates faster than ratLC3-I. These findings experimentally clarify the pro-LC3B band location in SDS-PAGE.In general, protein size is linearly proportional to its number of amino acids once protein binds SDS and run in SDS-polyacrylamide gel [14]. There are exceptions of this rule such as membrane bound protein with alpha helix structures shows gel shift in Wb assay [15]. However, no secondary structure was found in the C-terminus after G120 of LC3B proteins. Thus, it is logical to presume that pro-LC3B should migrate slower than LC3B-I because of five more amino acids at C-terminus. However, this was proven wrong by detailed analysis of humanLC3B in molecular level by SDS-PAGE. Our findings, for the first time, demonstrate that the last five amino acids in humanLC3B, particularly Lysine and Leucine residues, change the pro-LC3B migration behavior leading to its faster migration than LC3B-I in SDS-PAGE. The significance of the last five amino acids renders human pro-LC3B indistinguishable from LC3B-II in Wb.Four humanLC3 genes (LC3A, LC3B, LC3B2 and LC3C) have been identified. No LC3B2 and LC3C were found in rodent species. LC3B2 has only one amino acid different from LC3B (Y113 versus C113), and has very limited tissue distribution [16]. LC3A has two variants. LC3A variant 1 seems to be widely expressed among tissues compared to variant 2 [7], [16]. Interestingly, LC3A variant 1 was found frequently inactivated in humancancers by aberrant DNA methylation and associated with carcinogenesis. LC3C is transcribed at lower levels with limited tissue distribution [7], [16]. LC3C was found to selectively bind NDP52 and was required for antibacterial autophagy [17]. There is no detailed quantity information on LC3A, B and C expression in a particular type of cells. The ratio among LC3A, B and C, if they are co-expressed in a cell, is unclear. Of note, we find that LC3B is well response to chloroquine treatment in several cancer cell lines (A549, HCT116 and TPC-1) where LC3A and LC3C are lack of significant increase in LC3A-II or LC3C-II level (unpublished data), indicating LC3 family members may differentially involve in autophagy-related processes.As we demonstrated in this study, Atg4B level can affect pro-LC3B level. Cells from variant tissue origins may have different levels of Atg4Bexpression and Atg4B activity may be affected by other factors [18]–[22]. Unprocessed humanLC3B level could affect the LC3B-II analysis in certain human cells and tissues in certain conditions. Under such conditions, the LC3-II level may not truly reflect LC3B-II specie, i.e., the LC3-II observed by Wb assay could be partly from the unprocessed LC3B. In this situation, subcellular fractionation is recommended for humanLC3B-II assays.A number of research groups are working on searching for Atg4 inhibitors. Assays for evaluation of Atg4 activities in vivo and in vitro were developed based on C-terminal tags of LC3B including LC3B-GFP [23], LC3B-phosphlipaseA [24], FRET based CFP and YFP tagged LC3B [25], LC3B-luciferase [26]. These assays were developed for informative indicator for autophagy process or for searching for Atg4 inhibitors. It is interesting to note that none of these Atg4 inhibition assays are based on analyzing pro-LC3 level. One reason is likely due to unknown band patters for pro- LC3 in Wb. It would be particularly confused by looking at pro-humanLC3B band in these studies, where pro-LC3B is localized at the LC3B-II site in Wb. Our finding could apply for these situations, for instance, a recent report on Atg4B knockout mouse’s LC3 Wb assay where close two bands apparently representing murineLC3-I in tissues from Atg4B knockout mice may actually represent mouseLC3B-I and unprocessed LC3B, respectively [27].In conclusion, we find that the C-terminal amino acids after glycine conjugation sites determine pro-LC3B’s migration behaviors in SDS-PAGE. Figure 8E summarizes LC3A, LC3B and LC3C species band patters in 15% of SDS-PAGE for human, mouse and rat origins. For humanLC3B, pro-LC3B is indistinguishable from LC3B-II; pro-humanLC3A migrates to the same site as LC3A-I; pro-ratLC3B migrates faster >pro-mouseLC3B>pro-ratLC3> ratLC3-I/ratLC3B-I/mouseLC3B-I; mouse and ratLC3B-I migrate a little faster than humanLC3-I; HumanLC3C-I migrates faster>humanLC3B-I and humanLC3A-I >pro-humanLC3C; LC3A-II and LC3B-II migrate at similar rate as LC3C-II. Overall, the data presented provide a guide for cell-based or animal model Atg4 knock out/knock down and Atg4 inhibitor assays as it relates to the measurement of pro-LC3, LC3-I and LC3-II by immunoblot analysis.
Authors: Y Kabeya; N Mizushima; T Ueno; A Yamamoto; T Kirisako; T Noda; E Kominami; Y Ohsumi; T Yoshimori Journal: EMBO J Date: 2000-11-01 Impact factor: 11.598
Authors: Guillermo Mariño; José A Uría; Xose S Puente; Víctor Quesada; Javier Bordallo; Carlos López-Otín Journal: J Biol Chem Date: 2002-11-21 Impact factor: 5.157
Authors: Susanne G van der Grein; Kyra A Y Defourny; Huib H Rabouw; Soenita S Goerdayal; Martijn J C van Herwijnen; Richard W Wubbolts; Maarten Altelaar; Frank J M van Kuppeveld; Esther N M Nolte-'t Hoen Journal: Nat Commun Date: 2022-06-24 Impact factor: 17.694
Authors: Daniel J Klionsky; Amal Kamal Abdel-Aziz; Sara Abdelfatah; Mahmoud Abdellatif; Asghar Abdoli; Steffen Abel; Hagai Abeliovich; Marie H Abildgaard; Yakubu Princely Abudu; Abraham Acevedo-Arozena; Iannis E Adamopoulos; Khosrow Adeli; Timon E Adolph; Annagrazia Adornetto; Elma Aflaki; Galila Agam; Anupam Agarwal; Bharat B Aggarwal; Maria Agnello; Patrizia Agostinis; Javed N Agrewala; Alexander Agrotis; Patricia V Aguilar; S Tariq Ahmad; Zubair M Ahmed; Ulises Ahumada-Castro; Sonja Aits; Shu Aizawa; Yunus Akkoc; Tonia Akoumianaki; Hafize Aysin Akpinar; Ahmed M Al-Abd; Lina Al-Akra; Abeer Al-Gharaibeh; Moulay A Alaoui-Jamali; Simon Alberti; Elísabet Alcocer-Gómez; Cristiano Alessandri; Muhammad Ali; M Abdul Alim Al-Bari; Saeb Aliwaini; Javad Alizadeh; Eugènia Almacellas; Alexandru Almasan; Alicia Alonso; Guillermo D Alonso; Nihal Altan-Bonnet; Dario C Altieri; Élida M C Álvarez; Sara Alves; Cristine Alves da Costa; Mazen M Alzaharna; Marialaura Amadio; Consuelo Amantini; Cristina Amaral; Susanna Ambrosio; Amal O Amer; Veena Ammanathan; Zhenyi An; Stig U Andersen; Shaida A Andrabi; Magaiver Andrade-Silva; Allen M Andres; Sabrina Angelini; David Ann; Uche C Anozie; Mohammad Y Ansari; Pedro Antas; Adam Antebi; Zuriñe Antón; Tahira Anwar; Lionel Apetoh; Nadezda Apostolova; Toshiyuki Araki; Yasuhiro Araki; Kohei Arasaki; Wagner L Araújo; Jun Araya; Catherine Arden; Maria-Angeles Arévalo; Sandro Arguelles; Esperanza Arias; Jyothi Arikkath; Hirokazu Arimoto; Aileen R Ariosa; Darius Armstrong-James; Laetitia Arnauné-Pelloquin; Angeles Aroca; Daniela S Arroyo; Ivica Arsov; Rubén Artero; Dalia Maria Lucia Asaro; Michael Aschner; Milad Ashrafizadeh; Osnat Ashur-Fabian; Atanas G Atanasov; Alicia K Au; Patrick Auberger; Holger W Auner; Laure Aurelian; Riccardo Autelli; Laura Avagliano; Yenniffer Ávalos; Sanja Aveic; Célia Alexandra Aveleira; Tamar Avin-Wittenberg; Yucel Aydin; Scott Ayton; Srinivas Ayyadevara; Maria Azzopardi; Misuzu Baba; Jonathan M Backer; Steven K Backues; Dong-Hun Bae; Ok-Nam Bae; Soo Han Bae; Eric H Baehrecke; Ahruem Baek; Seung-Hoon Baek; Sung Hee Baek; Giacinto Bagetta; Agnieszka Bagniewska-Zadworna; Hua Bai; Jie Bai; Xiyuan Bai; Yidong Bai; Nandadulal Bairagi; Shounak Baksi; Teresa Balbi; Cosima T Baldari; Walter Balduini; Andrea Ballabio; Maria Ballester; Salma Balazadeh; Rena Balzan; Rina Bandopadhyay; Sreeparna Banerjee; Sulagna Banerjee; Ágnes Bánréti; Yan Bao; Mauricio S Baptista; Alessandra Baracca; Cristiana Barbati; Ariadna Bargiela; Daniela Barilà; Peter G Barlow; Sami J Barmada; Esther Barreiro; George E Barreto; Jiri Bartek; Bonnie Bartel; Alberto Bartolome; Gaurav R Barve; Suresh H Basagoudanavar; Diane C Bassham; Robert C Bast; Alakananda Basu; Henri Batoko; Isabella Batten; Etienne E Baulieu; Bradley L Baumgarner; Jagadeesh Bayry; Rupert Beale; Isabelle Beau; Florian Beaumatin; Luiz R G Bechara; George R Beck; Michael F Beers; Jakob Begun; Christian Behrends; Georg M N Behrens; Roberto Bei; Eloy Bejarano; Shai Bel; Christian Behl; Amine Belaid; Naïma Belgareh-Touzé; Cristina Bellarosa; Francesca Belleudi; Melissa Belló Pérez; Raquel Bello-Morales; Jackeline Soares de Oliveira Beltran; Sebastián Beltran; Doris Mangiaracina Benbrook; Mykolas Bendorius; Bruno A Benitez; Irene Benito-Cuesta; Julien Bensalem; Martin W Berchtold; Sabina Berezowska; Daniele Bergamaschi; Matteo Bergami; Andreas Bergmann; Laura Berliocchi; Clarisse Berlioz-Torrent; Amélie Bernard; Lionel Berthoux; Cagri G Besirli; Sebastien Besteiro; Virginie M Betin; Rudi Beyaert; Jelena S Bezbradica; Kiran Bhaskar; Ingrid Bhatia-Kissova; Resham Bhattacharya; Sujoy Bhattacharya; Shalmoli Bhattacharyya; Md Shenuarin Bhuiyan; Sujit Kumar Bhutia; Lanrong Bi; Xiaolin Bi; Trevor J Biden; Krikor Bijian; Viktor A Billes; Nadine Binart; Claudia Bincoletto; Asa B Birgisdottir; Geir Bjorkoy; Gonzalo Blanco; Ana Blas-Garcia; Janusz Blasiak; Robert Blomgran; Klas Blomgren; Janice S Blum; Emilio Boada-Romero; Mirta Boban; Kathleen Boesze-Battaglia; Philippe Boeuf; Barry Boland; Pascale Bomont; Paolo Bonaldo; Srinivasa Reddy Bonam; Laura Bonfili; Juan S Bonifacino; Brian A Boone; Martin D Bootman; Matteo Bordi; Christoph Borner; Beat C Bornhauser; Gautam Borthakur; Jürgen Bosch; Santanu Bose; Luis M Botana; Juan Botas; Chantal M Boulanger; Michael E Boulton; Mathieu Bourdenx; Benjamin Bourgeois; Nollaig M Bourke; Guilhem Bousquet; Patricia Boya; Peter V Bozhkov; Luiz H M Bozi; Tolga O Bozkurt; Doug E Brackney; Christian H Brandts; Ralf J Braun; Gerhard H Braus; Roberto Bravo-Sagua; José M Bravo-San Pedro; Patrick Brest; Marie-Agnès Bringer; Alfredo Briones-Herrera; V Courtney Broaddus; Peter Brodersen; Jeffrey L Brodsky; Steven L Brody; Paola G Bronson; Jeff M Bronstein; Carolyn N Brown; Rhoderick E Brown; Patricia C Brum; John H Brumell; Nicola Brunetti-Pierri; Daniele Bruno; Robert J Bryson-Richardson; Cecilia Bucci; Carmen Buchrieser; Marta Bueno; Laura Elisa Buitrago-Molina; Simone Buraschi; Shilpa Buch; J Ross Buchan; Erin M Buckingham; Hikmet Budak; Mauricio Budini; Geert Bultynck; Florin Burada; Joseph R Burgoyne; M Isabel Burón; Victor Bustos; Sabrina Büttner; Elena Butturini; Aaron Byrd; Isabel Cabas; Sandra Cabrera-Benitez; Ken Cadwell; Jingjing Cai; Lu Cai; Qian Cai; Montserrat Cairó; Jose A Calbet; Guy A Caldwell; Kim A Caldwell; Jarrod A Call; Riccardo Calvani; Ana C Calvo; Miguel Calvo-Rubio Barrera; Niels Os Camara; Jacques H Camonis; Nadine Camougrand; Michelangelo Campanella; Edward M Campbell; François-Xavier Campbell-Valois; Silvia Campello; Ilaria Campesi; Juliane C Campos; Olivier Camuzard; Jorge Cancino; Danilo Candido de Almeida; Laura Canesi; Isabella Caniggia; Barbara Canonico; Carles Cantí; Bin Cao; Michele Caraglia; Beatriz Caramés; Evie H Carchman; Elena Cardenal-Muñoz; Cesar Cardenas; Luis Cardenas; Sandra M Cardoso; Jennifer S Carew; Georges F Carle; Gillian Carleton; Silvia Carloni; Didac Carmona-Gutierrez; Leticia A Carneiro; Oliana Carnevali; Julian M Carosi; Serena Carra; Alice Carrier; Lucie Carrier; Bernadette Carroll; A Brent Carter; Andreia Neves Carvalho; Magali Casanova; Caty Casas; Josefina Casas; Chiara Cassioli; Eliseo F Castillo; Karen Castillo; Sonia Castillo-Lluva; Francesca Castoldi; Marco Castori; Ariel F Castro; Margarida Castro-Caldas; Javier Castro-Hernandez; Susana Castro-Obregon; Sergio D Catz; Claudia Cavadas; Federica Cavaliere; Gabriella Cavallini; Maria Cavinato; Maria L Cayuela; Paula Cebollada Rica; Valentina Cecarini; Francesco Cecconi; Marzanna Cechowska-Pasko; Simone Cenci; Victòria Ceperuelo-Mallafré; João J Cerqueira; Janete M Cerutti; Davide Cervia; Vildan Bozok Cetintas; Silvia Cetrullo; Han-Jung Chae; Andrei S Chagin; Chee-Yin Chai; Gopal Chakrabarti; Oishee Chakrabarti; Tapas Chakraborty; Trinad Chakraborty; Mounia Chami; Georgios Chamilos; David W Chan; Edmond Y W Chan; Edward D Chan; H Y Edwin Chan; Helen H Chan; Hung Chan; Matthew T V Chan; Yau Sang Chan; Partha K Chandra; Chih-Peng Chang; Chunmei Chang; Hao-Chun Chang; Kai Chang; Jie Chao; Tracey Chapman; Nicolas Charlet-Berguerand; Samrat Chatterjee; Shail K Chaube; Anu Chaudhary; Santosh Chauhan; Edward Chaum; Frédéric Checler; Michael E Cheetham; Chang-Shi Chen; Guang-Chao Chen; Jian-Fu Chen; Liam L Chen; Leilei Chen; Lin Chen; Mingliang Chen; Mu-Kuan Chen; Ning Chen; Quan Chen; Ruey-Hwa Chen; Shi Chen; Wei Chen; Weiqiang Chen; Xin-Ming Chen; Xiong-Wen Chen; Xu Chen; Yan Chen; Ye-Guang Chen; Yingyu Chen; Yongqiang Chen; Yu-Jen Chen; Yue-Qin Chen; Zhefan Stephen Chen; Zhi Chen; Zhi-Hua Chen; Zhijian J Chen; Zhixiang Chen; Hanhua Cheng; Jun Cheng; Shi-Yuan Cheng; Wei Cheng; Xiaodong Cheng; Xiu-Tang Cheng; Yiyun Cheng; Zhiyong Cheng; Zhong Chen; Heesun Cheong; Jit Kong Cheong; Boris V Chernyak; Sara Cherry; Chi Fai Randy Cheung; Chun Hei Antonio Cheung; King-Ho Cheung; Eric Chevet; Richard J Chi; Alan Kwok Shing Chiang; Ferdinando Chiaradonna; Roberto Chiarelli; Mario Chiariello; Nathalia Chica; Susanna Chiocca; Mario Chiong; Shih-Hwa Chiou; Abhilash I Chiramel; Valerio Chiurchiù; Dong-Hyung Cho; Seong-Kyu Choe; Augustine M K Choi; Mary E Choi; Kamalika Roy Choudhury; Norman S Chow; Charleen T Chu; Jason P Chua; John Jia En Chua; Hyewon Chung; Kin Pan Chung; Seockhoon Chung; So-Hyang Chung; Yuen-Li Chung; Valentina Cianfanelli; Iwona A Ciechomska; Mariana Cifuentes; Laura Cinque; Sebahattin Cirak; Mara Cirone; Michael J Clague; Robert Clarke; Emilio Clementi; Eliana M Coccia; Patrice Codogno; Ehud Cohen; Mickael M Cohen; Tania Colasanti; Fiorella Colasuonno; Robert A Colbert; Anna Colell; Miodrag Čolić; Nuria S Coll; Mark O Collins; María I Colombo; Daniel A Colón-Ramos; Lydie Combaret; Sergio Comincini; Márcia R Cominetti; Antonella Consiglio; Andrea Conte; Fabrizio Conti; Viorica Raluca Contu; Mark R Cookson; Kevin M Coombs; Isabelle Coppens; Maria Tiziana Corasaniti; Dale P Corkery; Nils Cordes; Katia Cortese; Maria do Carmo Costa; Sarah Costantino; Paola Costelli; Ana Coto-Montes; Peter J Crack; Jose L Crespo; Alfredo Criollo; Valeria Crippa; Riccardo Cristofani; Tamas Csizmadia; Antonio Cuadrado; Bing Cui; Jun Cui; Yixian Cui; Yong Cui; Emmanuel Culetto; Andrea C Cumino; Andrey V Cybulsky; Mark J Czaja; Stanislaw J Czuczwar; Stefania D'Adamo; Marcello D'Amelio; Daniela D'Arcangelo; Andrew C D'Lugos; Gabriella D'Orazi; James A da Silva; Hormos Salimi Dafsari; Ruben K Dagda; Yasin Dagdas; Maria Daglia; Xiaoxia Dai; Yun Dai; Yuyuan Dai; Jessica Dal Col; Paul Dalhaimer; Luisa Dalla Valle; Tobias Dallenga; Guillaume Dalmasso; Markus Damme; Ilaria Dando; Nico P Dantuma; April L Darling; Hiranmoy Das; Srinivasan Dasarathy; Santosh K Dasari; Srikanta Dash; Oliver Daumke; Adrian N Dauphinee; Jeffrey S Davies; Valeria A Dávila; Roger J Davis; Tanja Davis; Sharadha Dayalan Naidu; Francesca De Amicis; Karolien De Bosscher; Francesca De Felice; Lucia De Franceschi; Chiara De Leonibus; Mayara G de Mattos Barbosa; Guido R Y De Meyer; Angelo De Milito; Cosimo De Nunzio; Clara De Palma; Mauro De Santi; Claudio De Virgilio; Daniela De Zio; Jayanta Debnath; Brian J DeBosch; Jean-Paul Decuypere; Mark A Deehan; Gianluca Deflorian; James DeGregori; Benjamin Dehay; Gabriel Del Rio; Joe R Delaney; Lea M D Delbridge; Elizabeth Delorme-Axford; M Victoria Delpino; Francesca Demarchi; Vilma Dembitz; Nicholas D Demers; Hongbin Deng; Zhiqiang Deng; Joern Dengjel; Paul Dent; Donna Denton; Melvin L DePamphilis; Channing J Der; Vojo Deretic; Albert Descoteaux; Laura Devis; Sushil Devkota; Olivier Devuyst; Grant Dewson; Mahendiran Dharmasivam; Rohan Dhiman; Diego di Bernardo; Manlio Di Cristina; Fabio Di Domenico; Pietro Di Fazio; Alessio Di Fonzo; Giovanni Di Guardo; Gianni M Di Guglielmo; Luca Di Leo; Chiara Di Malta; Alessia Di Nardo; Martina Di Rienzo; Federica Di Sano; George Diallinas; Jiajie Diao; Guillermo Diaz-Araya; Inés Díaz-Laviada; Jared M Dickinson; Marc Diederich; Mélanie Dieudé; Ivan Dikic; Shiping Ding; Wen-Xing Ding; Luciana Dini; Jelena Dinić; Miroslav Dinic; Albena T Dinkova-Kostova; Marc S Dionne; Jörg H W Distler; Abhinav Diwan; Ian M C Dixon; Mojgan Djavaheri-Mergny; Ina Dobrinski; Oxana Dobrovinskaya; Radek Dobrowolski; Renwick C J Dobson; Jelena Đokić; Serap Dokmeci Emre; Massimo Donadelli; Bo Dong; Xiaonan Dong; Zhiwu Dong; Gerald W Dorn Ii; Volker Dotsch; Huan Dou; Juan Dou; Moataz Dowaidar; Sami Dridi; Liat Drucker; Ailian Du; Caigan Du; Guangwei Du; Hai-Ning Du; Li-Lin Du; André du Toit; Shao-Bin Duan; Xiaoqiong Duan; Sónia P Duarte; Anna Dubrovska; Elaine A Dunlop; Nicolas Dupont; Raúl V Durán; Bilikere S Dwarakanath; Sergey A Dyshlovoy; Darius Ebrahimi-Fakhari; Leopold Eckhart; Charles L Edelstein; Thomas Efferth; Eftekhar Eftekharpour; Ludwig Eichinger; Nabil Eid; Tobias Eisenberg; N Tony Eissa; Sanaa Eissa; Miriam Ejarque; Abdeljabar El Andaloussi; Nazira El-Hage; Shahenda El-Naggar; Anna Maria Eleuteri; Eman S El-Shafey; Mohamed Elgendy; Aristides G Eliopoulos; María M Elizalde; Philip M Elks; Hans-Peter Elsasser; Eslam S Elsherbiny; Brooke M Emerling; N C Tolga Emre; Christina H Eng; Nikolai Engedal; Anna-Mart Engelbrecht; Agnete S T Engelsen; Jorrit M Enserink; Ricardo Escalante; Audrey Esclatine; Mafalda Escobar-Henriques; Eeva-Liisa Eskelinen; Lucile Espert; Makandjou-Ola Eusebio; Gemma Fabrias; Cinzia Fabrizi; Antonio Facchiano; Francesco Facchiano; Bengt Fadeel; Claudio Fader; Alex C Faesen; W Douglas Fairlie; Alberto Falcó; Bjorn H Falkenburger; Daping Fan; Jie Fan; Yanbo Fan; Evandro F Fang; Yanshan Fang; Yognqi Fang; Manolis Fanto; Tamar Farfel-Becker; Mathias Faure; Gholamreza Fazeli; Anthony O Fedele; Arthur M Feldman; Du Feng; Jiachun Feng; Lifeng Feng; Yibin Feng; Yuchen Feng; Wei Feng; Thais Fenz Araujo; Thomas A Ferguson; Álvaro F Fernández; Jose C Fernandez-Checa; Sonia Fernández-Veledo; Alisdair R Fernie; Anthony W Ferrante; Alessandra Ferraresi; Merari F Ferrari; Julio C B Ferreira; Susan Ferro-Novick; Antonio Figueras; Riccardo Filadi; Nicoletta Filigheddu; Eduardo Filippi-Chiela; Giuseppe Filomeni; Gian Maria Fimia; Vittorio Fineschi; Francesca Finetti; Steven Finkbeiner; Edward A Fisher; Paul B Fisher; Flavio Flamigni; Steven J Fliesler; Trude H Flo; Ida Florance; Oliver Florey; Tullio Florio; Erika Fodor; Carlo Follo; Edward A Fon; Antonella Forlino; Francesco Fornai; Paola Fortini; Anna Fracassi; Alessandro Fraldi; Brunella Franco; Rodrigo Franco; Flavia Franconi; Lisa B Frankel; Scott L Friedman; Leopold F Fröhlich; Gema Frühbeck; Jose M Fuentes; Yukio Fujiki; Naonobu Fujita; Yuuki Fujiwara; Mitsunori Fukuda; Simone Fulda; Luc Furic; Norihiko Furuya; Carmela Fusco; Michaela U Gack; Lidia Gaffke; Sehamuddin Galadari; Alessia Galasso; Maria F Galindo; Sachith Gallolu Kankanamalage; Lorenzo Galluzzi; Vincent Galy; Noor Gammoh; Boyi Gan; Ian G Ganley; Feng Gao; Hui Gao; Minghui Gao; Ping Gao; Shou-Jiang Gao; Wentao Gao; Xiaobo Gao; Ana Garcera; Maria Noé Garcia; Verónica E Garcia; Francisco García-Del Portillo; Vega Garcia-Escudero; Aracely Garcia-Garcia; Marina Garcia-Macia; Diana García-Moreno; Carmen Garcia-Ruiz; Patricia García-Sanz; Abhishek D Garg; Ricardo Gargini; Tina Garofalo; Robert F Garry; Nils C Gassen; Damian Gatica; Liang Ge; Wanzhong Ge; Ruth Geiss-Friedlander; Cecilia Gelfi; Pascal Genschik; Ian E Gentle; Valeria Gerbino; Christoph Gerhardt; Kyla Germain; Marc Germain; David A Gewirtz; Elham Ghasemipour Afshar; Saeid Ghavami; Alessandra Ghigo; Manosij Ghosh; Georgios Giamas; Claudia Giampietri; Alexandra Giatromanolaki; Gary E Gibson; Spencer B Gibson; Vanessa Ginet; Edward Giniger; Carlotta Giorgi; Henrique Girao; Stephen E Girardin; Mridhula Giridharan; Sandy Giuliano; Cecilia Giulivi; Sylvie Giuriato; Julien Giustiniani; Alexander Gluschko; Veit Goder; Alexander Goginashvili; Jakub Golab; David C Goldstone; Anna Golebiewska; Luciana R Gomes; Rodrigo Gomez; Rubén Gómez-Sánchez; Maria Catalina Gomez-Puerto; Raquel Gomez-Sintes; Qingqiu Gong; Felix M Goni; Javier González-Gallego; Tomas Gonzalez-Hernandez; Rosa A Gonzalez-Polo; Jose A Gonzalez-Reyes; Patricia González-Rodríguez; Ing Swie Goping; Marina S Gorbatyuk; Nikolai V Gorbunov; Kıvanç Görgülü; Roxana M Gorojod; Sharon M Gorski; Sandro Goruppi; Cecilia Gotor; Roberta A Gottlieb; Illana Gozes; Devrim Gozuacik; Martin Graef; Markus H Gräler; Veronica Granatiero; Daniel Grasso; Joshua P Gray; Douglas R Green; Alexander Greenhough; Stephen L Gregory; Edward F Griffin; Mark W Grinstaff; Frederic Gros; Charles Grose; Angelina S Gross; Florian Gruber; Paolo Grumati; Tilman Grune; Xueyan Gu; Jun-Lin Guan; Carlos M Guardia; Kishore Guda; Flora Guerra; Consuelo Guerri; Prasun Guha; Carlos Guillén; Shashi Gujar; Anna Gukovskaya; Ilya Gukovsky; Jan Gunst; Andreas Günther; Anyonya R Guntur; Chuanyong Guo; Chun Guo; Hongqing Guo; Lian-Wang Guo; Ming Guo; Pawan Gupta; Shashi Kumar Gupta; Swapnil Gupta; Veer Bala Gupta; Vivek Gupta; Asa B Gustafsson; David D Gutterman; Ranjitha H B; Annakaisa Haapasalo; James E Haber; Aleksandra Hać; Shinji Hadano; Anders J Hafrén; Mansour Haidar; Belinda S Hall; Gunnel Halldén; Anne Hamacher-Brady; Andrea Hamann; Maho Hamasaki; Weidong Han; Malene Hansen; Phyllis I Hanson; Zijian Hao; Masaru Harada; Ljubica Harhaji-Trajkovic; Nirmala Hariharan; Nigil Haroon; James Harris; Takafumi Hasegawa; Noor Hasima Nagoor; Jeffrey A Haspel; Volker Haucke; Wayne D Hawkins; Bruce A Hay; Cole M Haynes; Soren B Hayrabedyan; Thomas S Hays; Congcong He; Qin He; Rong-Rong He; You-Wen He; Yu-Ying He; Yasser Heakal; Alexander M Heberle; J Fielding Hejtmancik; Gudmundur Vignir Helgason; Vanessa Henkel; Marc Herb; Alexander Hergovich; Anna Herman-Antosiewicz; Agustín Hernández; Carlos Hernandez; Sergio Hernandez-Diaz; Virginia Hernandez-Gea; Amaury Herpin; Judit Herreros; Javier H Hervás; Daniel Hesselson; Claudio Hetz; Volker T Heussler; Yujiro Higuchi; Sabine Hilfiker; Joseph A Hill; William S Hlavacek; Emmanuel A Ho; Idy H T Ho; Philip Wing-Lok Ho; Shu-Leong Ho; Wan Yun Ho; G Aaron Hobbs; Mark Hochstrasser; Peter H M Hoet; Daniel Hofius; Paul Hofman; Annika Höhn; Carina I Holmberg; Jose R Hombrebueno; Chang-Won Hong Yi-Ren Hong; Lora V Hooper; Thorsten Hoppe; Rastislav Horos; Yujin Hoshida; I-Lun Hsin; Hsin-Yun Hsu; Bing Hu; Dong Hu; Li-Fang Hu; Ming Chang Hu; Ronggui Hu; Wei Hu; Yu-Chen Hu; Zhuo-Wei Hu; Fang Hua; Jinlian Hua; Yingqi Hua; Chongmin Huan; Canhua Huang; Chuanshu Huang; Chuanxin Huang; Chunling Huang; Haishan Huang; Kun Huang; Michael L H Huang; Rui Huang; Shan Huang; Tianzhi Huang; Xing Huang; Yuxiang Jack Huang; Tobias B Huber; Virginie Hubert; Christian A Hubner; Stephanie M Hughes; William E Hughes; Magali Humbert; Gerhard Hummer; James H Hurley; Sabah Hussain; Salik Hussain; Patrick J Hussey; Martina Hutabarat; Hui-Yun Hwang; Seungmin Hwang; Antonio Ieni; Fumiyo Ikeda; Yusuke Imagawa; Yuzuru Imai; Carol Imbriano; Masaya Imoto; Denise M Inman; Ken Inoki; Juan Iovanna; Renato V Iozzo; Giuseppe Ippolito; Javier E Irazoqui; Pablo Iribarren; Mohd Ishaq; Makoto Ishikawa; Nestor Ishimwe; Ciro Isidoro; Nahed Ismail; Shohreh Issazadeh-Navikas; Eisuke Itakura; Daisuke Ito; Davor Ivankovic; Saška Ivanova; Anand Krishnan V Iyer; José M Izquierdo; Masanori Izumi; Marja Jäättelä; Majid Sakhi Jabir; William T Jackson; Nadia Jacobo-Herrera; Anne-Claire Jacomin; Elise Jacquin; Pooja Jadiya; Hartmut Jaeschke; Chinnaswamy Jagannath; Arjen J Jakobi; Johan Jakobsson; Bassam Janji; Pidder Jansen-Dürr; Patric J Jansson; Jonathan Jantsch; Sławomir Januszewski; Alagie Jassey; Steve Jean; Hélène Jeltsch-David; Pavla Jendelova; Andreas Jenny; Thomas E Jensen; Niels Jessen; Jenna L Jewell; Jing Ji; Lijun Jia; Rui Jia; Liwen Jiang; Qing Jiang; Richeng Jiang; Teng Jiang; Xuejun Jiang; Yu Jiang; Maria Jimenez-Sanchez; Eun-Jung Jin; Fengyan Jin; Hongchuan Jin; Li Jin; Luqi Jin; Meiyan Jin; Si Jin; Eun-Kyeong Jo; Carine Joffre; Terje Johansen; Gail V W Johnson; Simon A Johnston; Eija Jokitalo; Mohit Kumar Jolly; Leo A B Joosten; Joaquin Jordan; Bertrand Joseph; Dianwen Ju; Jeong-Sun Ju; Jingfang Ju; Esmeralda Juárez; Delphine Judith; Gábor Juhász; Youngsoo Jun; Chang Hwa Jung; Sung-Chul Jung; Yong Keun Jung; Heinz Jungbluth; Johannes Jungverdorben; Steffen Just; Kai Kaarniranta; Allen Kaasik; Tomohiro Kabuta; Daniel Kaganovich; Alon Kahana; Renate Kain; Shinjo Kajimura; Maria Kalamvoki; Manjula Kalia; Danuta S Kalinowski; Nina Kaludercic; Ioanna Kalvari; Joanna Kaminska; Vitaliy O Kaminskyy; Hiromitsu Kanamori; Keizo Kanasaki; Chanhee Kang; Rui Kang; Sang Sun Kang; Senthilvelrajan Kaniyappan; Tomotake Kanki; Thirumala-Devi Kanneganti; Anumantha G Kanthasamy; Arthi Kanthasamy; Marc Kantorow; Orsolya Kapuy; Michalis V Karamouzis; Md Razaul Karim; Parimal Karmakar; Rajesh G Katare; Masaru Kato; Stefan H E Kaufmann; Anu Kauppinen; Gur P Kaushal; Susmita Kaushik; Kiyoshi Kawasaki; Kemal Kazan; Po-Yuan Ke; Damien J Keating; Ursula Keber; John H Kehrl; Kate E Keller; Christian W Keller; Jongsook Kim Kemper; Candia M Kenific; Oliver Kepp; Stephanie Kermorgant; Andreas Kern; Robin Ketteler; Tom G Keulers; Boris Khalfin; Hany Khalil; Bilon Khambu; Shahid Y Khan; Vinoth Kumar Megraj Khandelwal; Rekha Khandia; Widuri Kho; Noopur V Khobrekar; Sataree Khuansuwan; Mukhran Khundadze; Samuel A Killackey; Dasol Kim; Deok Ryong Kim; Do-Hyung Kim; Dong-Eun Kim; Eun Young Kim; Eun-Kyoung Kim; Hak-Rim Kim; Hee-Sik Kim; Jeong Hun Kim; Jin Kyung Kim; Jin-Hoi Kim; Joungmok Kim; Ju Hwan Kim; Keun Il Kim; Peter K Kim; Seong-Jun Kim; Scot R Kimball; Adi Kimchi; Alec C Kimmelman; Tomonori Kimura; Matthew A King; Kerri J Kinghorn; Conan G Kinsey; Vladimir Kirkin; Lorrie A Kirshenbaum; Sergey L Kiselev; Shuji Kishi; Katsuhiko Kitamoto; Yasushi Kitaoka; Kaio Kitazato; Richard N Kitsis; Josef T Kittler; Ole Kjaerulff; Peter S Klein; Thomas Klopstock; Jochen Klucken; Helene Knævelsrud; Roland L Knorr; Ben C B Ko; Fred Ko; Jiunn-Liang Ko; Hotaka Kobayashi; Satoru Kobayashi; Ina Koch; Jan C Koch; Ulrich Koenig; Donat Kögel; Young Ho Koh; Masato Koike; Sepp D Kohlwein; Nur M Kocaturk; Masaaki Komatsu; Jeannette König; Toru Kono; Benjamin T Kopp; Tamas Korcsmaros; Gözde Korkmaz; Viktor I Korolchuk; Mónica Suárez Korsnes; Ali Koskela; Janaiah Kota; Yaichiro Kotake; Monica L Kotler; Yanjun Kou; Michael I Koukourakis; Evangelos Koustas; Attila L Kovacs; Tibor Kovács; Daisuke Koya; Tomohiro Kozako; Claudine Kraft; Dimitri Krainc; Helmut Krämer; Anna D Krasnodembskaya; Carole Kretz-Remy; Guido Kroemer; Nicholas T Ktistakis; Kazuyuki Kuchitsu; Sabine Kuenen; Lars Kuerschner; Thomas Kukar; Ajay Kumar; Ashok Kumar; Deepak Kumar; Dhiraj Kumar; Sharad Kumar; Shinji Kume; Caroline Kumsta; Chanakya N Kundu; Mondira Kundu; Ajaikumar B Kunnumakkara; Lukasz Kurgan; Tatiana G Kutateladze; Ozlem Kutlu; SeongAe Kwak; Ho Jeong Kwon; Taeg Kyu Kwon; Yong Tae Kwon; Irene Kyrmizi; Albert La Spada; Patrick Labonté; Sylvain Ladoire; Ilaria Laface; Frank Lafont; Diane C Lagace; Vikramjit Lahiri; Zhibing Lai; Angela S Laird; Aparna Lakkaraju; Trond Lamark; Sheng-Hui Lan; Ane Landajuela; Darius J R Lane; Jon D Lane; Charles H Lang; Carsten Lange; Ülo Langel; Rupert Langer; Pierre Lapaquette; Jocelyn Laporte; Nicholas F LaRusso; Isabel Lastres-Becker; Wilson Chun Yu Lau; Gordon W Laurie; Sergio Lavandero; Betty Yuen Kwan Law; Helen Ka-Wai Law; Rob Layfield; Weidong Le; Herve Le Stunff; Alexandre Y Leary; Jean-Jacques Lebrun; Lionel Y W Leck; Jean-Philippe Leduc-Gaudet; Changwook Lee; Chung-Pei Lee; Da-Hye Lee; Edward B Lee; Erinna F Lee; Gyun Min Lee; He-Jin Lee; Heung Kyu Lee; Jae Man Lee; Jason S Lee; Jin-A Lee; Joo-Yong Lee; Jun Hee Lee; Michael Lee; Min Goo Lee; Min Jae Lee; Myung-Shik Lee; Sang Yoon Lee; Seung-Jae Lee; Stella Y Lee; Sung Bae Lee; Won Hee Lee; Ying-Ray Lee; Yong-Ho Lee; Youngil Lee; Christophe Lefebvre; Renaud Legouis; Yu L Lei; Yuchen Lei; Sergey Leikin; Gerd Leitinger; Leticia Lemus; Shuilong Leng; Olivia Lenoir; Guido Lenz; Heinz Josef Lenz; Paola Lenzi; Yolanda León; Andréia M Leopoldino; Christoph Leschczyk; Stina Leskelä; Elisabeth Letellier; Chi-Ting Leung; Po Sing Leung; Jeremy S Leventhal; Beth Levine; Patrick A Lewis; Klaus Ley; Bin Li; Da-Qiang Li; Jianming Li; Jing Li; Jiong Li; Ke Li; Liwu Li; Mei Li; Min Li; Min Li; Ming Li; Mingchuan Li; Pin-Lan Li; Ming-Qing Li; Qing Li; Sheng Li; Tiangang Li; Wei Li; Wenming Li; Xue Li; Yi-Ping Li; Yuan Li; Zhiqiang Li; Zhiyong Li; Zhiyuan Li; Jiqin Lian; Chengyu Liang; Qiangrong Liang; Weicheng Liang; Yongheng Liang; YongTian Liang; Guanghong Liao; Lujian Liao; Mingzhi Liao; Yung-Feng Liao; Mariangela Librizzi; Pearl P Y Lie; Mary A Lilly; Hyunjung J Lim; Thania R R Lima; Federica Limana; Chao Lin; Chih-Wen Lin; Dar-Shong Lin; Fu-Cheng Lin; Jiandie D Lin; Kurt M Lin; Kwang-Huei Lin; Liang-Tzung Lin; Pei-Hui Lin; Qiong Lin; Shaofeng Lin; Su-Ju Lin; Wenyu Lin; Xueying Lin; Yao-Xin Lin; Yee-Shin Lin; Rafael Linden; Paula Lindner; Shuo-Chien Ling; Paul Lingor; Amelia K Linnemann; Yih-Cherng Liou; Marta M Lipinski; Saška Lipovšek; Vitor A Lira; Natalia Lisiak; Paloma B Liton; Chao Liu; Ching-Hsuan Liu; Chun-Feng Liu; Cui Hua Liu; Fang Liu; Hao Liu; Hsiao-Sheng Liu; Hua-Feng Liu; Huifang Liu; Jia Liu; Jing Liu; Julia Liu; Leyuan Liu; Longhua Liu; Meilian Liu; Qin Liu; Wei Liu; Wende Liu; Xiao-Hong Liu; Xiaodong Liu; Xingguo Liu; Xu Liu; Xuedong Liu; Yanfen Liu; Yang Liu; Yang Liu; Yueyang Liu; Yule Liu; J Andrew Livingston; Gerard Lizard; Jose M Lizcano; Senka Ljubojevic-Holzer; Matilde E LLeonart; David Llobet-Navàs; Alicia Llorente; Chih Hung Lo; Damián Lobato-Márquez; Qi Long; Yun Chau Long; Ben Loos; Julia A Loos; Manuela G López; Guillermo López-Doménech; José Antonio López-Guerrero; Ana T López-Jiménez; Óscar López-Pérez; Israel López-Valero; Magdalena J Lorenowicz; Mar Lorente; Peter Lorincz; Laura Lossi; Sophie Lotersztajn; Penny E Lovat; Jonathan F Lovell; Alenka Lovy; Péter Lőw; Guang Lu; Haocheng Lu; Jia-Hong Lu; Jin-Jian Lu; Mengji Lu; Shuyan Lu; Alessandro Luciani; John M Lucocq; Paula Ludovico; Micah A Luftig; Morten Luhr; Diego Luis-Ravelo; Julian J Lum; Liany Luna-Dulcey; Anders H Lund; Viktor K Lund; Jan D Lünemann; Patrick Lüningschrör; Honglin Luo; Rongcan Luo; Shouqing Luo; Zhi Luo; Claudio Luparello; Bernhard Lüscher; Luan Luu; Alex Lyakhovich; Konstantin G Lyamzaev; Alf Håkon Lystad; Lyubomyr Lytvynchuk; Alvin C Ma; Changle Ma; Mengxiao Ma; Ning-Fang Ma; Quan-Hong Ma; Xinliang Ma; Yueyun Ma; Zhenyi Ma; Ormond A MacDougald; Fernando Macian; Gustavo C MacIntosh; Jeffrey P MacKeigan; Kay F Macleod; Sandra Maday; Frank Madeo; Muniswamy Madesh; Tobias Madl; Julio Madrigal-Matute; Akiko Maeda; Yasuhiro Maejima; Marta Magarinos; Poornima Mahavadi; Emiliano Maiani; Kenneth Maiese; Panchanan Maiti; Maria Chiara Maiuri; Barbara Majello; Michael B Major; Elena Makareeva; Fayaz Malik; Karthik Mallilankaraman; Walter Malorni; Alina Maloyan; Najiba Mammadova; Gene Chi Wai Man; Federico Manai; Joseph D Mancias; Eva-Maria Mandelkow; Michael A Mandell; Angelo A Manfredi; Masoud H Manjili; Ravi Manjithaya; Patricio Manque; Bella B Manshian; Raquel Manzano; Claudia Manzoni; Kai Mao; Cinzia Marchese; Sandrine Marchetti; Anna Maria Marconi; Fabrizio Marcucci; Stefania Mardente; Olga A Mareninova; Marta Margeta; Muriel Mari; Sara Marinelli; Oliviero Marinelli; Guillermo Mariño; Sofia Mariotto; Richard S Marshall; Mark R Marten; Sascha Martens; Alexandre P J Martin; Katie R Martin; Sara Martin; Shaun Martin; Adrián Martín-Segura; Miguel A Martín-Acebes; Inmaculada Martin-Burriel; Marcos Martin-Rincon; Paloma Martin-Sanz; José A Martina; Wim Martinet; Aitor Martinez; Ana Martinez; Jennifer Martinez; Moises Martinez Velazquez; Nuria Martinez-Lopez; Marta Martinez-Vicente; Daniel O Martins; Joilson O Martins; Waleska K Martins; Tania Martins-Marques; Emanuele Marzetti; Shashank Masaldan; Celine Masclaux-Daubresse; Douglas G Mashek; Valentina Massa; Lourdes Massieu; Glenn R Masson; Laura Masuelli; Anatoliy I Masyuk; Tetyana V Masyuk; Paola Matarrese; Ander Matheu; Satoaki Matoba; Sachiko Matsuzaki; Pamela Mattar; Alessandro Matte; Domenico Mattoscio; José L Mauriz; Mario Mauthe; Caroline Mauvezin; Emanual Maverakis; Paola Maycotte; Johanna Mayer; Gianluigi Mazzoccoli; Cristina Mazzoni; Joseph R Mazzulli; Nami McCarty; Christine McDonald; Mitchell R McGill; Sharon L McKenna; BethAnn McLaughlin; Fionn McLoughlin; Mark A McNiven; Thomas G McWilliams; Fatima Mechta-Grigoriou; Tania Catarina Medeiros; Diego L Medina; Lynn A Megeney; Klara Megyeri; Maryam Mehrpour; Jawahar L Mehta; Alfred J Meijer; Annemarie H Meijer; Jakob Mejlvang; Alicia Meléndez; Annette Melk; Gonen Memisoglu; Alexandrina F Mendes; Delong Meng; Fei Meng; Tian Meng; Rubem Menna-Barreto; Manoj B Menon; Carol Mercer; Anne E Mercier; Jean-Louis Mergny; Adalberto Merighi; Seth D Merkley; Giuseppe Merla; Volker Meske; Ana Cecilia Mestre; Shree Padma Metur; Christian Meyer; Hemmo Meyer; Wenyi Mi; Jeanne Mialet-Perez; Junying Miao; Lucia Micale; Yasuo Miki; Enrico Milan; Małgorzata Milczarek; Dana L Miller; Samuel I Miller; Silke Miller; Steven W Millward; Ira Milosevic; Elena A Minina; Hamed Mirzaei; Hamid Reza Mirzaei; Mehdi Mirzaei; Amit Mishra; Nandita Mishra; Paras Kumar Mishra; Maja Misirkic Marjanovic; Roberta Misasi; Amit Misra; Gabriella Misso; Claire Mitchell; Geraldine Mitou; Tetsuji Miura; Shigeki Miyamoto; Makoto Miyazaki; Mitsunori Miyazaki; Taiga Miyazaki; Keisuke Miyazawa; Noboru Mizushima; Trine H Mogensen; Baharia Mograbi; Reza Mohammadinejad; Yasir Mohamud; Abhishek Mohanty; Sipra Mohapatra; Torsten Möhlmann; Asif Mohmmed; Anna Moles; Kelle H Moley; Maurizio Molinari; Vincenzo Mollace; Andreas Buch Møller; Bertrand Mollereau; Faustino Mollinedo; Costanza Montagna; Mervyn J Monteiro; Andrea Montella; L Ruth Montes; Barbara Montico; Vinod K Mony; Giacomo Monzio Compagnoni; Michael N Moore; Mohammad A Moosavi; Ana L Mora; Marina Mora; David Morales-Alamo; Rosario Moratalla; Paula I Moreira; Elena Morelli; Sandra Moreno; Daniel Moreno-Blas; Viviana Moresi; Benjamin Morga; Alwena H Morgan; Fabrice Morin; Hideaki Morishita; Orson L Moritz; Mariko Moriyama; Yuji Moriyasu; Manuela Morleo; Eugenia Morselli; Jose F Moruno-Manchon; Jorge Moscat; Serge Mostowy; Elisa Motori; Andrea Felinto Moura; Naima Moustaid-Moussa; Maria Mrakovcic; Gabriel Muciño-Hernández; Anupam Mukherjee; Subhadip Mukhopadhyay; Jean M Mulcahy Levy; Victoriano Mulero; Sylviane Muller; Christian Münch; Ashok Munjal; Pura Munoz-Canoves; Teresa Muñoz-Galdeano; Christian Münz; Tomokazu Murakawa; Claudia Muratori; Brona M Murphy; J Patrick Murphy; Aditya Murthy; Timo T Myöhänen; Indira U Mysorekar; Jennifer Mytych; Seyed Mohammad Nabavi; Massimo Nabissi; Péter Nagy; Jihoon Nah; Aimable Nahimana; Ichiro Nakagawa; Ken Nakamura; Hitoshi Nakatogawa; Shyam S Nandi; Meera Nanjundan; Monica Nanni; Gennaro Napolitano; Roberta Nardacci; Masashi Narita; Melissa Nassif; Ilana Nathan; Manabu Natsumeda; Ryno J Naude; Christin Naumann; Olaia Naveiras; Fatemeh Navid; Steffan T Nawrocki; Taras Y Nazarko; Francesca Nazio; Florentina Negoita; Thomas Neill; Amanda L Neisch; Luca M Neri; Mihai G Netea; Patrick Neubert; Thomas P Neufeld; Dietbert Neumann; Albert Neutzner; Phillip T Newton; Paul A Ney; Ioannis P Nezis; Charlene C W Ng; Tzi Bun Ng; Hang T T Nguyen; Long T Nguyen; Hong-Min Ni; Clíona Ní Cheallaigh; Zhenhong Ni; M Celeste Nicolao; Francesco Nicoli; Manuel Nieto-Diaz; Per Nilsson; Shunbin Ning; Rituraj Niranjan; Hiroshi Nishimune; Mireia Niso-Santano; Ralph A Nixon; Annalisa Nobili; Clevio Nobrega; Takeshi Noda; Uxía Nogueira-Recalde; Trevor M Nolan; Ivan Nombela; Ivana Novak; Beatriz Novoa; Takashi Nozawa; Nobuyuki Nukina; Carmen Nussbaum-Krammer; Jesper Nylandsted; Tracey R O'Donovan; Seónadh M O'Leary; Eyleen J O'Rourke; Mary P O'Sullivan; Timothy E O'Sullivan; Salvatore Oddo; Ina Oehme; Michinaga Ogawa; Eric Ogier-Denis; Margret H Ogmundsdottir; Besim Ogretmen; Goo Taeg Oh; Seon-Hee Oh; Young J Oh; Takashi Ohama; Yohei Ohashi; Masaki Ohmuraya; Vasileios Oikonomou; Rani Ojha; Koji Okamoto; Hitoshi Okazawa; Masahide Oku; Sara Oliván; Jorge M A Oliveira; Michael Ollmann; James A Olzmann; Shakib Omari; M Bishr Omary; Gizem Önal; Martin Ondrej; Sang-Bing Ong; Sang-Ging Ong; Anna Onnis; Juan A Orellana; Sara Orellana-Muñoz; Maria Del Mar Ortega-Villaizan; Xilma R Ortiz-Gonzalez; Elena Ortona; Heinz D Osiewacz; Abdel-Hamid K Osman; Rosario Osta; Marisa S Otegui; Kinya Otsu; Christiane Ott; Luisa Ottobrini; Jing-Hsiung James Ou; Tiago F Outeiro; Inger Oynebraten; Melek Ozturk; Gilles Pagès; Susanta Pahari; Marta Pajares; Utpal B Pajvani; Rituraj Pal; Simona Paladino; Nicolas Pallet; Michela Palmieri; Giuseppe Palmisano; Camilla Palumbo; Francesco Pampaloni; Lifeng Pan; Qingjun Pan; Wenliang Pan; Xin Pan; Ganna Panasyuk; Rahul Pandey; Udai B Pandey; Vrajesh Pandya; Francesco Paneni; Shirley Y Pang; Elisa Panzarini; Daniela L Papademetrio; Elena Papaleo; Daniel Papinski; Diana Papp; Eun Chan Park; Hwan Tae Park; Ji-Man Park; Jong-In Park; Joon Tae Park; Junsoo Park; Sang Chul Park; Sang-Youel Park; Abraham H Parola; Jan B Parys; Adrien Pasquier; Benoit Pasquier; João F Passos; Nunzia Pastore; Hemal H Patel; Daniel Patschan; Sophie Pattingre; Gustavo Pedraza-Alva; Jose Pedraza-Chaverri; Zully Pedrozo; Gang Pei; Jianming Pei; Hadas Peled-Zehavi; Joaquín M Pellegrini; Joffrey Pelletier; Miguel A Peñalva; Di Peng; Ying Peng; Fabio Penna; Maria Pennuto; Francesca Pentimalli; Cláudia Mf Pereira; Gustavo J S Pereira; Lilian C Pereira; Luis Pereira de Almeida; Nirma D Perera; Ángel Pérez-Lara; Ana B Perez-Oliva; María Esther Pérez-Pérez; Palsamy Periyasamy; Andras Perl; Cristiana Perrotta; Ida Perrotta; Richard G Pestell; Morten Petersen; Irina Petrache; Goran Petrovski; Thorsten Pfirrmann; Astrid S Pfister; Jennifer A Philips; Huifeng Pi; Anna Picca; Alicia M Pickrell; Sandy Picot; Giovanna M Pierantoni; Marina Pierdominici; Philippe Pierre; Valérie Pierrefite-Carle; Karolina Pierzynowska; Federico Pietrocola; Miroslawa Pietruczuk; Claudio Pignata; Felipe X Pimentel-Muiños; Mario Pinar; Roberta O Pinheiro; Ronit Pinkas-Kramarski; Paolo Pinton; Karolina Pircs; Sujan Piya; Paola Pizzo; Theo S Plantinga; Harald W Platta; Ainhoa Plaza-Zabala; Markus Plomann; Egor Y Plotnikov; Helene Plun-Favreau; Ryszard Pluta; Roger Pocock; Stefanie Pöggeler; Christian Pohl; Marc Poirot; Angelo Poletti; Marisa Ponpuak; Hana Popelka; Blagovesta Popova; Helena Porta; Soledad Porte Alcon; Eliana Portilla-Fernandez; Martin Post; Malia B Potts; Joanna Poulton; Ted Powers; Veena Prahlad; Tomasz K Prajsnar; Domenico Praticò; Rosaria Prencipe; Muriel Priault; Tassula Proikas-Cezanne; Vasilis J Promponas; Christopher G Proud; Rosa Puertollano; Luigi Puglielli; Thomas Pulinilkunnil; Deepika Puri; Rajat Puri; Julien Puyal; Xiaopeng Qi; Yongmei Qi; Wenbin Qian; Lei Qiang; Yu Qiu; Joe Quadrilatero; Jorge Quarleri; Nina Raben; Hannah Rabinowich; Debora Ragona; Michael J Ragusa; Nader Rahimi; Marveh Rahmati; Valeria Raia; Nuno Raimundo; Namakkal-Soorappan Rajasekaran; Sriganesh Ramachandra Rao; Abdelhaq Rami; Ignacio Ramírez-Pardo; David B Ramsden; Felix Randow; Pundi N Rangarajan; Danilo Ranieri; Hai Rao; Lang Rao; Rekha Rao; Sumit Rathore; J Arjuna Ratnayaka; Edward A Ratovitski; Palaniyandi Ravanan; Gloria Ravegnini; Swapan K Ray; Babak Razani; Vito Rebecca; Fulvio Reggiori; Anne Régnier-Vigouroux; Andreas S Reichert; David Reigada; Jan H Reiling; Theo Rein; Siegfried Reipert; Rokeya Sultana Rekha; Hongmei Ren; Jun Ren; Weichao Ren; Tristan Renault; Giorgia Renga; Karen Reue; Kim Rewitz; Bruna Ribeiro de Andrade Ramos; S Amer Riazuddin; Teresa M Ribeiro-Rodrigues; Jean-Ehrland Ricci; Romeo Ricci; Victoria Riccio; Des R Richardson; Yasuko Rikihisa; Makarand V Risbud; Ruth M Risueño; Konstantinos Ritis; Salvatore Rizza; Rosario Rizzuto; Helen C Roberts; Luke D Roberts; Katherine J Robinson; Maria Carmela Roccheri; Stephane Rocchi; George G Rodney; Tiago Rodrigues; Vagner Ramon Rodrigues Silva; Amaia Rodriguez; Ruth Rodriguez-Barrueco; Nieves Rodriguez-Henche; Humberto Rodriguez-Rocha; Jeroen Roelofs; Robert S Rogers; Vladimir V Rogov; Ana I Rojo; Krzysztof Rolka; Vanina Romanello; Luigina Romani; Alessandra Romano; Patricia S Romano; David Romeo-Guitart; Luis C Romero; Montserrat Romero; Joseph C Roney; Christopher Rongo; Sante Roperto; Mathias T Rosenfeldt; Philip Rosenstiel; Anne G Rosenwald; Kevin A Roth; Lynn Roth; Steven Roth; Kasper M A Rouschop; Benoit D Roussel; Sophie Roux; Patrizia Rovere-Querini; Ajit Roy; Aurore Rozieres; Diego Ruano; David C Rubinsztein; Maria P Rubtsova; Klaus Ruckdeschel; Christoph Ruckenstuhl; Emil Rudolf; Rüdiger Rudolf; Alessandra Ruggieri; Avnika Ashok Ruparelia; Paola Rusmini; Ryan R Russell; Gian Luigi Russo; Maria Russo; Rossella Russo; Oxana O Ryabaya; Kevin M Ryan; Kwon-Yul Ryu; Maria Sabater-Arcis; Ulka Sachdev; Michael Sacher; Carsten Sachse; Abhishek Sadhu; Junichi Sadoshima; Nathaniel Safren; Paul Saftig; Antonia P Sagona; Gaurav Sahay; Amirhossein Sahebkar; Mustafa Sahin; Ozgur Sahin; Sumit Sahni; Nayuta Saito; Shigeru Saito; Tsunenori Saito; Ryohei Sakai; Yasuyoshi Sakai; Jun-Ichi Sakamaki; Kalle Saksela; Gloria Salazar; Anna Salazar-Degracia; Ghasem H Salekdeh; Ashok K Saluja; Belém Sampaio-Marques; Maria Cecilia Sanchez; Jose A Sanchez-Alcazar; Victoria Sanchez-Vera; Vanessa Sancho-Shimizu; J Thomas Sanderson; Marco Sandri; Stefano Santaguida; Laura Santambrogio; Magda M Santana; Giorgio Santoni; Alberto Sanz; Pascual Sanz; Shweta Saran; Marco Sardiello; Timothy J Sargeant; Apurva Sarin; Chinmoy Sarkar; Sovan Sarkar; Maria-Rosa Sarrias; Surajit Sarkar; Dipanka Tanu Sarmah; Jaakko Sarparanta; Aishwarya Sathyanarayan; Ranganayaki Sathyanarayanan; K Matthew Scaglione; Francesca Scatozza; Liliana Schaefer; Zachary T Schafer; Ulrich E Schaible; Anthony H V Schapira; Michael Scharl; Hermann M Schatzl; Catherine H Schein; Wiep Scheper; David Scheuring; Maria Vittoria Schiaffino; Monica Schiappacassi; Rainer Schindl; Uwe Schlattner; Oliver Schmidt; Roland Schmitt; Stephen D Schmidt; Ingo Schmitz; Eran Schmukler; Anja Schneider; Bianca E Schneider; Romana Schober; Alejandra C Schoijet; Micah B Schott; Michael Schramm; Bernd Schröder; Kai Schuh; Christoph Schüller; Ryan J Schulze; Lea Schürmanns; Jens C Schwamborn; Melanie Schwarten; Filippo Scialo; Sebastiano Sciarretta; Melanie J Scott; Kathleen W Scotto; A Ivana Scovassi; Andrea Scrima; Aurora Scrivo; David Sebastian; Salwa Sebti; Simon Sedej; Laura Segatori; Nava Segev; Per O Seglen; Iban Seiliez; Ekihiro Seki; Scott B Selleck; Frank W Sellke; Joshua T Selsby; Michael Sendtner; Serif Senturk; Elena Seranova; Consolato Sergi; Ruth Serra-Moreno; Hiromi Sesaki; Carmine Settembre; Subba Rao Gangi Setty; Gianluca Sgarbi; Ou Sha; John J Shacka; Javeed A Shah; Dantong Shang; Changshun Shao; Feng Shao; Soroush Sharbati; Lisa M Sharkey; Dipali Sharma; Gaurav Sharma; Kulbhushan Sharma; Pawan Sharma; Surendra Sharma; Han-Ming Shen; Hongtao Shen; Jiangang Shen; Ming Shen; Weili Shen; Zheni Shen; Rui Sheng; Zhi Sheng; Zu-Hang Sheng; Jianjian Shi; Xiaobing Shi; Ying-Hong Shi; Kahori Shiba-Fukushima; Jeng-Jer Shieh; Yohta Shimada; Shigeomi Shimizu; Makoto Shimozawa; Takahiro Shintani; Christopher J Shoemaker; Shahla Shojaei; Ikuo Shoji; Bhupendra V Shravage; Viji Shridhar; Chih-Wen Shu; Hong-Bing Shu; Ke Shui; Arvind K Shukla; Timothy E Shutt; Valentina Sica; Aleem Siddiqui; Amanda Sierra; Virginia Sierra-Torre; Santiago Signorelli; Payel Sil; Bruno J de Andrade Silva; Johnatas D Silva; Eduardo Silva-Pavez; Sandrine Silvente-Poirot; Rachel E Simmonds; Anna Katharina Simon; Hans-Uwe Simon; Matias Simons; Anurag Singh; Lalit P Singh; Rajat Singh; Shivendra V Singh; Shrawan K Singh; Sudha B Singh; Sunaina Singh; Surinder Pal Singh; Debasish Sinha; Rohit Anthony Sinha; Sangita Sinha; Agnieszka Sirko; Kapil Sirohi; Efthimios L Sivridis; Panagiotis Skendros; Aleksandra Skirycz; Iva Slaninová; Soraya S Smaili; Andrei Smertenko; Matthew D Smith; Stefaan J Soenen; Eun Jung Sohn; Sophia P M Sok; Giancarlo Solaini; Thierry Soldati; Scott A Soleimanpour; Rosa M Soler; Alexei Solovchenko; Jason A Somarelli; Avinash Sonawane; Fuyong Song; Hyun Kyu Song; Ju-Xian Song; Kunhua Song; Zhiyin Song; Leandro R Soria; Maurizio Sorice; Alexander A Soukas; Sandra-Fausia Soukup; Diana Sousa; Nadia Sousa; Paul A Spagnuolo; Stephen A Spector; M M Srinivas Bharath; Daret St Clair; Venturina Stagni; Leopoldo Staiano; Clint A Stalnecker; Metodi V Stankov; Peter B Stathopulos; Katja Stefan; Sven Marcel Stefan; Leonidas Stefanis; Joan S Steffan; Alexander Steinkasserer; Harald Stenmark; Jared Sterneckert; Craig Stevens; Veronika Stoka; Stephan Storch; Björn Stork; Flavie Strappazzon; Anne Marie Strohecker; Dwayne G Stupack; Huanxing Su; Ling-Yan Su; Longxiang Su; Ana M Suarez-Fontes; Carlos S Subauste; Selvakumar Subbian; Paula V Subirada; Ganapasam Sudhandiran; Carolyn M Sue; Xinbing Sui; Corey Summers; Guangchao Sun; Jun Sun; Kang Sun; Meng-Xiang Sun; Qiming Sun; Yi Sun; Zhongjie Sun; Karen K S Sunahara; Eva Sundberg; Katalin Susztak; Peter Sutovsky; Hidekazu Suzuki; Gary Sweeney; J David Symons; Stephen Cho Wing Sze; Nathaniel J Szewczyk; Anna Tabęcka-Łonczynska; Claudio Tabolacci; Frank Tacke; Heinrich Taegtmeyer; Marco Tafani; Mitsuo Tagaya; Haoran Tai; Stephen W G Tait; Yoshinori Takahashi; Szabolcs Takats; Priti Talwar; Chit Tam; Shing Yau Tam; Davide Tampellini; Atsushi Tamura; Chong Teik Tan; Eng-King Tan; Ya-Qin Tan; Masaki Tanaka; Motomasa Tanaka; Daolin Tang; Jingfeng Tang; Tie-Shan Tang; Isei Tanida; Zhipeng Tao; Mohammed Taouis; Lars Tatenhorst; Nektarios Tavernarakis; Allen Taylor; Gregory A Taylor; Joan M Taylor; Elena Tchetina; Andrew R Tee; Irmgard Tegeder; David Teis; Natercia Teixeira; Fatima Teixeira-Clerc; Kumsal A Tekirdag; Tewin Tencomnao; Sandra Tenreiro; Alexei V Tepikin; Pilar S Testillano; Gianluca Tettamanti; Pierre-Louis Tharaux; Kathrin Thedieck; Arvind A Thekkinghat; Stefano Thellung; Josephine W Thinwa; V P Thirumalaikumar; Sufi Mary Thomas; Paul G Thomes; Andrew Thorburn; Lipi Thukral; Thomas Thum; Michael Thumm; Ling Tian; Ales Tichy; Andreas Till; Vincent Timmerman; Vladimir I Titorenko; Sokol V Todi; Krassimira Todorova; Janne M Toivonen; Luana Tomaipitinca; Dhanendra Tomar; Cristina Tomas-Zapico; Sergej Tomić; Benjamin Chun-Kit Tong; Chao Tong; Xin Tong; Sharon A Tooze; Maria L Torgersen; Satoru Torii; Liliana Torres-López; Alicia Torriglia; Christina G Towers; Roberto Towns; Shinya Toyokuni; Vladimir Trajkovic; Donatella Tramontano; Quynh-Giao Tran; Leonardo H Travassos; Charles B Trelford; Shirley Tremel; Ioannis P Trougakos; Betty P Tsao; Mario P Tschan; Hung-Fat Tse; Tak Fu Tse; Hitoshi Tsugawa; Andrey S Tsvetkov; David A Tumbarello; Yasin Tumtas; María J Tuñón; Sandra Turcotte; Boris Turk; Vito Turk; Bradley J Turner; Richard I Tuxworth; Jessica K Tyler; Elena V Tyutereva; Yasuo Uchiyama; Aslihan Ugun-Klusek; Holm H Uhlig; Marzena Ułamek-Kozioł; Ilya V Ulasov; Midori Umekawa; Christian Ungermann; Rei Unno; Sylvie Urbe; Elisabet Uribe-Carretero; Suayib Üstün; Vladimir N Uversky; Thomas Vaccari; Maria I Vaccaro; Björn F Vahsen; Helin Vakifahmetoglu-Norberg; Rut Valdor; Maria J Valente; Ayelén Valko; Richard B Vallee; Angela M Valverde; Greet Van den Berghe; Stijn van der Veen; Luc Van Kaer; Jorg van Loosdregt; Sjoerd J L van Wijk; Wim Vandenberghe; Ilse Vanhorebeek; Marcos A Vannier-Santos; Nicola Vannini; M Cristina Vanrell; Chiara Vantaggiato; Gabriele Varano; Isabel Varela-Nieto; Máté Varga; M Helena Vasconcelos; Somya Vats; Demetrios G Vavvas; Ignacio Vega-Naredo; Silvia Vega-Rubin-de-Celis; Guillermo Velasco; Ariadna P Velázquez; Tibor Vellai; Edo Vellenga; Francesca Velotti; Mireille Verdier; Panayotis Verginis; Isabelle Vergne; Paul Verkade; Manish Verma; Patrik Verstreken; Tim Vervliet; Jörg Vervoorts; Alexandre T Vessoni; Victor M Victor; Michel Vidal; Chiara Vidoni; Otilia V Vieira; Richard D Vierstra; Sonia Viganó; Helena Vihinen; Vinoy Vijayan; Miquel Vila; Marçal Vilar; José M Villalba; Antonio Villalobo; Beatriz Villarejo-Zori; Francesc Villarroya; Joan Villarroya; Olivier Vincent; Cecile Vindis; Christophe Viret; Maria Teresa Viscomi; Dora Visnjic; Ilio Vitale; David J Vocadlo; Olga V Voitsekhovskaja; Cinzia Volonté; Mattia Volta; Marta Vomero; Clarissa Von Haefen; Marc A Vooijs; Wolfgang Voos; Ljubica Vucicevic; Richard Wade-Martins; Satoshi Waguri; Kenrick A Waite; Shuji Wakatsuki; David W Walker; Mark J Walker; Simon A Walker; Jochen Walter; Francisco G Wandosell; Bo Wang; Chao-Yung Wang; Chen Wang; Chenran Wang; Chenwei Wang; Cun-Yu Wang; Dong Wang; Fangyang Wang; Feng Wang; Fengming Wang; Guansong Wang; Han Wang; Hao Wang; Hexiang Wang; Hong-Gang Wang; Jianrong Wang; Jigang Wang; Jiou Wang; Jundong Wang; Kui Wang; Lianrong Wang; Liming Wang; Maggie Haitian Wang; Meiqing Wang; Nanbu Wang; Pengwei Wang; Peipei Wang; Ping Wang; Ping Wang; Qing Jun Wang; Qing Wang; Qing Kenneth Wang; Qiong A Wang; Wen-Tao Wang; Wuyang Wang; Xinnan Wang; Xuejun Wang; Yan Wang; Yanchang Wang; Yanzhuang Wang; Yen-Yun Wang; Yihua Wang; Yipeng Wang; Yu Wang; Yuqi Wang; Zhe Wang; Zhenyu Wang; Zhouguang Wang; Gary Warnes; Verena Warnsmann; Hirotaka Watada; Eizo Watanabe; Maxinne Watchon; Anna Wawrzyńska; Timothy E Weaver; Grzegorz Wegrzyn; Ann M Wehman; Huafeng Wei; Lei Wei; Taotao Wei; Yongjie Wei; Oliver H Weiergräber; Conrad C Weihl; Günther Weindl; Ralf Weiskirchen; Alan Wells; Runxia H Wen; Xin Wen; Antonia Werner; Beatrice Weykopf; Sally P Wheatley; J Lindsay Whitton; Alexander J Whitworth; Katarzyna Wiktorska; Manon E Wildenberg; Tom Wileman; Simon Wilkinson; Dieter Willbold; Brett Williams; Robin S B Williams; Roger L Williams; Peter R Williamson; Richard A Wilson; Beate Winner; Nathaniel J Winsor; Steven S Witkin; Harald Wodrich; Ute Woehlbier; Thomas Wollert; Esther Wong; Jack Ho Wong; Richard W Wong; Vincent Kam Wai Wong; W Wei-Lynn Wong; An-Guo Wu; Chengbiao Wu; Jian Wu; Junfang Wu; Kenneth K Wu; Min Wu; Shan-Ying Wu; Shengzhou Wu; Shu-Yan Wu; Shufang Wu; William K K Wu; Xiaohong Wu; Xiaoqing Wu; Yao-Wen Wu; Yihua Wu; Ramnik J Xavier; Hongguang Xia; Lixin Xia; Zhengyuan Xia; Ge Xiang; Jin Xiang; Mingliang Xiang; Wei Xiang; Bin Xiao; Guozhi Xiao; Hengyi Xiao; Hong-Tao Xiao; Jian Xiao; Lan Xiao; Shi Xiao; Yin Xiao; Baoming Xie; Chuan-Ming Xie; Min Xie; Yuxiang Xie; Zhiping Xie; Zhonglin Xie; Maria Xilouri; Congfeng Xu; En Xu; Haoxing Xu; Jing Xu; JinRong Xu; Liang Xu; Wen Wen Xu; Xiulong Xu; Yu Xue; Sokhna M S Yakhine-Diop; Masamitsu Yamaguchi; Osamu Yamaguchi; Ai Yamamoto; Shunhei Yamashina; Shengmin Yan; Shian-Jang Yan; Zhen Yan; Yasuo Yanagi; Chuanbin Yang; Dun-Sheng Yang; Huan Yang; Huang-Tian Yang; Hui Yang; Jin-Ming Yang; Jing Yang; Jingyu Yang; Ling Yang; Liu Yang; Ming Yang; Pei-Ming Yang; Qian Yang; Seungwon Yang; Shu Yang; Shun-Fa Yang; Wannian Yang; Wei Yuan Yang; Xiaoyong Yang; Xuesong Yang; Yi Yang; Ying Yang; Honghong Yao; Shenggen Yao; Xiaoqiang Yao; Yong-Gang Yao; Yong-Ming Yao; Takahiro Yasui; Meysam Yazdankhah; Paul M Yen; Cong Yi; Xiao-Ming Yin; Yanhai Yin; Zhangyuan Yin; Ziyi Yin; Meidan Ying; Zheng Ying; Calvin K Yip; Stephanie Pei Tung Yiu; Young H Yoo; Kiyotsugu Yoshida; Saori R Yoshii; Tamotsu Yoshimori; Bahman Yousefi; Boxuan Yu; Haiyang Yu; Jun Yu; Jun Yu; Li Yu; Ming-Lung Yu; Seong-Woon Yu; Victor C Yu; W Haung Yu; Zhengping Yu; Zhou Yu; Junying Yuan; Ling-Qing Yuan; Shilin Yuan; Shyng-Shiou F Yuan; Yanggang Yuan; Zengqiang Yuan; Jianbo Yue; Zhenyu Yue; Jeanho Yun; Raymond L Yung; David N Zacks; Gabriele Zaffagnini; Vanessa O Zambelli; Isabella Zanella; Qun S Zang; Sara Zanivan; Silvia Zappavigna; Pilar Zaragoza; Konstantinos S Zarbalis; Amir Zarebkohan; Amira Zarrouk; Scott O Zeitlin; Jialiu Zeng; Ju-Deng Zeng; Eva Žerovnik; Lixuan Zhan; Bin Zhang; Donna D Zhang; Hanlin Zhang; Hong Zhang; Hong Zhang; Honghe Zhang; Huafeng Zhang; Huaye Zhang; Hui Zhang; Hui-Ling Zhang; Jianbin Zhang; Jianhua Zhang; Jing-Pu Zhang; Kalin Y B Zhang; Leshuai W Zhang; Lin Zhang; Lisheng Zhang; Lu Zhang; Luoying Zhang; Menghuan Zhang; Peng Zhang; Sheng Zhang; Wei Zhang; Xiangnan Zhang; Xiao-Wei Zhang; Xiaolei Zhang; Xiaoyan Zhang; Xin Zhang; Xinxin Zhang; Xu Dong Zhang; Yang Zhang; Yanjin Zhang; Yi Zhang; Ying-Dong Zhang; Yingmei Zhang; Yuan-Yuan Zhang; Yuchen Zhang; Zhe Zhang; Zhengguang Zhang; Zhibing Zhang; Zhihai Zhang; Zhiyong Zhang; Zili Zhang; Haobin Zhao; Lei Zhao; Shuang Zhao; Tongbiao Zhao; Xiao-Fan Zhao; Ying Zhao; Yongchao Zhao; Yongliang Zhao; Yuting Zhao; Guoping Zheng; Kai Zheng; Ling Zheng; Shizhong Zheng; Xi-Long Zheng; Yi Zheng; Zu-Guo Zheng; Boris Zhivotovsky; Qing Zhong; Ao Zhou; Ben Zhou; Cefan Zhou; Gang Zhou; Hao Zhou; Hong Zhou; Hongbo Zhou; Jie Zhou; Jing Zhou; Jing Zhou; Jiyong Zhou; Kailiang Zhou; Rongjia Zhou; Xu-Jie Zhou; Yanshuang Zhou; Yinghong Zhou; Yubin Zhou; Zheng-Yu Zhou; Zhou Zhou; Binglin Zhu; Changlian Zhu; Guo-Qing Zhu; Haining Zhu; Hongxin Zhu; Hua Zhu; Wei-Guo Zhu; Yanping Zhu; Yushan Zhu; Haixia Zhuang; Xiaohong Zhuang; Katarzyna Zientara-Rytter; Christine M Zimmermann; Elena Ziviani; Teresa Zoladek; Wei-Xing Zong; Dmitry B Zorov; Antonio Zorzano; Weiping Zou; Zhen Zou; Zhengzhi Zou; Steven Zuryn; Werner Zwerschke; Beate Brand-Saberi; X Charlie Dong; Chandra Shekar Kenchappa; Zuguo Li; Yong Lin; Shigeru Oshima; Yueguang Rong; Judith C Sluimer; Christina L Stallings; Chun-Kit Tong Journal: Autophagy Date: 2021-02-08 Impact factor: 13.391
Authors: D Bosc; L Vezenkov; S Bortnik; J An; J Xu; C Choutka; A M Hannigan; S Kovacic; S Loo; P G K Clark; G Chen; R N Guay-Ross; K Yang; W H Dragowska; F Zhang; N E Go; A Leung; N S Honson; T A Pfeifer; M Gleave; M Bally; S J Jones; S M Gorski; R N Young Journal: Sci Rep Date: 2018-08-03 Impact factor: 4.379