Tethered domains and flexible regions in tRNase Z(L), the long form of tRNase Z.

tRNase Z, a member of the metallo-β-lactamase family, endonucleolytically removes the pre-tRNA 3' trailer in a step central to tRNA maturation. The short form (tRNase Z(S)) is the only one found in bacteria and archaebacteria and is also present in some eukaryotes. The homologous long form (tRNase Z(L)), exclusively found in eukaryotes, consists of related amino- and carboxy-domains, suggesting that tRNase Z(L) arose from a tandem duplication of tRNase Z(S) followed by interdependent divergence of the domains. X-ray crystallographic structures of tRNase Z(S) reveal a flexible arm (FA) extruded from the body of tRNase Z remote from the active site that binds tRNA far from the scissile bond. No tRNase Z(L) structures have been solved; alternative biophysical studies are therefore needed to illuminate its functional characteristics. Structural analyses of tRNase Z(L) performed by limited proteolysis, two dimensional gel electrophoresis and mass spectrometry establish stability of the amino and carboxy domains and flexibility of the FA and inter-domain tether, with implications for tRNase Z(L) function.

Introduction

tRNAs are transcribed as precursors and processed by removal of a 5′ leader and a 3′ trailer (reviewed in [1]), among other reactions including modification, splicing and CCA addition. In a reaction central to tRNA maturation, tRNase Z endonucleolytically removes the 3′ trailer preparing OH− on the discriminator (the unpaired nucleotide at the 3′ side of the acceptor stem) for CCA addition and aminoacylation.

Enzymes involved in general metabolism of tRNAs recognize shared features of tRNAs that are absent from most other RNAs, unlike the specificity of the aminoacyl tRNA synthetases. tRNA end-processing enzymes such as RNase P, tRNase Z and CCA-adding enzyme can utilize as substrate a half-tRNA minihelix consisting of the conserved coaxially stacked acceptor stem and T arm [2]–[4]. tRNase Z recognizes this feature using a distinctive flexible arm (FA) [5]–[12].

Two forms of tRNase Z

tRNase Z is a member of the β-lactamase family of metal-dependent hydrolases, characterized by an αβ/βα sandwich fold with the two internal β-sheets flanked by α-helices and one or more metal binding sites [13], [14]. tRNase Z can be separately encoded in short (tRNase ZS) and long (tRNase ZL) forms, and is present, in one form or another, in all eukaryotes and archaebacteria and about half of bacteria [15]. tRNase ZS is the only form in bacteria and archaebacteria. tRNase ZL occurs exclusively in eukaryotes, and is the sole form in S. cerevisiae, C. elegans and D. melanogaster. D. melanogaster tRNase Z functions in vivo in both nuclear and mitochondrial pre-tRNA maturation [16].

Some eukaryotes including H. sapiens encode both tRNase ZL and tRNase ZS. tRNase ZL is the better candidate for an essential function in human pre-tRNA maturation due to its >1,000-fold higher reaction efficiency [17] and dual (nuclear and mitochondrial) localization [18]–[20]. The function of human tRNase ZS, which localizes to cytoplasm, is unknown.

The flexible arm of tRNase Z

All tRNase Zs have a flexible arm (FA; see Supplementary Figures SF1, SF5) which recognizes the elbow that caps the coaxially stacked acceptor stem/T arm common to tRNAs5–11; no accessory proteins are required for pre-tRNA binding or cleavage [21]. Deleting the FA hand causes an almost 100-fold increase in K m for D. melanogaster tRNase Z with little effect on k cat [11], quantifying its recognition/binding function.

Domain structure

tRNase ZL consists of two domains, both similar to a β-lactamase metalloenzyme unit22, tethered by a 70–85 residue spacer [23], suggesting that tRNase ZL evolved from a tandem duplication of tRNase ZS (Figure 1). The C-domain retained the functional metallo-β-lactamase unit and catalytic activity but lost the flexible arm. The N-domain retained the FA and thus functions in initial substrate recognition and binding; architectural features of a metallo-β-lactamase are still present, but the metal-binding residues and active site were lost. While tRNase ZS is a functional homodimer, tRNase ZL presumably acts as a monomer.

Figure 1

Evolution of tRNase ZL from tRNase ZS by tandem duplication/adaptation.

A) D. melanogaster tRNase Z; B) H. sapiens tRNase ZL; C) H. sapiens tRNase ZS adapted from Domain Search entries in NCBI. Pink regions below amino and carboxy domains, with annotated homology to β-Lactamase superfamily, are consistent with the evolution of tRNase ZL from tRNase ZS by tandem duplication/adaptation. D. melanogaster tRNase Z is accession # NP_724916, taken from discovery of a juvenile hormone inducible cDNA (JHI-1 [43]) that was later found to be D. melanogaster tRNase Z [15], . The entry used for H. sapiens tRNase ZL is accession # NP_060597, which was reported to be a candidate human prostate cancer susceptibility gene (ElaC222) and later shown to be human tRNase ZL [15], [44]. H. sapiens tRNase ZS is accession # NP_061166 (ElaC1 [22]). Pink rectangles below sequence tracks indicate the position and boundaries of the blocks that display the greatest sequence similarity to a proto-metallo-β-lactamase unit. The carboxy domain displays greater homology to the archetypal β-Lactamase superfamily than the amino domain. Additional annotations: the flexible arm (FA) is found only in the amino domain (N-Domain) of tRNase ZL and N-Domain and C-Domain are linked by a flexible tether.

No experimental tRNase ZL structures have been reported, and important functional characteristics of tRNase ZL, especially those of the more diverged amino domain and the tether, cannot be deduced from available tRNase ZS structures. Alternative biophysical means for investigating tRNase ZL are therefore needed.

Investigation of tRNase ZL by proteolysis, electrophoresis and mass spectrometry

Endoproteinases cleave adjacent to a specific amino acid residue at regions on the surface of a protein that are solvent-exposed and flexible enough to fit the active site geometry of the protease [24]–[26], typically 8 to 10 residue stretches of the native protein. Such flexible regions generally occur in loops or secondary structure elements capable of unfolding [24]–[28]. Initial cleavages, before tertiary structure of the protein deteriorates, occur in the flexible regions, and stable domains are more resistant to proteolysis. Flexible regions determined by limited proteolysis and mass spectrometry correlate with polypeptide disorder as determined by NMR [29], X-ray crystallographic B-factors [27], [30], fluorescence spectroscopy [31], circular dichroism spectroscopy [31] and computational molecular dynamics [27].

Limited proteolysis fragments can be analyzed using a combination of gel electrophoresis, amino acid analysis and N-terminal sequencing [27], [29], [31]. The advent of high-resolution protein mass spectrometry enabled precise protease site mapping [30]–[32]. Linear mode matrix-assisted laser desorption/ionization – Time-of-Flight (MALDI- TOF) analysis [33], [34] is well-suited for the mass determination of moderate to large polypeptides such as tRNase Z proteolysis products because of its practically unlimited mass range, and is complementary to gel electrophoresis because it produces accurate molecular weights of these proteolysis products with higher resolution and precision, while electrophoresis is better for quantification of relative polypeptide abundance.

To investigate domain structure and flexibility of tRNase ZL, we subjected D. melanogaster and H. sapiens tRNase ZL to limited tryptic proteolysis and analyzed the products by one- and two-dimensional gel electrophoresis and MALDI-TOF mass spectrometry. 2D gels resolve roughly an order of magnitude more spots than 1D gels, relieving issues of heterogeneous bands (1D SDS-PAGE) and spectral crowding (MALDI-TOF).

Protease accessible regions fall within specific regions in tRNase ZL. Cleavage in the inter-domain tether unlinks the protein into stable domains, consistent with tandem duplication. The region in and around the flexible arm is accessible. Hydrophilic regions close to both termini are highly flexible. A similar domain structure is observed for H. sapiens tRNase ZL.

Theoretical tryptic digestion of tRNase Z produces 3,081 polypeptides. 2D electrophoresis resolves about 6 families averaging 5–10 spots of related polpypeptides each, resulting in ∼60 species, representing <2% of the potential. Limited proteolysis thus indeed generates stable domains from cleavage in flexible regions.

The analysis was extended by probing functionally deficient tRNase Z sequence variants and by using proteases with complementary specificity. Flexibility of the inter-domain tether, first observed here, may contribute to greater catalytic efficiency of tRNase ZL over tRNase ZS.

Materials and Methods

Protein preparation

Fruit fly tRNase Z with an N-terminal 6× His tag was baculovirus-expressed and affinity purified using nickel-chelate resin (Qiagen) as previously described [21]. Protein was expressed from an internal methionine (M24AAT) that is taken to be the translation start for the nuclear form of fruit fly tRNase Z, two residues before the predicted amino end of the mitochondrial form after import and cleavage [16], and is thus numbered M1 throughout. Removing the His-tag using rTEV protease (Invitrogen) leaves a 7 residue leader (GAMDPEF) which was added to the tRNase Z for interpretation of masses in the spectra.

Approximately 500 µg of native tRNase Z was further purified by gel filtration using a Superose 6 10/300 GL column at 4°C on the Akta Purifier 10 platform (GE Life Sciences) using 250 mM KCl, 25 mM Tris-HCl pH 7, 1 mM DTT as column buffer. Ovalbumin, bovine serum albumin and alcohol dehydrogenase were used as size standards. Peak fractions were pooled and concentrated using a 10 kD NMWL microconcentrator (Millipore). Proteins were analyzed using 1D SDS-PAGE with a 10% polyacrylamide separating gel and a 4% stacking gel with Tris-Glycine buffers containing 0.1% SDS. Gels were stained with Sypro orange (Molecular Probes) and scanned with a Typhoon 9210 (GE Life Sciences).

Processing analysis

The sample applied to the column, gel filtration fractions and the concentrated pooled eluate were assayed for tRNase Z activity using a 5′-endlabeled fruit fly pre-tRNAArg substrate [35]. Gel lanes (Figure 2C) were scanned with a Typhoon 9210 and peak areas were obtained using ImageQuant. Enzyme specific activity was estimated by dividing % product/minute of reaction by enzyme concentration (estimated from the protein gel lanes compared with the BSA standard; Figure 2B).

Figure 2

tRNase Z purifies as a monomer.

(A) Affinity purified D. melanogaster tRNase Z was separated by SEC using a Superose 6 10/300 GL column on the Akta Purifier 10 platform (GE Life Sciences). Symbols above the absorbance profile indicate elution peaks for Ovalbumin (45 kD), BSA (66 kD) and Alcohol Dehydrogenase (141 kD). tRNase Z (green triangles) chromatograms as a monomer true to its ∼84 kD molecular weight. * identifies a shoulder in the chromatogram coinciding with expected position of the tRNase ZL dimer which is apparently low in quantity and enzyme activity. Lines beneath axis indicate peak fractions. B) Protein gel. UF: Unfractionated tRNase Z. Pool – peak fractions were pooled and concentrated. C) Processing assay of three peak fractions compared with UF indicates that gel filtration improves enzyme specific activity. Each fraction was incubated with end-labeled substrate for 15 min. and electrophoresed on a denaturing polyacrylamide gel. S, P at right designate the 90 nt D. melanogaster pre-tRNAArg substrate and 73 nt product, respectively. Lane 0: no processing control.

Protease digestion, 1D electrophoresis and mass spectrometry

12 µg of pooled concentrated D. melanogaster tRNase Z SEC eluate was digested with 0.167 ng/mL trypsin (Promega; a 1,200∶1 tRNase Z: trypsin mass ratio) at 37 C in 60 µL of 50 mM ammonium bicarbonate pH 8. For H. sapiens tRNase ZL, twice the trypsin concentration was used. Reactions were sampled before addition of trypsin and after 1, 2, 5, 10, 15 and 30 min of reaction. At each time point, 3 µL samples were transferred to protein gel loading buffer for 1D SDS-PAGE and 2 µL samples were transferred to 1 µL of 1% TFA to inactivate trypsin. Samples for mass spectrometry were further mixed in a 1∶1 ratio with a saturated solution of recrystallized α-cyano-4-hydroxycinnamic acid (CHCA, Sigma) in 50% formic acid/33% isopropyl alcohol/17% water (v/v/v; Fisher, all HPLC grade or higher) and prepared for matrix-assisted laser desorption/ionization (MALDI)-time of flight (TOF) mass spectrometry using the ultra-thin method essentially as described [36], [37]. Procedures for protease digestion with endo LysC (Roche) and GluC (Roche or New England Biolabs) were the same as for trypsin except that GluC was used at 83 ng/µL.

Spectra from 10–90 kD were taken using a Waters MaldiMX with suppression set at 9,000. Bovine serum albumin (66,430 DA; Sigma) was used as a mass standard. Full length tRNase Z has a mass of 83,671 Da from the 7 residue leader through M1AAT (see above) to T743. Some tRNase Z is observed with ∼3 kDA larger mass (86,640 Da) due to incomplete rTEV digestion which leaves an additional 23 residue leader (MSYYHHHHHHDYDIPTTENLYFQ; 2986 Da) from the Fastbac vector. Protein Analysis Worksheet (PAWS; Genomic Solutions, Inc.) was used with observed masses from the spectra and known sequence to collect the interpreted cleavage products with their calculated masses.

2D Electrophoresis and mass spectrometry

D. melanogaster and H. sapiens tRNase ZL samples were treated with trypsin and sampled at various times as in preparation of samples for 1D electrophoresis and MALDI-TOF. 2D electrophoresis was performed with first dimension isoelectric focusing (IEF) in a mixture of pH 3–10 and 5–8 ampholytes using a mini-tube gel system (BioRad). Second dimension SDS-PAGE was performed as for 1D SDS-PAGE. 2D gels were stained with Sypro Orange using Method 2[38] by fixing in 0.0005% SDS, 2% acetic acid, 40% ethyl alcohol, washing twice in 0.0005% SDS, 2% acetic acid, staining twice with Sypro Orange in 0.0005% SDS, 2% acetic acid, rinsing briefly in 0.0005% SDS, 2% acetic acid and scanning with a Typhoon 9210.

Representative polypeptide spots >30 kDa were excised from the 2D gels and subjected to exhaustive in-gel tryptic proteolysis, generally to peptides with molecular weights <4 kDa. These peptides can be analyzed by mass spectrometry using higher resolution single-stage MS to obtain peptide mass maps of each limited proteolysis product, as well as tandem MS (MS/MS) to confirm peptide sequence, both using MALDI-ion trap mass spectrometry. Sensitivity of the MALDI-ion trap mass spectrometry instrument in MS/MS mode [39], [40] allows identification of low abundance polypeptides at the boundaries of the limited proteolysis polypeptides, and the offline, stable nature of MALDI samples allows multiple rounds of interrogation for the manual interpretation of data.

Results

The long form of tRNase Z (tRNaseZL) from D. melanogaster and H. sapiens share a domain structure with the short form (tRNase ZS). Both amino and carboxy domains display homology to the β-lactamase family of metal-dependent hydrolases (Figure 1, adapted from NCBI Domain Search with additional annotation). It was suggested in 2001, and extensively supported since, that tRNase ZL arose as a tandem duplication of tRNaseZS with subsequent divergence of the two domains [22]. The distinctive flexible arm of tRNase Z was retained by the amino domain [7] and the metal-binding residues and active site were retained by the carboxy domain.

Native tRNase ZL purifies as a monomer

While tRNase ZS is a homodimer, domain structure of tRNase ZL suggests that it functions as a monomer. Size exclusion chromatography (SEC) of native soluble tRNase ZL shows a major absorbance peak at the position expected for monomeric tRNase ZL (∼84 kDa) relative to size standards (Figure 2A) which coincides with the protein and processing activity peaks (Figure 2B, C). The precise molecular weight was confirmed by MALDI-TOF mass spectrometry (see below). A minor peak (∼168 kDA; * above chromatogram in Figure 2A) corresponds in position to a tRNase ZL dimer. SEC fractions display greater specific activity than unfractionated tRNase Z, presumably due to removal of trace inhibitors. Aggregated tRNase Z in the small void volume peak is practically inactive.

Stable domains and flexible regions detected by limited proteolysis

To investigate stable domains and flexible regions, peak fractions of monomeric D. melanogaster tRNase Z (brace below Figure 2B) were pooled, concentrated and subjected to limited proteolysis at a ∼1,200∶1 mass ratio of tRNase Z to trypsin (see Methods) followed by electrophoresis on protein gels and analysis by mass spectrometry (Figure 3). Sequence, domain structure, functional motifs [5]–[11], [13]–[16], [21]–[23], [35], [41], [44] and predicted secondary structure of D. melanogaster tRNase Z are presented in Figure 4 with trypsin cleavage sites indicated by vertical arrowheads and more fully described in Supplement (including the multiple sequence alignment in Supplemental Figure SF2 in File S1). MALDI-TOF results are complemented by 2D gel electrophoresis (isoelectric focusing, then SDS-PAGE; Figure 5) followed by mass spectrometric analysis of the gel spots (Figure 6, Table 1).

Figure 3

Trypsin digestion of purified tRNase Z followed by mass spectrometry shows the main stable domains and flexible regions.

A) Protein gel lanes illustrate extent of digestion of D. melanogaster tRNase Z by trypsin. Colored dots (red, orange, blue, magenta and green) indicate full length tRNase Z and the tryptic fragments arising from cleavage at Nflex, FA, Ndom-tether and Cend. B) Spectra obtained by mass spectrometry of the samples illustrated in (A). MALDI-TOF was performed using a Waters MaldiMX. Representative masses are presented on the spectra and the complete table (mass observed, mass calculated, ppm error and theoretical pI) is presented in Supplementary Table ST1.

Figure 4

Sequence and predicted secondary structure of D. melanogaster tRNase Z (Psipred).

Large rectangular enclosures indicate amino domain, tether and carboxy domain. Dashed rectangular enclosures indicate functionally characterized motifs (discussed in detail and further annotated with a multiple sequence alignment in Supplemental Figure SF2 in File S1).

Figure 5

Two dimensional gel electrophoresis of D. melanogaster tRNase Z-trypsin polypeptides.

A three min. digest like those illustrated in Figure 3 was electrophoresed on a first dimension isoelectric focusing tube gel. The second dimension SDS-PAGE was the same as in Figure 3.

Figure 6

Maldi-ion trap mass spectra of exhaustive in-gel trypsin digest products.

Spots were excised from the two dimensional gel (Figure 5). (A) Full length D. melanogaster tRNase Z. (B) A representative Cdom2 partial proteolysis polypeptide. Start and end residue numbers are indicated for all peaks that can be positively assigned to tRNase ZL tryptic peptides. See table 1 for details. Peptides present in both samples are labeled in black; those present in the full length protein but not Cdom2 are labeled in red.

Table 1

D. melanogaster tRNase Z Peptide Analysis.

First	Last	MW	Sequence
N 1	9	1609.8	GAMDPEFMAATIASAK
10	16	754.4	DPLTGPR
17	25	1174.6	YEREPNVLR
27	60	3383.8	KLASVVPGTVNLQVLGSGANGAPAAVYLFTDQAR
28	60	3255.7	LASVVPGTVNLQVLGSGANGAPAAVYLFTDQAR
61	71	1357.6	YLFNCGEGTQR
72	77	733.4	LAHEHK
83	112	3272.7	LEQIFLTQNTWASCGGLPGLTLTIQDAGVR
113	130	1945.0	DIGLHGPPHLGSMLQSMR
131	136	760.5	RFVVLK
132	136	604.3	FVVLK
137	157	2479.2	NLQVRPNDCSEGACFEDSILK
158	171	1526.8	VDSLPLINSEDPTK
172	183	1503.8	SVINYICQLKPR
192	207	1704.9	CVEQGVPPGPLLGQLK
222	254	3548.8	SVDVTEASETALSFVFLDVPSENYLPALLTHGK
286	316	3456.6	DFVVESFSSEAQHIYLSSPLNQFSGYAAAHR
317	348	3682.0	IQHQLHQLAPQVFPLLGEQLSCQSQTLSLNLK
365	384	2314.1	ANETEEQGVVAMTNYHLRPR
403	416	1523.8	ETHAVPGFLELLAK
417	433	2022.9	FKEEYSFPDNSADSYPK
449	456	900.5	NVSSILIR
457	477	2327.2	TAIDAYVLLDCGEGTYGQIVR
490	512	2603.4	QLQAIYVSHLHADHHIGLGLL
515	520	796.5	RQLKPR
521	530	1077.7	ADPLILLAPR
531	541	1493.7	QIEPWLEFYNR
542	570	3116.6	QIETVEDAYTLVGNGELLASPLSGEQVER
571	582	1332.7	LGITSISTCLVR
583	597	1628.8	HCPNSFGISLTLAAK
605	622	2068.0	ITYSGDTMPCQDLIDLGR
623	642	2302.0	DSTVLIHEATMEDDLEEEAR
643	657	1652.9	LKTHSTVSQAIQQGR
645	657	1411.7	THSTVSQAIQQGR
658	662	604.4	NMNAR
663	672	1238.7	HTILTHFSQR
679	687	1089.5	LPSDEDMQR
688	707	2372.2	VAIAFDNMEVTIEDLQHYHK
708	726	2336.1	LYPALFAMYAEYTEELEQR

Tryptic Peptides from 2D gel spots were analyzed by MALDI-Ion trap MS. All peptides listed are found in full length tRNase Z.

Bold: Ndom and tether peptides are found in full length tRNase Z but not in Cdom2 region.

Italic: Absence of peptide 365–384 from Cdom2 defines the amino boundary of the Cdom2 polypeptide.

First seven residues are leader following TEV site.

Before the addition of protease (0 min in Figure 3A), the major band in the tRNase Z preparation displays an apparent molecular weight relative to known markers above 85 kDa, consistent with anomalously slow migration observed earlier [11]. Heterogeneous groups of protein bands appear after 3 minutes and are maintained through 15–30 minutes of digestion (identified by colored circles at right in Figure 3A based on size and other evidence presented in detail below). MALDI-TOF analysis of tRNase Z proteolysis products (Figure 3B) yields major m/z peaks consistent with these size classes of polypeptides (Figure 3A).

Masses obtained by mass spectrometry are not subject to the discrepancy between apparent molecular weight of tryptic polypeptides relative to marker proteins observed in gel electrophoresis. Because of high mass resolution obtained by MALDI-TOF, peaks can be assigned to specific polypeptides (see Supplemental Table ST1 and Table 2 in File S1). Prior to trypsin addition (Figure 3B, 0 min), the mass spectrum contains two major peaks that correspond to the singly (1+) and doubly (2+) protonated mass-to-charge (m/z) values of full length D. melanogaster tRNase Z. Because BSA and its multiply protonated species were used for mass calibration, more reliable masses are sometimes achieved using the 2+ ion of tryptic polypeptides whose mass is greater than BSA (see Methods). The calculated mass of tRNase Z is 83,671 Da; the observed mass of the more intense 2+ peak is 83,708 Da. A small peak with m/z  = 55,945 Da, consistent with a triply ionized tRNase Z dimer, decreases in intensity with increasing time of reaction; while generally present, its intensity is lower with conservative pooling of SEC fractions.

Table 2

D. melanogaster tRNase Z – Trypsin Polypeptides.

	Observed Polypeptide	Cleavage Sites		Theoretical MW	Theoretical pI	MALDI-TOF Peaks1
		N-End	C-End
Full Length	N – Cend	N	K 729 RELKQERKRKLAET	81,904–83,671	6.03–6.32	81,892–83,708
Flexible Amino End	Nend – Cend	KD10-RY17-RE20	K 729 RELKQERKRKLAET	80,066–81,904	6.03–6.32	80,121–81,892
	Nflex – Cend	RK 26 KL	K 729 RELKQERKRKLAET	78,161–80,184	5.97–6.25	78,208–80,121
Carboxy End Truncation	Nend – CTr	N	R 662	73,918	6.15	73,960
	Nflex – CTr	RK 26 KL	R 662	70,131–70,387	6.08–6.21	70,280
Flexible Arm	FA1 – Cend	RA184	K 729 RELKQERKRKLAET	61,220–62,987	5.78–5.96	60,487–61,378
	FA2 – Cend	KC192	K 729 RELKQERKRKLAET	60,453–62,220	5.72–5.90	60,487–61,616
	FA3 – Cend	RS222	K 729 RELKQERKRKLAET	57,356–59,123	5.71–5.89	57,471–59,121
Amino End Truncation	Nint – Cend	KRLKKL259	K 729 RELKQERKRKLAET	53,297–55,590	5.79–6.11	53,445
Amino Domain DomainTether	Nend – Ndom1	RY17	K 402	42,589	6.94	ND*
	Nflex – Ndom2	RK 26 KL	R 384 KG	39,087–41,237	6.48–7.30	39,062–40,061
	Nflex – Ndom3	RK 26 KL	K 348 KTKL	35,044–35,658	7.72–8.42	35,416–35,508
Carboxy Domain	Cdom1 – Cend	KK 349TKL	K 729 RELKQERKRKLAET	43,135–44,902	5.56–5.80	43,121–44,790
	Cdom2 – Cend	RK 385G	K 729 RELKQERKRKLAET	38,964–40,860	5.64–5.90	39,227–40,061
	CdomTr	RK 385G	R 642LK, R 657, R 662	28,756–31,106	5.30–5.71	28,754–31,107

Interpretation of limited proteolysis products is based on gel electrophoresis (Figures 3A and 5) and mass spectrometry (Figures 3B and 6).

from Figure 3B and Supplemental Table ST1 in File S1.

An amino end at D10 producing a polypeptide with mass 43,225 DA and pI 6.96 could be assigned from the mass 43,208 Da obtained by MALDI-TOF.

Peaks of lower mass in the 80, 60, 45, 40 and 35 kD regions increase at the expense of full length protein with trypsin incubation time, as in the gel lanes. Representative peak masses are labeled in Figure 3B; matching polypeptides are assigned in Supplemental Table ST1 in File S1 along with detailed interpretation in Supplemental text in File S1. The 52.5 – 67.5 kDa mass region (enclosed in dashed vertical lines in Figure 3B), where polypeptides originating from cleavage in the FA are expected, was expanded 2.5-fold on the y-axis.

tRNase Z polypeptides cannot be unambiguously identified by linear mode MALDI-TOF alone because of peak heterogeneity from theoretical molecular weights too close to be resolved and due to overlap with the +2z region. Interestingly, some peaks arise from a mixture of amino and carboxy domain polypeptides (green and magenta circles, respectively) with almost identical masses (see Supplemental Table ST1 in File S1 for examples).

The major size classes of limited proteolysis polypeptides are separated into clusters of spots (Figure 5) using two-dimensional gel electrophoresis (isoelectric focusing followed by orthogonal SDS-PAGE). Important ambiguities in the 1D SDS-PAGE and MALDI-TOF results (Figure 3, Supplemental Table ST1 in File S1) were resolved. In particular, Ndom polypeptides have a higher pI, and Cdom polypeptides have a lower pI, than full length tRNase Z (Figure 5, Supplemental Table ST1 in File S1). Additionally, smaller polypeptides including major Ndom and Cdom species in the 39–42 kDa range which overlap with doubly protonated, higher molecular weight species (Figure 3B) are readily visualized on 2D gels.

Closely spaced spots fall into practically horizontal tracks (enclosed in elongated ellipses in Figure 5), suggesting polypeptide families with incremental charge and mass differences produced by cleavages at clusters of basic residues at both ends. These families are shown below to be cleaved at or N-terminal to a basic patch close to the amino end (Nflex­, red), from amino end or Nflex to a truncation site in the carboxy domain (CTr, orange), from the flexible arm into the carboxy domain (FA region, blue), and specific to the amino (Ndom, green) and carboxy (Cdom, magenta) domains with varying amounts of tether attached.

The D. melanogaster Cdom2 family (Figure 5) has more than 10 spots in a slightly oblique track (pI decreases with mass). This large family can be explained (Supplemental Table ST2 in File S1) by trypsin cleavage in tether (R 384 KG; potential cleavage sites underlined) and in a basic patch close to the carboxy end (Cend; K 729 RELKQERKRKLAET743). The predicted spots with highest mass and pI (Supplemental Table ST2 in File S1) are K385–T743 (40,860 Da; 5.90) and K385–K739 (40,445 Da; 5.99); the lowest is G386–K729 (38,964 Da; 5.55).

The interpretation is supported by MALDI-trap peptide analysis of polypeptide spots extracted from full length D. melanogaster tRNase Z (with coverage illustrated in Supplemental Figure SF3 in File S1) and Cdom2 spots (Figure 6, Table 1). The amino boundary of Cdom2 polypeptides must not come before R382P383RK385 because the peptide A365NETEEQGVVAMTNYHLRPR384 observed in full length tRNase Z (underlined in Figure 6A, italic in Table 1) was not found in the Cdom2 spots. Polypeptide analysis does not rule out amino ends at T390 and L395, however; faint parallel tracks observed below the main track of the Cdom2 family (Figure 5) are consistent with the 500–1,000 Da reduced mass predicted for polypeptides that begin in tether several residues closer to the C-end.

Analytical methods described in detail for the Cdom2 region were applied to other families consisting of intense resolved spots from the 2D gel (enclosed in colored ellipses in Figure 5) with results presented in Table 2 (additional detail provided in Supplement). Polypeptides are identified by the following procedures: (1) Preliminary assignments with high mass accuracy are made using MALDI-TOF spectra (Figure 3B, Supplemental Table ST1 in File S1). (2) Relative molecular weight and pI information from the 2D gel (Figure 5) is combined with predicted molecular weights and pIs (Supplemental Table ST1 in File S1) and by modeling as for Cdom2 polypeptides (Supplemental Table ST2 in File S1) based on sequence. (3) Boundaries are established for polypeptides from the 2D gels by peptide analysis (Figure 6, Table 1, Supplemental Table ST3 in File S1and Supplemental Appendix S1).

The largest trypsin cleavage products (N–Cend) arise from cleavage within a hydrophilic flexible region close to the carboxy end (Cend) as described above for Cdom2. The observed reduction in pI with mass (predicted 6.32–6.03; see Table 2) is due to Cend trimming of 3 more basic than acidic residues.

Shortening from the amino end of tRNase Z (KD10–RY17–RE20) culminates in a hydrophilic basic patch (R 25 KKL) designated Nflex which, accompanied by Cend trimming, produces the Nflex-Cend family. The predicted mass range (78,161–81,904 Da) is consistent with observation (Figures 3, 5 and Table 2).

Truncation within the carboxy domain (CTr) by cleavage at an internal site (R662) produces two polypeptides, from Nend and from Nflex, with masses around 74 and 70 kDa, respectively. While clearly resolved on gels (Figures 3A and 5), these species display low intensity in the spectra (Figure 3B). The characteristic ∼4 kDa spacing between Nend/Nflex, repeated below in two tracks of CTr polypeptides, suggests that a strong stop at Nflex (R25KKL) dominates the gradual trimming from the amino end (KD10–RY17–RE20–RK26).

The tRNase Z FA consists of a globular hand (two α helices connected by a GP-rich loop, two antiparallel β strands and a turn of 3/10 helix; α4α5GPLβ10β11η following the numbering of B. subtilis tRNase ZS secondary structure elements [5]) extruded from the body of the enzyme by a structured stalk (Supplemental Figures SF1, SF5 in File S1; cf [5]). Three main cleavage sites were found in the FA region: RA184 in the ascending stalk and KC192 and RS222 in the FA hand (in α4 and just after β11, respectively; see Figure 4 and Supplement for annotation and additional structural detail). Heterogeneity of mass (from ∼57.5 to ∼61.5 kDa) and pI arises due to Cend trimming as described above. Taking into consideration the anomalously slow migration relative to known markers, the tracks in the FA family enclosed in ellipses (Figure 5) are consistent with the three main classes of peak masses observed in MALDI-TOF spectra (Figure 3B, Supplemental Table ST1 in File S1).

A weaker track of bands that appears at lower apparent molecular weight and higher relative pI just below the FA ellipse is consistent with the Nint-Cend species (amino end K258KL) found in the MALDI-TOF spectra (peaks detected at 53,429–53,445–54,551 Da; theoretical pI around 5.8; Supplemental Table ST1 in File S1, Table 2). The lower intensity of these polypeptide species in both the gel and the MALDI-TOF spectra suggests these to be lower protease accessible/flexibility regions.

The amino domain (Ndom) region displays Ndom1, Ndom2, Ndom3 sub-families which increase in pI with decreasing mass, depending mainly on the length of retained tether. Ndom3, the smallest stable species, begins at Nflex (R 25 KKL) and ends at the Ndom-tether boundary (K 348 KTK), supported by polypeptide species K27–K351, K26–K349 and L28–K351 from MALDI-TOF in the 35,416–35,508 Da mass and 7.72–8.16 pI range (Figure 3B, Supplemental Table ST1 in File S1, Table 2) and by boundaries established by peptide analysis (Supplemental Table ST3 in File S1). Ndom2, like Ndom1, begins at Nflex, but ends further into tether at R384K, coinciding with the amino end of Cdom2 (Tables 1 and 2). Corresponding polypeptides obtained from MALDI-TOF (Figure 3B, Supplemental Table ST1 in File S1) are L28–R384 (39,062 Da, 6.48 pI), K26–R384 (39,227 and 39,372 Da, 6.93 pI) and K27–K385 (40,061 Da, 7.3 pI). Peptide analysis (Supplemental Table ST3 in File S1) establishes consistent boundaries.

The amino end of Ndom1 is at Y17 and its carboxy end is between K385 and K402 based on relative pI and apparent molecular weight (Figure 5) and peptide analysis (Supplemental Table ST3 in File S1), with a predicted mass of 42,589 Da and pI of 6.94 for the Y17–K402 species (Table 2). A corresponding peak was not observed in the MALDI-TOF spectra, however. Likewise, masses of 43,208 and 44,790 Da observed by MALDI-TOF (Figure 3B, Supplemental Table ST1 in File S1), corresponding to Ndom with trypsin cleavages at K416, K418, and K433 closer to or at the carboxy end of tether, were not confirmed by peptide analysis of Ndom1 polypeptides from 2D gel spots. Heterogeneity within the Ndom1 family and peptides sometimes too faintly detected to establish firm boundaries may explain this discrepancy between characterization of Ndom1 polypeptides by 1D and 2D methods.

Like Ndom, the Cdom family is divided into sub-families based on the length of tether retained. The amino end of Cdom1 is at the Ndom-tether boundary (K 348 KTKL). The amino end of Cdom2 (characterized above; Figure 6, Table 1) is at the major flexible site within tether (R 384 KG). Cdom species with little or no tether was not found; on the other hand, spots derived from Cdom2 were truncated within the carboxy domain (CdomTr) at three possible internal sites (R 642LK, R 657, R 662). Smaller polypeptides observed on 1D and 2D gels were not analyzed, as stable domain polypeptides unfold with decreasing size, exposing secondary cleavage sites.

D. melanogaster tRNase Z variants and use of other proteases

Deletion of the FA of D. melanogaster tRNase Z causes a nearly two order of magnitude increase in K m for tRNA processing with little effect on k cat, and the single substitution L187A at the boundary between the ascending stalk and the globular hand of the FA has almost the same effect [11]. These variants were therefore analyzed by limited proteolysis with trypsin and MALDI-TOF (Supplemental Figure SF4 and Supplemental Tables ST3 and ST4 in File S1). Detailed effects of tRNA binding on the FA of B. subtilis tRNase Z8, cf 5 are illustrated in Supplemental Figure SF5 in File S1. Wild type D. melanogaster tRNase Z was digested with endoproteinase LysC, which cleaves after lysines, and GluC, which cleaves after glutamates, followed by MALDI-TOF analysis (Supplemental Figure SF6 and Tables ST6 and ST7 in File S1).

H. sapiens tRNase ZL

Because of differences in domain size and tether length between D. melanogaster tRNase Z and H. sapiens tRNase ZL (Figure 1, cf Figures 4, 7), protease/MS spectra (Figure 8), 2D electrophoresis patterns (Figure 9) and polypeptide identification (Table 3, Supplemental Tables ST8, 9 in File S1) obtained from H. sapiens tRNase ZL help evaluate the conservation of stable domains and flexible regions observed in D. melanogaster tRNase Z. A five residue leader (GAMGS) after TEV protease cleavage of the His-tag is followed by H. sapiens tRNase ZL from G50 ( in Figure 7; see17). The major peak at 86,997 Da in the spectrum (Figure 8, Table 3, Supplemental Table ST8 in File S1) corresponds to the TEV cleaved product of H. sapiens tRNase ZL (calc. 87,014 Da). A weak peak corresponds to tRNase ZL with the uncleaved leader (mass observed 89,834 Da; calc. 89,854 Da).

Figure 7

Sequence and predicted secondary structure of H. sapiens tRNase ZL (Psipred).

Enclosed regions Ndom, Tether and Cdom and annotation of functional motifs are as in Figure 4. Polymorphisms and isoforms (identified by enclosure in blue circles and orange ellipses, respectively) are described in detail in Supplement.

Figure 8

H. sapiens tRNase ZL displays flexible regions like those in D. melanogaster tRNase Z.

H. sapiens tRNase ZL was expressed from G50 as previously described [17]. A) SDS-PAGE is the same as in Figure 3A. B) Presentation of the spectra and labeling of peaks is as in Figure 3B. The complete table is presented in Supplementary Table ST8.

Figure 9

Two dimensional gel electrophoresis of H. sapiens tRNase ZL-trypsin polypeptides.

A ten min. digest like those illustrated in Figure 5 was electrophoresed on a first dimension isoelectric focusing tube gel. The second dimension SDS-PAGE was as in Figure 5.

Table 3

H. sapiens tRNase ZL – Trypsin Polypeptides.

	Observed Polypeptide	Cleavage Sites		Theoretical		MALDI-TOF
		N-end	C-end	MW	pI	Peaks
Full Length	Full Length	N	Q826	86,997	6.62	87,004
Flexible Carboxy End	Nend – Cflex	N	R 781 REKRELR	82,844	6.53	82,818
	Nflex – Cflex	RD69	R 781 REKRELR	79,629–80,597	6.33–6.46	ND
Amino End Truncation	NTr – Cend	RR 191GKH	KK 822VRAQ	70,683–71,025	6.40–6.55	ND
	NTr – Cend	RR 191GKH	KR 812	69,108–69,450	6.31–6.45	ND
	NTr – Cflex	RR 191GKH	R 781 REKRELR	65,695–67,203	6.24–6.53	66,258; 66,680
Flexible Arm	FAJ – Cend	RR 232G	KR 812AHTEEPQAKKVRAQ	64,399–66,286	6.24–6.49	65,556–66,291
	FAJ – Cflex	RR 232G	R 781 REKRELR	60,983–62,491	6.16–6.47	61,538; 61,907
	FA1 – Cend	KA259 KE	KR 812AHTEEPQAKKVRAQ	60,453–62,220	5.72–5.90	61,538
	FA2 – Cflex	RS283	RREKR 785	56,354	5.93	56,342
		RE290	ELRQVR 791	56,355	5.97
Amino Domain	Ndom1	RD69	K 476 R 477	45,851–46,007	6.75, 6.99	ND
			R 464 R 465	44,642–44,798	6.75, 6.99
	Ndom2	N	RCKK 407	39,774–40,133	6.99–7.74	40,150
Carboxy Domain	Cdom1 – Cflex	RCKKE408	RREKR 785	41,735–42,664	5.89–6.26	41,748
	Cdom2 – Cflex	RR 465S	RREKR 785	34,848–35,574	5.95–6.25	35,551
			ELRQVR 791	35,816–36,356		35,802; 36,218
	Cdom2 – Cflex	KRS478	RREKR 785	33,640–34,366	5.95–6.25	ND
	CdomTr	RR 465S	K 751	31,471; 31,627	6.35; 6.23	ND
	CdomTr	KRS478	K 751	30,419; 30,263	6.35; 6.22	ND

Interpretation of limited proteolysis products is based on gel electrophoresis (Figures 8A and 9) and mass spectrometry (Figures 8B and ST9).

Most peaks observed in the spectra (Figure 8) correspond to polypeptides that fit the designations developed for D. melanogaster tRNase Z (yellow highlighting in Supplemental Table ST8, cf ST1 in File S1). Cleavage was observed at R68 close to the amino end (Nflex) and in tether, FA, and in the C-terminal tail (Table 3, cf Table 2).

Several peaks also arise from cleavage at a basic patch on the amino side of the H. sapiens tRNase ZL FA referred to as NTr (truncated in amino domain at R 190 RGK; Table 3, Supplemental Table ST8 in File S1). A tryptic fragment in H. sapiens tRNase ZL beginning at R231 at the base of the ascending stalk referred to as FAJ (for example, a peak at 66,291 Da in the 30 minute time point interpreted as R232–Q826, calc. 66,286 Da; Figure 8, Supplemental Table ST8 in File S1) corresponds in position to a LysC cleavage in D. melanogaster tRNase Z (Supplemental Table ST6 in File S1) but was otherwise not prominently observed in D. melanogaster tRNase Z. These two basic flexible patches demarcate the boundaries encoded by exon 7 of H. sapiens tRNase ZL. Isoform 3 of H. sapiens tRNase ZL arises from skipping of exon 7, causing deletion of 40 residues41 (orange ellipse in Figure 7).

Cleavage in the FA hand of H. sapiens tRNase ZL, but not the stalk, is observed at K 258AKE, K282 and R289. A peak at 61,538 Da in the 15 min spectrum, for example, corresponds to A259–K811 with the correct pI [5.95], mass calc 61,504 Da; 56,342 Da in the 30 minute time point corresponds to the tryptic fragments S283–R785, calc. 56,354 Da, and E290–R791, calc. 56,355 Da, which cannot be distinguished from each other by mass or pI.

Two main Ndom species and two main Cdom species were observed. Prominent cleavages that demarcate amino and carboxy domains in H. sapiens tRNase ZL include a basic patch in the amino domain proximal to tether (R 404CKK), just as the accessible 348–351 basic patch in D. melanogaster tRNase Z is found on the amino side of tether (Figure 3–5). For example, a peak in the 10 minute spectrum at 47,261 Da corresponds to the proteolytic product C405–Q826, calc. 47,241 Da. Isoform 2 of H. sapiens tRNase ZL (deletion of K406 or K407 within the flexible region at the Ndom-tether boundary; orange circle in Figure 7) arises from slippage at the exon 13–14 splice junction [41].

Cleavages distributed through tether in H. sapiens tRNase ZL include R 464 RS and K 476 RS (Figures 8, 9 and Supplemental Table ST8 in File S1), similar to the R 384 KG region in D. melanogaster tRNase Z. Additionally, CdomTr arises from cleavages in tether at R 464 RS or K 476 RS and within the carboxy domain at K742, K751, K762 or K769 (Figure 9 and Supplemental Tables ST8, ST9 in File S1).

The polypeptides whose ends define the stable domains and flexible regions in H. sapiens tRNase ZL, like those from D. melanogaster tRNase Z, fall into families when separated by two dimensional electrophoresis (Figure 9). Relative pI and apparent relative masses for the major polypeptide families and thus relative positions on the 2D gels are strikingly similar for these two long form tRNase Z species, with comparable coverage of the spots by mass spectrometry (Supplemental Figure SF9; cf SF3 in File S1; Appendix S2). Less heterogeneity is observed in the isoelectric focusing dimension, however, and a several-fold higher combination of trypsin concentration and incubation time are required for a comparable distribution of cleavage polypeptides with H. sapiens tRNase ZL than with D. melanogaster tRNase Z.

Ndom2 and Cdom1, the most prominent Ndom and Cdom species, display a reversal of apparent relative molecular weights on the 2D gels. Ndom2 migrates slower than Cdom1 by SDS gel electrophoresis, while mass spectrometric methods show Cdom1 and Ndom2 to have masses in the 42 kDa and 40 kDa ranges, respectively; this discrepancy could be due to the higher pI of Ndom than Cdom polypeptides, consistent with the observation that positively charged proteins such as Ribonuclease A and histones migrate anomalously slow on SDS gels.

Conserved characteristics of the tether

Tether length, position and flexibility appear to be conserved between D. melanogaster tRNase Z and H. sapiens tRNase ZL. The carboxy boundary of the amino domain proximal to tether is demarcated by a conserved sequence block [41] designated Ndom-Tprox (Figure 10). A hydrophilic region at the Ndom-tether boundary (Figures 4 and 7; sequence enclosed in small bold rectangles in Figure 10 and Supplemental Figure SF2 in File S1) is similar to the hydrophilic patches close to the carboxy ends of metazoan tRNase ZLs. The carboxy boundary of tether and start of the alignment between Cdom and tRNase ZS is marked by a conserved proline (S in Figures 4, 7; identical in 3/5 species in the full length alignments in Supplemental Figure SF2 in File S1and in 19/26 species in the alignment of metazoan tRNase ZLs [41]).

Figure 10

Tether alignments.

The long form of tRNase Z from H. sapiens (Hsa; Accession # NP_060597), D. melanogaster (Dme; Q8MKW7), A. thaliana (Ath; AAM51378), C. elegans (Cel; O4476) and S. cereviseae (Sce; NP013005.1) were aligned using Clustalw. The full length alignments are presented in Supplemental Figure SF2 in File S1. Numbers at top are for H. sapiens tRNase ZL. Regions presented begin with the last identified homology block (Ndom-Tprox) in the amino domain [41] proximal to tether and include two smaller homology blocks in tether (rectangular enclosures).//indicates omitted sequence. Small bold rectangles enclose hydrophilic patches that mark the Ndom-tether boundary.

The tethers examined most closely here have similar sequences and predicted secondary structures (two α-helices toward the carboxy end; Figures 4 and 7). Two short sequence patches are conserved in the first half of tether: BxKBxBRP (in which B is a bulky hydrophobic residue) just preceding the major flexible site RK385 in the D. melanogaster tRNase Z tether and EE399B at the start of the first predicted α helix. The first of these sites is detected as a possible trypsin cleavage at K424 in the H. sapiens tRNase ZL Cdom polypeptide Y425–K784 (Supplemental Table ST8 in File S1); the second is detected by GluC in D. melanogaster Cdom polypeptide E399–E718 (Supplemental Table ST7 in File S1).

Discussion

Two defining features of tRNase ZL, flexible tethering of tandemly duplicated, functionally diverged domains and the presence of the tRNA-binding flexible arm in the amino domain, are directly characterized here through biophysical analysis. tRNase ZL purifies under native conditions and presumably functions as a monomer, while tRNase ZS is a homodimer. The main flexible regions are the FA hand and the tether that links the amino and carboxy domains, besides the hydrophilic ends, illustrated schematically in Figure 11. Internal sites presented in Tables 2 and 3 and Figures 4 and 7, including NInt and CTr in D. melanogaster tRNase Z and Ntr, FAJ and CdomTr in H. sapiens tRNase ZL, are not equivalent.

Figure 11

Tethered domains and flexible regions in tRNase ZL.

Polypeptides characterized in the limited proteolysis experiments define the stable domains and flexible regions in tRNase ZL illustrated in the diagram. Most of the proteolytic cleavages fall into four flexible regions, designated Nflex, FA, Tether and Cend, producing polypeptides designated Nflex, FA, Ndom and Cdom. Two main flexible regions in tether produce Ndom and Cdom polypeptides varying in length as illustrated.

Simultaneous vs. sequential cleavage in flexible regions and production and disappearance of stable domains

Data from the time courses with trypsin and other proteases generally favor simultaneous, as distinguished from strictly sequential, cleavage of tRNase Z. 1D SDS-PAGE and MALDI-TOF experiments show polypeptide species that appear early and persist late, over a factor of ten in digestion time (from 1–10 min for D. melanogaster tRNase Z and from 3–30 min for H. sapiens tRNase ZL), and similar overall patterns were observed in time courses of tRNase ZL cleavage by trypsin separated on 2D gels (not shown).

Depletion of Ndom but not Cdom polypeptides by FA cleavage

A tRNase Z protein cleaved in FA would not be a source for Ndom polypeptides, but could produce Cdom polypeptides. Similarly, once cleaved in tether, the pool of Ndom polypeptides could be depleted by cleavage in FA, producing fragments below 30–35 kDa, too small for productive analysis of stable domains by these methods. CdomTr fragments are the only small stable polypeptides.

Inverse relation between flexibility and catalytic efficiency

D. melanogaster tRNase Z requires ∼5-fold less time/protease to achieve similar levels of proteolysis, and is therefore more flexible than H. sapiens tRNase ZL D. melanogaster tRNase Z is between 10 – 100-fold less active in pre-tRNA processing than H. sapiens tRNase ZL (from comparisons between [11], [17], [37], [42]), suggesting an inverse correlation between flexibility and catalytic efficiency. Likewise, the D. melanogaster L187A tRNase Z variant displays a more flexible FA hand (Supplemental Figure SF4B in File S1; cf Figure 3B) and close to 100-fold lower catalytic efficiency than wild type due to an increase in K m, suggesting impaired substrate binding. Hypotheses relating flexibility to catalytic efficiency are more fully developed in Supplement.

Possible adaptive value of tandem duplication with a flexible tether

Strong Ndom and Cdom peaks observed throughout the tRNase ZL time course with trypsin and other proteases support the tandem duplication/flexible tether model of eukaryotic tRNase Z evolution. tRNase ZL is generally more than twice the size of the tRNase ZS subunit (e.g. 826 residues, 92,219 Da in H. sapiens tRNase ZL vs 363 residues, 40,019 Da in tRNase ZS). tRNase ZS, a homodimeric protein, requires an extensive dimer interface. In contrast, the amino- and carboxy-domains of tRNase ZL are flexibly tethered. Close to 2,000-fold greater catalytic efficiency of H. sapiens tRNase ZL over tRNase ZS is consistent with adaptive value of the flexible tether.

MALDI-Ion trap MS/MS spectra from tRNAseZ.

(PDF)

Click here for additional data file.

MALDI-Ion trap MS/MS spectra from tRNAseZ.

(PDF)

Click here for additional data file.

Contains supplemental figures SF1 – SF7, and supplemental tables ST1- ST9 and acc:ompanying text: Figure SF1. tRNA in a complex with tRNase ZS. Figure SF2. Full length tRNase ZL alignments. Table ST1. Wild Type D. melanogaster tRNase Z – Trypsin MALDI-ToF based on spectra in Figure 3B. Table ST2. Predicted members of D. melanogaster tRNase Z Cdom2 family. Figure SF3. D. melanogaster tRNase Z – Trypsin Full Length Coverage. Table ST3. Compilation of D. melanogaster tRNase Z peptide MALDI-Ion trap. Figure SF4. D. melanogaster tRNase Z ΔFA & L187A MALDI-ToF. Tables ST4, ST5. Polypeptide Tables based on spectra in Supplemental Figure SF4. Figure SF5. Detail views of tRNase Z FA free and bound to tRNA. Figure SF6. D. melanogaster tRNase Z– LysC & GluC MALDI-ToF. Tables ST6, ST7. Polypeptide Tables based on spectra in Supplemental Figure SF6. Table ST8. H. sapiens tRNase ZL – Trypsin MALDI-ToF Table. Figure SF7. H. sapiens tRNase ZL – Trypsin Full Length Coverage. Table ST9. Compilation of H. sapiens tRNase ZL peptide MALDI-Ion trap.

(DOCX)

Click here for additional data file.