Literature DB >> 23613794

In vitro HIV-1 evolution in response to triple reverse transcriptase inhibitors & in silico phenotypic analysis.

Barbara A Rath1, Kaveh Pouran Yousef, David K Katzenstein, Robert W Shafer, Christof Schütte, Max von Kleist, Thomas C Merigan.   

Abstract

BACKGROUND: Effectiveness of ART regimens strongly depends upon complex interactions between the selective pressure of drugs and the evolution of mutations that allow or restrict drug resistance.
METHODS: Four clinical isolates from NRTI-exposed, NNRTI-naive subjects were passaged in increasing concentrations of NVP in combination with 1 µM 3 TC and 2 µM ADV to assess selective pressures of multi-drug treatment. A novel parameter inference procedure, based on a stochastic viral growth model, was used to estimate phenotypic resistance and fitness from in vitro combination passage experiments.
RESULTS: Newly developed mathematical methods estimated key phenotypic parameters of mutations arising through selective pressure exerted by 3 TC and NVP. Concentrations of 1 µM 3 TC maintained the M184V mutation, which was associated with intrinsic fitness deficits. Increasing NVP concentrations selected major NNRTI resistance mutations. The evolutionary pathway of NVP resistance was highly dependent on the viral genetic background, epistasis as well as stochasticity. Parameter estimation indicated that the previously unrecognized mutation L228Q was associated with NVP resistance in some isolates.
CONCLUSION: Serial passage of viruses in the presence of multiple drugs may resemble the selection of mutations observed among treated individuals and populations in vivo and indicate evolutionary preferences and restrictions. Phenotypic resistance estimated here "in silico" from in vitro passage experiments agreed well with previous knowledge, suggesting that the unique combination of "wet-" and "dry-lab" experimentation may improve our understanding of HIV-1 resistance evolution in the future.

Entities:  

Mesh:

Substances:

Year:  2013        PMID: 23613794      PMCID: PMC3629221          DOI: 10.1371/journal.pone.0061102

Source DB:  PubMed          Journal:  PLoS One        ISSN: 1932-6203            Impact factor:   3.240


Introduction

Antiretroviral drug resistance [1] limits therapeutic options, clinical benefit and increases the risk of clinical progression [2]. Recommended first-line ART regimens consist of one non-nucleoside reverse transcriptase inhibitor (NNRTI) combined with two nucleoside reverse transcriptase inhibitors (NRTIs) [3]. All drugs within these combinations exert their effect on the HIV-1 reverse transcriptase. Nevirapine (NVP), the first approved NNRTI, binds directly to reverse transcriptase (RT) (the NNRTI binding pocket), leading to conformational inflexibility [4] and inhibition of enzymatic action [5]. NVP is used frequently to prevent the transmission of HIV-1 from mother to child [6]. Lamivudine (3 TC) is the most commonly used NRTI. Its triphosphate (3 TC-TP) competes with endogenous deoxycytosine triphosphate for incorporation into the nascent viral DNA during reverse transcription, where it inhibits HIV DNA elongation [7]. Adefovir (ADV) is an adenosine-monophosphate analogue, which in diphosphate form, acts as a chain-terminator competing with deoxyadenosine triphosphate for incorporation into viral DNA. Although not approved by the FDA for treatment of HIV [8], it is closely related to tenofovir disoproxil fumarate (TDF) a preferred nucleotide RT inhibitor that is currently recommended as a key component in first-line HAART [9]. Resistance to NVP, 3 TC and ADV is attributed to distinct mutations. NVP resistance mutations within the NNRTI binding pocket decrease NVP binding to RT by means of steric hindrance [10]. Lamivudine (3 TC) resistance conferred by the M184V mutation, decreases the affinity of 3 TC-TP for the primer/template complex during reverse transcription [7]. In contrast, ADV (and tenofovir) resistance selectively decreases incorporation of ADV phosphonate into viral DNA [11], [12], associated with mutations at K70E and K65R. Different mutational trajectories may arise during combination therapy, which may be altered by pre-existing mutations through epistatic constraints and genetic bottlenecks [13], [14]. In the context of combination therapy, selective pressures drive evolutionary pathways, consideration of which may optimize strategic sequencing of ART regimens [1], [15]. Furthermore, the preservation of mutations that limit viral fitness and replicative capacity [16], [17] provide for significant improvement in clinical and immunological outcomes among drug-experienced patients [18]. To understand drug resistance during combination antiviral drug treatments, an in vitro assay [19] was established in stimulated PBMC infected with virus isolates from 4 NRTI-experienced (but NNRTI-naive) patients. Mutations were selected by passage in different combinations and concentrations of ADV, 3 TC and NVP and viral fitness and resistance were estimated on the basis of a stochastic model of viral growth.

Materials

HIV Strains

As described previously [19], clinical isolates were derived from frozen samples. The primary clinical isolates were derived from 4 individuals who had previously received NRTI and protease inhibitors, but who had never been exposed to NNRTIs. The baseline RT mutations (as compared to the Los Alamos consensus Hxb2) up to RT amino acid position 300 can be found in Table 1.
Table 1

Baseline amino acid substitutions in relation to reference sequence (Hxb2) from the Stanford HIVDB [28].

Reverse Transcriptase Amino Acid Position
2035416769708390118122123135169177184196201202208210211214215219272275277291293294297
Hxb2KVMDTKRVVEDIEDMGKIHLRFTKAKKEIPE
Iso#1 T L I K E E V E V Y Q R V Q
Iso#2 R S N R I S T V V L F Q P D T
Iso#3 R S N R I S T V V L F Q P D T
Iso#4 I L N K K D V Y W K Y V
Iso#5 L K E T V W K Y P T

Cells and Cell Culture

HIV-negative donor PBMC from the Stanford Blood Bank were cultured in RPMI medium containing 15% heat-inactivated fetal calf serum, IL-2, PenStrep, and L-Glu and stimulated for 2–3 days with phytohemagglutinin (Sigma, St. Luis, MO) [20]–[22].

Test Compounds

Nevirapine (NVP) was kindly provided by Boehringer Ingelheim (Ridgefield, CT), lamivudine (3 TC) by GlaxoSmithKline (Research Triangle Park, NC), and adefovir (ADV) by Gilead (Foster City, CA).

Virological Methods

Passage Experiments

The serial combination passage experiments with isolates #1–#5 were conducted as follows [19]: (A) no drugs were added to the media, (B) 1 µM 3 TC and 2 µM ADV were added and maintained, (C) NVP was added and concentrations were doubled with each passage (0.01 µM NVP during the first passage up to 20.48 µM during the last passage), (D) 2 µM ADV and increasing concentrations of NVP were added, (E) 1 µM 3 TC and increasing concentrations of NVP were added and (F) 1 µM 3 TC and 2 µM ADV and increasing concentrations of NVP were added to the medium, see Figure 1. Isolates #2 and #3 were derived from the same individual but were run independently in experimental set-ups C, D & E. For each experimental set-up (A–F), 12 single-passage experiments were run, in total 5* 3* 12+4* 3* 12 = 324 single-passage experiments with a median duration of 21 days, respectively. With each passage-experiment in C, D, E and F, the concentration of NVP was doubled. The NVP starting dose was 0.01 µM, below the previously reported IC50 of NNRTI-naïve isolates (around 0.1 µM [23]). The final concentration was 2048-fold (20.48 µM), below reported cytotoxic levels [23]. Cultures were passaged as previously described [19]. Viral growth was monitored using a p24 antigen assay (Abbott Laboratories, Chicago, IL). At p24 ELISA values≥3×104 pg/ml, the cultures were passaged: at levels <3×104 pg/ml, cultures were split, and 2.5 million PBMCs were replaced by new donor PBMC in media containing the respective drugs in the same molar concentration. Supernatant to infect new cells was adjusted by p24 values obtained prior to passage.
Figure 1

Summary of passage experiments with sequencing data.

The illustration provides a complete review of RT sequence changes under the following experimental set-ups: A: no drugs were added to the media, B: [1 µM] 3 TC and [2 µM] ADV were added and maintained, C: NVP was added and concentrations were doubled for each passage (0.01 µM NVP during the first passage up to 20.48 µM during the last passage), D: [2 µM] ADV and increasing concentrations of NVP were added, E: [1 µM] 3 TC and increasing concentrations of NVP were added and F: [1 µM] 3 TC and [2 µM] ADV and increasing concentrations of NVP were added to the medium. Individual isolates #1 to #5 are indicated above the columns. Sequence changes listed are indicated in the rows that correspond to the passage number where they were first observed. NVP concentrations used in the respective passage experiment are listed on the right in units µM. Any mutation away from wild-type (Hxb2 strain) is indicated by a rightward-pointing arrow, whereas reversal to wild-type is indicated by a left-ward pointing arrow. All sequence changes (novel mutations and reversals) persisted throughout passage 12.

Summary of passage experiments with sequencing data.

The illustration provides a complete review of RT sequence changes under the following experimental set-ups: A: no drugs were added to the media, B: [1 µM] 3 TC and [2 µM] ADV were added and maintained, C: NVP was added and concentrations were doubled for each passage (0.01 µM NVP during the first passage up to 20.48 µM during the last passage), D: [2 µM] ADV and increasing concentrations of NVP were added, E: [1 µM] 3 TC and increasing concentrations of NVP were added and F: [1 µM] 3 TC and [2 µM] ADV and increasing concentrations of NVP were added to the medium. Individual isolates #1 to #5 are indicated above the columns. Sequence changes listed are indicated in the rows that correspond to the passage number where they were first observed. NVP concentrations used in the respective passage experiment are listed on the right in units µM. Any mutation away from wild-type (Hxb2 strain) is indicated by a rightward-pointing arrow, whereas reversal to wild-type is indicated by a left-ward pointing arrow. All sequence changes (novel mutations and reversals) persisted throughout passage 12.

ABI Sequencing

Population-based sequencing of amplified cDNA from viral RNA was performed as described previously [19], [24]. cDNA was obtained using Superscript-One-Step RT-PCR reagent (Life Technologies, Gaithersburg, MD). First-round nested PCR primers were RT-21 [25] and MAW-26 [24], second-round primers were PRO-1 [26] and RT-20 [25]. A d-Rhodamine labeled terminator kit (PE Applied Biosystems, Warrensburg, UK) and the previously described primers RT-a, RT-b (forward), RT-y and HXBR2-89 (reverse) [27] were used for sequencing (ABI Model 377 equipment and software). After alignment, proofreading, and editing, sequence data were compared to baseline and earlier passages of virus. Any change relative to wild type Hxb2 [28] sequence was defined as mutation. Any mutation back towards Hxb2 was defined as a reversal, even if it was not “all the way back”.

Mathematical Methods

Novel mathematical methods were developed in order to quantitatively estimate key phenotypic attributes from the experimentally observed viral growth kinetics, by minimizing the residual error ε between experimental- and model-predicted virus passage times. The estimated phenotypic attributes include the fold resistance towards NVP, , and the fitness deficits for mutational events occurring during the respective passage experiments. Furthermore, the growth rate of the respective baseline isolate , its susceptibility towards NVP () and the probability to encounter inhibition by NRTIs (ADV or 3 TC) with intensity (explained below) were estimated. The viral growth model is introduced below. Based on the viral growth model, passage times were computed to derive an objective function suited for parameter estimation from the available experimental data. Finally, a large-scale model selection technique was used to find the most informative/relevant set of phenotypic parameters and the robustness of the parameter estimation procedure was assessed. The source code for the developed methods is provided in the Material S1, with a short description of the code.

Basic Viral Growth Model

We assumed a simple-birth Markov model [29], combining the intermediate steps of target cell infection, pro-viral integration, virus release, and virus maturation (e.g. see [30] for an overview). Target cell concentrations were held constant during the experiments (see Virological Methods), which reduces the infection to first order kinetics. Furthermore, the absence of immune responses in vitro allows the assessment of virus growth in the absence of the immunologic confounders typically encountered in vivo. For each virus isolate we could therefore model viral growth kinetics with rate constant , where the index j refers to the experiment and the index p refers to the passage number, i.e. passage , as shown in Fig. 1. For example, isolate #1 is assumed to grow at rate in experiment C at passage 7, i.e. in the presence of 0.32 µM NVP and after having acquired mutation Y188C (see Fig. 1C). As explained in the example, the viral growth with rate constant is determined by the presence of baseline mutations, by the presence of drugs at different concentrations, and by mutational events , arising throughout the course of the experiment (selection/de-selection of mutations). We modelled their simultaneous effects as described previously [31]:where denotes the growth rate of the baseline viral isolate in the absence of drugs. The parameter denotes the effect of NVP on viral growth kinetics in experiment j, in passage p. It holds that , i.e. when the drug is very efficient, will be close to 1 (computation outlined below). The fitness deficit of the viral strain encountered in experiment j, passage p is denoted by. If the strain is very fit, will be close to 1, if it is very unfit, it will be close to 0 (computation outlined below). The parameter denotes the intensity of the NRTI-effect (ADV/3TC effects) on viral growth in experimental set-up j, which was estimated to be with probability when NRTIs were added (experimental set-ups ) and which was set to , if NRTIs were not added (experimental set-up: ). Note, that the concentrations of NRTIs were maintained throughout an experimental set-up j, in contrast to NVP concentrations, which were increased in consecutive passages p. Different models for ADV/3TC effects were compared: (i) assigning individual “noise effects” to ADV and 3TC respectively, (ii) assigning an isolated ADV effect or (iii) a 3TC effect versus (iv) a model that assigned an NRTI-effect if one of the inhibitors was present. The comparison suggested that model (iv) was best suited to describe the data. We therefore assigned an NRTI-effect, if at least one of the inhibitors (ADV or 3TC) was present in experimental set-up j.

Drug Effects and Fitness

The effect of NVP on viral growth was modelled according to the standard model of pharmacological action (Emax-model) [32]:where denotes the fold resistance to NVP exerted by a single mutation selected during the course of experiment j until passage p. [NVP (j, p)] denotes the concentration of NVP added in passage p of experiment and refers to the fifty percent inhibitory concentration of the baseline isolate. Accordingly, the fitness deficit of the respective viral strain present at passage p during experiment j was modelled according to: where denotes the relative fitness of the single mutation , that has not yet been reversed/de-selected until passage p in experiment j. Note, that all mutational events that have arisen until a particular passage in experiments were taken into account simultaneously. For example, in experimental set-upj = A for isolate #2, at passage p  = 12 (see Fig. 1A) we took into account both the phenotypic effects of q 1 = M←184 V, which arose earlier at passage 4, as well as q 2 =  N←67 S, see eq. (1)-(3).

Passage Times

In the experiments (see Virological Methods), viral growth which exceeded a threshold was recorded, i.e. the time required for a viral population to exceed a p24 ELISA signal of≥3×104 pg/ml (see Fig. 2). This time can be referred to as passage time. Having a model for the growth of virus (see eqs.(1)-(3)), we can compute these quantities from the model as well, which allows us to perform parameter estimation. The passage experiments can be modelled as a Markov process [33], for which the time elapsed (in days) before the size of the virus population attains the threshold is referred to as passage time (in mathematical literature it is also referred to as first passage time or first hitting time) [34]. Because the passage times are random variables, we are interested in their statistical moments. The first statistical moment of the probability distribution of the passage time corresponds to its mean value (the mean passage time), whereas the square root of the second (centralized) statistical moment corresponds to its standard deviation [35].
Figure 2

Box plot of single passage times for virus isolate #1, #2/3, #4 & #5 during experimental set-ups A–F as indicated on the x-axis.

The solid red horizontal lines indicate the respective median passage times, whereas the boxes surrounding them indicate the range encompassed by the 25th and 75th percentiles. The whiskers denote the most extreme data points, which are not considered outliers and the black dots indicate outliers. A: Viral passage times for isolate #1. B: Viral passage times for isolate #2&3 (combined). C: Viral passage times for isolate #4. D: Viral passage times for isolate #5.

Box plot of single passage times for virus isolate #1, #2/3, #4 & #5 during experimental set-ups A–F as indicated on the x-axis.

The solid red horizontal lines indicate the respective median passage times, whereas the boxes surrounding them indicate the range encompassed by the 25th and 75th percentiles. The whiskers denote the most extreme data points, which are not considered outliers and the black dots indicate outliers. A: Viral passage times for isolate #1. B: Viral passage times for isolate #2&3 (combined). C: Viral passage times for isolate #4. D: Viral passage times for isolate #5. In the passage experiments described above (see Virological Methods), virus was diluted 100-fold (100 µL supernatant in 10 mL media) and the time to an initial p24 ELISA signal (≥3×104 pg/ml) was recorded. We therefore infer that ; i.e. the concentration of virus has to increase by a factor of 100 with respect to the virus concentration used at the initiation of a passage . For any passage p during experimental setting j the mean passage time can be computed according to [36]:where denotes the waiting time in state k (number of viral particles). Substituting eq.(1), we get By further substituting eqs. (2)–(3), the equation above allows to express the mean passage time in terms of the , fitness values , fold resistance , basic growth rate and , which will be exploited later for parameter estimation. The raw second moment of the passage time distribution can be computed according to [36]:where eq.(1)-(3) can again be substituted. The raw second moment (eq.(6)) can be centralized. The square root of this centralized second moment yields the standard deviation of the passage times [37]. Thus, the above analytical expressions enable to compute the mean and standard deviation of the time required for a single-passage p in an experiment j according to

Objective Function

The above derived mean and standard deviation of the passage times correspond to a single passage p in an experiment j. Experimentally measured viral growth statistics (see Fig. 2) correspond to mean values and standard deviations pooled over all 12 individual passages p during experiment j. The corresponding pooled means and standard deviations of passage times can be computed from the model as follows [38]: Substituting eqs.(1)-(8), we use the statistical measures derived in eqs.(9)-(10) to estimate model parameters (fold resistance towards NVP () and the fitness deficits for single mutations q, the growth rate of the respective baseline isolate , its susceptibility towards NVP () and the probability to encounter inhibition by NRTIs with intensity (), by minimizing the weighted least squares deviation between model and data:were and denotes the predicted pooled mean passage times and the corresponding pooled standard deviations respectively for experimental set-up j, which were computed using eqs.(9)-(10). Parameters and denote the experimental pooled mean passage times and their standard deviations for experimental set-up j, as shown in Fig. 2. The parameter set , which is optimized, is determined by all mutational events that occurred in the respective isolate and baseline parameters. For example, for isolate #1, this includes the baseline parameters and and the parameters related to mutational events:

Parameter Estimation, Identifiability & Model Selection

Parameter estimation was run using constrained optimization implemented in the MATLAB© function (optimization toolbox). Note that some unbounded parameters (e.g. ) may not be reliably estimated if they appear in conjunction, see eq. (2). In order to improve the estimation of these parameters, we penalized unrealistically large values in the objective function, i.e. where . This way, a resistance value is only estimated, if it improves the model significantly over a ‘no resistance’ estimate (‘null model’). Also, estimation would favor small values, which is justified, because all baseline isolates were NVP-naive. While this change to the objective function adds a (small) bias towards lower values, all fold resistance estimates have to be interpreted as lower boundaries, i.e. FR(106A)≥65 denotes that mutation V106A yields at least 65-fold susceptibility reduction. Parameter estimates for were not altered by this modification of the objective function. Finally, we performed a model selection to investigate which sub-set of parameters best explained the data. For example, if a total number of two mutational events q 1 and q 2 were selected in all experiments with the same isolate x, we took all of four possible candidate models into account: a model that takes both mutational events q 1 and q 2 into account , two models that take either q 1 or q 2 into account ( and ) and a ‘null’ model , which does not take any mutational events into account. For each of the 2| candidate models (in total 5280 models for all isolates), parameter estimation was performed 50 times with random start parameters to assess parameter identifiability for each candidate model . Finally, for each isolate, the k-most informative models according to their AIC (Akaike information criterion) [39] were chosen. The k-most informative models had to exceed a relative likelihood of 0.45, in comparison to the best model (lowest AIC). Parameter estimates presented later in the manuscript are medians and 5th and 95th percentiles based on the k-best models. A visual predictive check of experimental- vs. predicted data (k-best models) is shown in Figure S1. For clarity and ease-of-understanding, a diagram of the parameter estimation and model selection procedure is depicted in Figure S2 and the complete MATLAB© source code is provided in Material S1, including a short instruction on its application.

Results

Selection of Mutations by ADV, 3 TC, and NVP

Baseline isolates #1–5 (see Table 1) exhibited thymidine-analogue-associated mutations (TAM): M41L, D67N, K70R, L210W, T215F/Y, K219Q and 3 TC resistance (M184V) [40], but there were no mutations associated with NNRTI resistance including positions 100,101, 103, 106, 108, 179, 181, 188, 190, 225, 227, 230 and 236 [28], [40], [41]. In experiments with NVP, substitutions at all of these positions were observed, except for codons 100, 225, 230 and 236. The additional substitutions observed at codons 69, 122, 128, 208, 218, 224 and 228 in our NVP experiments have not previously been linked to NVP resistance [28], [40]. Isolates exposed to escalating doses of NVP showed a gradual appearance/selection of one- to three new NNRTI mutations (totalling 43 new mutations with NVP), see Fig. 1. Of the newly detected mutations, 36 were at positions previously reported in the context of NVP resistance [28], [40], [41]. Mutations at position 106 (V106A/M/I) and V108I were eventually selected by NVP (experimental set-ups ). Interestingly, different substitutions arose for the distinct isolates at position 106, i.e. isolate #4 developed 106 M, whereas isolates #1 and #5 developed 106A and isolates #2/3 either developed 106A or 106I. The mutation V106M always appeared with L228Q, followed by F227L in experiments with NVP and ADV (experiments D & F) in isolate #4. Mutations Y181C and Y188C were selected in isolates #2, 3, 4 & 5 and isolates #1, 2, 4 & 5 respectively. Other mutations occurred less frequently. All isolates had the 184V mutation at baseline (Table 1), which was always preserved in the presence of 3 TC, whereas the reversion M←184V occurred in 86% (12/14) of the passages when 3 TC was absent (p<0.001). Interestingly, mutation H208Y was de-selected in isolate #4, experiments , but selected in isolate #5, experiment , see Fig. 1B. Pre-existing TAM-1 mutations were deselected in isolate #4 C/D←215Y (Fig. 1A & Fig. 1C) and in isolate #5 L←210W (Fig. 1C & Fig. 1E). The mutation 210W was always deselected together with R←211K and in the presence of NVP, but in the absence of ADV (experiments C & E). The TAM-2 mutation at position 67 S was modified N←67 S in isolate #2/3, experiments . Isolates #2 and #3 were derived from the same clinical isolate with similar, but not identical evolutionary patterns that emerged in serial passage experiments C, D & E (see Fig. 1C–E). This suggests that chance mutation may occur with different evolutionary consequences. The average number of selected mutations is illustrated in Figure 3A for the sequential passages (pooling data from all passages and isolates). The average rate of resistance development in passages 5–7 and 12 was significantly greater in experiments with NVP than without NVP. The rate of new resistance mutations in the NVP experiments was highest during passages 5–7 and 12.
Figure 3

Selection dynamics.

A: Average number of mutations per passage in experiments with NVP (experimental set-ups C, D, E & F). Asterisks indicate whether there were significantly more mutations (Wilcoxon rank sum test) than in the NVP-free experiments (experimental set-ups A & B). *p<0.1, **p<0.05, ***p<0.01. B: Cumulative probability of detecting no mutation. The blue and red lines show the cumulative probability of not detecting a mutation after the indicated numbers of passages (x-axis) in experiments where NVP was added with increasing concentrations (blue line; experimental set-ups C, D, E & F) vs. experiments where no NVP was added (red line; experimental set-ups A & B).

Selection dynamics.

A: Average number of mutations per passage in experiments with NVP (experimental set-ups C, D, E & F). Asterisks indicate whether there were significantly more mutations (Wilcoxon rank sum test) than in the NVP-free experiments (experimental set-ups A & B). *p<0.1, **p<0.05, ***p<0.01. B: Cumulative probability of detecting no mutation. The blue and red lines show the cumulative probability of not detecting a mutation after the indicated numbers of passages (x-axis) in experiments where NVP was added with increasing concentrations (blue line; experimental set-ups C, D, E & F) vs. experiments where no NVP was added (red line; experimental set-ups A & B). The rate of mutation as time-to-event, with NVP, was significantly greater than the rate of mutation without NVP. In the presence of NVP, at least one mutation occurred after 8 passages, whereas at least one mutation occurred in only 47% of all experiments without NVP by passage 8 (and in 66.6% of experiments without NVP after 12 passages). The cumulative probability that no mutation appears is shown in Figure 3B. The rate at which mutations appear is significantly higher (p<0.01) with NVP.

Viral Growth Kinetics

The experimental single-passage times are shown in Figure 2 where the passage times with NVP at increasing concentrations were compared to those without NVP. Most experiments with NVP resulted in significantly longer passage times compared to those without addition of drugs (experimental set-up A; see solid horizontal bars in Figure 2). Remarkably, there was no significant difference in mean passage times between experiments with NVP (experimental conditions C, D, E & F) and experimental set-up B (ADV and 3 TC at constant drug concentrations).

Addition of Low dose NRTIs Introduces Stochastic Viral Growth Dynamics

In Figure 4A–D we compared viral growth dynamics without drugs to growth in 1 µM 3 TC and 2 µM ADV. The addition of 3 TC and ADV did not significantly delay viral growth in isolates #1, 2 & 4, suggesting that 1 µM 3 TC and 2 µM ADV did not inhibit viral growth in the majority of passage-experiments. However, for isolate #5 significantly longer passage times were observed (p  = 0.01) when 3 TC and ADV were added to the medium. However, the variance of the passage times was significantly increased for all isolates tested (p<0.05 for isolates #2 and #5 and p<0.01 for isolates #1 and #4, see Fig. 4).
Figure 4

Box plot of passage times for virus isolate #1, #2, #4 & #5 during experimental set-ups A & B (no drugs added vs. 1 µM 3 TC plus 2 µM ADV added) as indicated on the x-axis.

The solid red horizontal lines indicate the respective median passage times, whereas the boxes surrounding them indicate the range encompassed by the 25th and 75th percentiles. The whiskers denote the most extreme data points, which are not considered outliers and the black dots indicate outliers. A: Viral passage times for isolate #1. B: Viral passage times for isolate #2. C: Viral passage times for isolate #4. D: Viral passage times for isolate #5.

Box plot of passage times for virus isolate #1, #2, #4 & #5 during experimental set-ups A & B (no drugs added vs. 1 µM 3 TC plus 2 µM ADV added) as indicated on the x-axis.

The solid red horizontal lines indicate the respective median passage times, whereas the boxes surrounding them indicate the range encompassed by the 25th and 75th percentiles. The whiskers denote the most extreme data points, which are not considered outliers and the black dots indicate outliers. A: Viral passage times for isolate #1. B: Viral passage times for isolate #2. C: Viral passage times for isolate #4. D: Viral passage times for isolate #5. This initial evaluation of viral growth kinetics in the presence and absence of 3 TC/ADV indicates a stochastic effect of 3 TC and ADV. In order to account for this effect in the viral growth model, we introduced the parameter denoting the probability of NRTI-effect (depending on the baseline isolate), and a parameter describing the intensity of effect, denoted by . These parameters were estimated to be with probability when NRTIs were added (experimental set-ups ) and set to , if NRTIs were not added (experimental set-up: ), as described in the Mathematical Methods section.

Estimating Drug Susceptibility and Fitness of Baseline Isolates

Using the Mathematical Methods described earlier, we were able to estimate key model parameters. In Table 2 the estimated growth rates r ∅ and 50% inhibitory NVP concentrations IC50 are shown for the respective baseline isolates.
Table 2

Estimated baseline parameters.

r 0/[1/day]IC50[µM] η NRTI ρ NRTI
Iso #1 0.42 (0.42, 0.42)0.39 (0.37, 0.48)0.65 (0.63, 0.67)0.43 (0.28, 0.44)
Iso #2/3 0.39 (0.39, 0.39)0.07 (0.07, 0.1)0.99 (0.97, 0.99)5.4e−7 (4.7e−7, 1.8e−4)
Iso #4 0.33 (0.33, 0.33)0.13 (0.07, 0.14)0.99 (0.99, 0.99)1.1e−5 (3.8e−6, 1.2e−5)
Iso #5 0.36 (0.36, 0.36)0.39 (0.39, 0.49)0.99 (0.99, 0.99)1e−6 (9.9e−7, 1.1e−6)

r 0/ (baseline growth rate in the absence of drugs), intensity- η NRTI and probability ρ NRTI of NRTI-induced effect at concentrations of 1 µM 3 TC and 2 µM ADV respectively and lower-bound estimates for the susceptibility of baseline isolates towards NVP IC50. Indicated numbers are median estimates from the k-best models (see Mathematical Methods) and their respective 5th–and 95th –percentiles (in brackets).

r 0/ (baseline growth rate in the absence of drugs), intensity- η NRTI and probability ρ NRTI of NRTI-induced effect at concentrations of 1 µM 3 TC and 2 µM ADV respectively and lower-bound estimates for the susceptibility of baseline isolates towards NVP IC50. Indicated numbers are median estimates from the k-best models (see Mathematical Methods) and their respective 5th–and 95th –percentiles (in brackets). All baseline isolates had fairly similar growth rates (range: 0.33–0.42 day−1), although isolate 1 seems to be slightly more fit (in terms of the viral growth rate r ∅), whereas isolate 4 is the least fit of the four baseline isolates. The estimated median IC50 of the baseline isolates ranged from 0.07 to 0.39 µM NVP, consistent with published IC50 values for drug susceptible virus (wt- IC50:0.1 µM [23]; corrected for protein binding). The estimated intensity- and probability of NRTI effect (parameters η NRTI and ρ NRTI respectively) are shown in Table 2. For isolates #2, #3, #4 and #5, the estimated parameters confirmed that the probability of NRTI inhibition is low (ρ NRTI = 5.10–7,10–5 and 10–6 respectively for isolates #2/3, #4 and #5), but the intensity of effect was quite pronounced (η NRTI = 0.99 respectively for isolates #2/3, #4 and #5) at low NRTI concentrations. In contrast, for isolate #1, parameters relating to the efficacy of NRTIs were ρ NRTI = 0.43 (5th percentile: 0.28; 95th percentile: 0.44) and η NRTI = 0.66 (5th percentile: 0.63; 95th percentile: 0.67).

NVP Drug Resistance

Using the Mathematical Methods presented earlier, we estimated the fold resistance FR(q), exerted by the individual mutations q (see Table 3). As described in the Mathematical Methods section, we used a model selection algorithm in order to choose the most informative models (permutations of considered mutations) for our parameter estimation. As a consequence, not all parameters could be estimated. Mutations that were observed during final passages did not allow the assessment of growth dynamics in subsequent passages. Specifically, parameters FR(69I), FR(103N), FR(122K), FR(128Q), FR(208Y) and FR(218G) were not identifiable from the data and were thus not included into Table 3.
Table 3

Estimated lower-bounds of fold resistance against NVP exerted by single amino acid substitutions in the distinct genetic background of the baseline isolates.

Iso #1Iso #2/3Iso #4Iso #5
FR(101E) n.sn.s5 (2, 5)n.s.
FR(106A) 80 (52, 135)176 (22, 195)n.s21 (9, 47)
FR(106I) n.s5 (3, 9)n.sn.s
FR(106M) n.sn.s1 (1, 4)n.s
FR(108I) 25 (7, 26)1 (1, 1)7 (6, 65)7 (3, 7)
FR(179I) n.s.1 (1, 3)n.s.n.s.
FR(181C) 5 (4, 6)7 (6, 41)n.i13 (10, 13)
FR(190A) n.s8 (7, 11)n.in.s.
FR(181C/190A) n.sn.s67 (59, 300)n.s.
FR(188C) 23 (4, 43)n.s.n.s7 (2, 11)
FR(218E) n.s.1 (1, 5)n.s.n.s.
FR(224K) n.s1 (1, 5)n.sn.s.
FR(227L) n.sn.s12 (7, 29)n.i.
FR(228Q) n.sn.s128 (8, 423)n.s.

Values indicated are medians of all parameter estimates and the 5th and 95th percentile of the estimates are indicated in brackets. 'n.s’ means ‘not selected’ and n.i. means parameter ‘not identifiable’. Parameters FR(69I), FR(103N), FR(122K), FR(128Q), FR(208Y) and FR(218G) were not identifiable from the data for any isolates and thus omitted from the table.

Values indicated are medians of all parameter estimates and the 5th and 95th percentile of the estimates are indicated in brackets. 'n.s’ means ‘not selected’ and n.i. means parameter ‘not identifiable’. Parameters FR(69I), FR(103N), FR(122K), FR(128Q), FR(208Y) and FR(218G) were not identifiable from the data for any isolates and thus omitted from the table. Resistance estimates were distinct for the four different baseline isolates, indicating that pre-existing NRTI mutations may have influenced the impact of subsequent mutations on NVP susceptibility [42]–[45]. All isolates developed novel mutations at codon 106 in the presence of NVP. Mutation V106A was estimated to induce a profound fold resistance for isolates #1 and #2/3 and in isolate #4 (≥80, ≥184 and ≥21 respectively). Substitution V106I was associated with at least 5-fold resistance, which was selected by relatively low NVP concentrations of 0.04 µM in isolates #2/3. According to our estimates (Table 3), the substitution V106M in isolate #4 elicited little resistance. Mutation V108I arose in all isolates at least once. V108I led to modest NVP resistance in isolate #4 and #5, whereas moderate to strong resistance was conferred in isolate #1. Mutation Y181C appeared in all isolates, but the magnitude of resistance conferred by this mutation could only be estimated for isolates #1, #2/3 and #5, where it resulted in 5- to 13-fold resistance. In isolate #4, Y181C appeared simultaneously with G190???A, which induced strong NVP resistance according to our parameter estimates (FR≥67). Interestingly, mutation L228Q (isolate #4) was estimated to be associated with strong resistance development to NVP (Table 3) by our parameter estimates. This mutation always occurred before F227L, which added a moderate fold resistance. Mutation K103N, which is the most commonly observed resistance mutation to NVP in the clinic, appeared only during the final passage in experimental set-up D [NVP +3 TC] with isolate #2. Hence, a phenotype associated with this mutation was not observed and FR(103N) could not be estimated.

Effect of Baseline Mutations on Viral Fitness

The following back mutations or reversals were observed during the passage experiments: q∈{M←184V, N←67S, H←208Y, C/D←215Y, V←35I, L←210W, R←211K}. Only the de-selection M←184V significantly improved viral fitness in all isolates according to our parameter estimates (Table 4). Interestingly, the number of distinct mutations undergoing reversal was inversely correlated with our estimates of the growth rate r ∅, i.e. the “fittest” baseline isolates (largest parameter r 0/) had the fewest distinct mutations reversing back to wild type (1, 2, 4, 2 distinct deselected mutations for isolates #1, #2/3, #4 and #5 respectively).
Table 4

Estimated relative fitness deficit f(q) of mutations present in the genetic background of baseline isolates #1,#2/3,#4,#5.

Iso #1Iso #2/3Iso #4Iso #5
f (184V) 0.79 (0.79, 0.79)0.59 (0.59, 0.62)0.65 (0.64, 0.65)0.65 (0.65, 0.66)
f (215Y) n.dsn.ds0.68 (0.68,0.68)n.ds

A small value (close to 0) denotes a large fitness loss, whereas a value close to 1 denotes no fitness deficit. Values indicated are medians of all parameter estimates. The 5th and 95th percentile of estimates are indicated in brackets. 'n.ds’ means ‘not deselected’ and n.i. means parameter ‘not identifiable’. Parameters f(67S), f(208H), f(35I) and f(210W/211K) could not be reliably estimated from the data or were not significantly different from the value 1.

A small value (close to 0) denotes a large fitness loss, whereas a value close to 1 denotes no fitness deficit. Values indicated are medians of all parameter estimates. The 5th and 95th percentile of estimates are indicated in brackets. 'n.ds’ means ‘not deselected’ and n.i. means parameter ‘not identifiable’. Parameters f(67S), f(208H), f(35I) and f(210W/211K) could not be reliably estimated from the data or were not significantly different from the value 1. Parameter estimation (see Table 4) indicated that 184V conferred the greatest selective disadvantage of all mutations tested. The relative fitness estimated for the individual isolates ranged from 59% to 79% for the distinct isolates, which is generally consistent with previous in vivo estimates [46] and predictions from mechanistic mathematical models of HIV-1 DNA polymerization [7]. Although all baseline isolates carried resistance mutations at position 215, a change at amino acid position 215 (C←215Y and D←215Y) was observed only in isolate # 4. In Table 4, we estimated a relative fitness of 68% attributable to amino acid 215Y in isolate #4. Fitness values f(67S), f(208H), f(35I) and f(210W/211K) were not included in the k-most informative models (see Mathematical Methods) and could thus not be estimated from the data.

Discussion

The selection of drug resistance by a combination of drugs in vitro demonstrated complex evolutionary trajectories. Mathematical modelling of the passage experiments and the viral growth dynamics enabled estimation of fitness and drug resistance associated with mutational events.

Epistasis and Combination Passage Experiments

Drug resistance emerging during antiretroviral combination therapy is influenced by viral genetic polymorphisms, random effects, and epistasis. The latter is a phenomenon where the phenotype induced by one mutation is modified by one or several other mutations [47]. Epistasis may be of particular clinical relevance in NRTI and NNRTI therapies, where the reverse transcriptase is targeted by different drugs [3]. Mutations resulting from exposure to one RT inhibitor may alter the phenotype of mutations selected by another RT inhibitor, through functional or conformational perturbation of the enzyme. Epistasis in HIV-1 has been studied in the absence of drugs [47] and after application of single drugs [7], [48]. Due to the complexity of the laboratory work required and the many possible permutations resulting from a variety of parameters, passage experiments using multiple drugs simultaneously have not yet been studied in detail. Here, combination passage experiments were performed in four clinical isolates from NRTI experienced, NNRTI-naive patients. In contrast to site directed mutagenesis to introduce resistance mutations into clonal laboratory isolates, clinical isolates were subject to the gradual and “natural” evolutionary dynamics in the serial passage experiments. Consensus sequencing after each passage allowed the detection of variants that may be favored by in vivo selection. The isolates harbouring amino acid substitutions selected by NRTI exposure showed very distinct (strain-specific) evolutionary trajectories. Among identical amino acid substitutions we could observe distinct (strain-specific) effects on drug resistance (see Tables 2 & 3). Such strain-specific differences are likely governed by epistatic interactions between pre-existing and novel emerging mutations, as reported elsewhere [13], [14]. Epistasis in combination therapy complicates genotype-phenotype relationships because single mutations may have different effects on drug resistance in different genetic backgrounds. The divergent evolution of isolates #2 and #3 (derived from the same baseline sample), on the other hand, stresses the impact of chance mutation on evolutionary trajectories.

Phenotypic Attributes of Acquired NVP Resistance Mutations

Epistasis could be the mechanism behind the selective amino acid substitution at RT codon 106 in isolate #4, which exclusively developed the V106M (GTG -> ATG) substitution, although V106A (GTG -> GCG) could also have occurred by random mutation. Interestingly, V106M always appeared together with L228Q (either before- or after), followed by F227L in experiments with NVP and ADV (experiments D & F) in the specific genetic background of isolate #4. The L228Q is a rare mutation associated with co-administration of NRTIs and NNRTIs [28], particularly when the NRTI is a dATP analogue such as ADV. In our case it only (and always) appears in isolate #4, i.e. in 2/2 experiments when NVP was co-administered with ADV (experiments D & F), irrespective of the presence of 3 TC. The L228Q mutation results in a change from a non-polar/hydrophobic- to a strongly polar amino acid in direct proximity to the NNRTI binding pocket [49], possibly modulating the binding of NVP, which could induce resistance as predicted in Table 3. In contrast, isolates #1, #2/3 and isolate #5 developed V106A, which mediate strong resistance [28] in agreement with our estimates, see Table 3. Although previous reports suggest that the V106I mutation alone does not confer resistance to NVP in vitro [50], [51], we estimated a low-to-moderate resistance by this mutation, which may be explained by the genetic background of isolates #2/3. It may be possible that appearance of the K103N mutation was restricted by multiple pre-existing RT mutations. Notably, the K103N may contribute little in terms of resistance to NVP in the presence of multiple TAMs and 3 TC resistance (such as RT mutations: M41L, D67N, M184V, L210W, T215Y, K219Q, P236P/L) [52], see Fig. 1. Previous reports provide evidence that the Y181C mutation is associated with moderate-to-high level NVP resistance [28], while our estimates for isolates #1, #2/3 and #5 suggests a low-to-moderate resistance attributable to this mutation. Although considered a major resistance mutation against NVP, [28], [40], in isolate #3, the estimated impact of G190A was only moderate. In agreement with other data [28], [52], mutation Y188C induced moderate to strong NVP resistance. This mutation however, was only selected in isolates #1 and #5.

Phenotypic Attributes of De-selected (Fitness) Mutations

The 184 V mutation was deselected in all combination passage experiments not including 3 TC and conferred a significant selective disadvantage in all isolates tested, which is exploited in some treatment lines that include 3 TC despite the M184V mutations. However, the degree of the fitness deficit was different for the four distinct baseline isolates, suggesting, again, epistatic interactions, as described previously [53], [54]. The statistical analysis of the experiments suggested that addition of 1 µM 3 TC and 2 µM ADV to the drug resistant viruses used in the experiments did not significantly inhibit viral growth. Furthermore, the analysis suggested that M184V, which was present in all baseline isolates, persisted in the presence of 1 µM 3 TC and reverted in its absence. The continued administration of 3 TC to preserve 184V is common in salvage strategies [18], [55]. Mutations C/D←215Y are considered “reversion” mutations that have been observed in vivo in the absence of zidovudine (AZT) [56], [57] and in untreated individuals infected with 215F/Y-containing (AZT-resistant) variants [57]. Here, “reversion” was observed in the genetic context of isolate #4. This “reversion” could recover an apparently large fitness loss associated with 215Y (relative fitness 68%, see Table 3). AZT-susceptible strains containing 215C/D were reported to be as fit as the WT virus in the absence of the drug [58], but retain the potential for the rapid emergence of high-level AZT resistance, through a single nucleotide substitution at codon 215 to become the resistant 215Y (by contrast, the conversion of wild type to resistant T215Y requires 2 nucleotide substitutions). Multidrug passage experiments with escalating drug concentrations may reproduce clinical scenarios where concentrations vary over time and facilitate the development of drug resistance [59]. The emergence of drug resistance, despite high genetic barriers, has been attributed to heterogeneous pharmacokinetics in multiple physiologic compartments [60], resulting in sub-inhibitory concentrations of drugs [61]–[63]. In our passage experiments, such multi-stage scenarios can be reproduced: resistance may evolve under conditions allowing residual replication (the respective first passages) and then be selected further in subsequent passages favoring selection through increased selective pressure. The drug combination assay may be suitable to study the evolution of very complex resistance patterns, such as TAMs, the Q151M complex, resistance to some protease inhibitors or multidrug resistance to NNRTI+NRTI combinations. Most importantly, in vitro combination passage experiments in conjunction with novel in silico analysis methodologies can contribute to an improved understanding of the complex evolution of drug resistance in clinical studies and individuals. Mathematical tools to estimate phenotypic parameters, including resistance and fitness, may provide new insights for designing effective drug combinations. Visual predictive checks of predicted (y-axis) versus observed (x-axis) data points. A: Means of mean first passage times and B: their standard deviations . The distinct markers indicate the different patient isolates: leftward-, upward-, rightward- and downward-pointing triangles indicate data/predictions from/for isolates #1, #2/3, #4 and #5. Colours indicate the different experimental set-ups, e.g. red, cyan, blue, yellow, magenta and green denote experimental set-ups A-F respectively. Vertical bars indicate the range of predictions spanned by the 5th and 95th percentile of all model evaluations. (PDF) Click here for additional data file. Organization of the source code (Material S1) for the estimation of phenotypic parameters from passage experiments. (PDF) Click here for additional data file. MATLAB© source code of the developed parameter inference procedure described in the Mathematical Methods section. (ZIP) Click here for additional data file.
  52 in total

1.  Phenotypic hypersusceptibility to non-nucleoside reverse transcriptase inhibitors in treatment-experienced HIV-infected patients: impact on virological response to efavirenz-based therapy.

Authors:  N Shulman; A R Zolopa; D Passaro; R W Shafer; W Huang; D Katzenstein; D M Israelski; N Hellmann; C Petropoulos; J Whitcomb
Journal:  AIDS       Date:  2001-06-15       Impact factor: 4.177

2.  Phenotypic susceptibility and virological outcome in nucleoside-experienced patients receiving three or four antiretroviral drugs.

Authors:  David A Katzenstein; Ronald J Bosch; Nicholas Hellmann; Nan Wang; Lee Bacheler; Mary A Albrecht
Journal:  AIDS       Date:  2003-04-11       Impact factor: 4.177

3.  Evaluation of cutpoints for phenotypic hypersusceptibility to efavirenz.

Authors:  Ronald J Bosch; Gerald F Downey; David A Katzenstein; Nicholas Hellmann; Lee Bacheler; Mary A Albrecht
Journal:  AIDS       Date:  2003-11-07       Impact factor: 4.177

4.  Epistasis as the primary factor in molecular evolution.

Authors:  Michael S Breen; Carsten Kemena; Peter K Vlasov; Cedric Notredame; Fyodor A Kondrashov
Journal:  Nature       Date:  2012-10-14       Impact factor: 49.962

5.  Selection of drug-resistant HIV-1 mutants in response to repeated structured treatment interruptions.

Authors:  Javier Martinez-Picado; Kristina Morales-Lopetegi; Terri Wrin; Julia G Prado; Simon D W Frost; Christos J Petropoulos; Bonaventura Clotet; Lidia Ruiz
Journal:  AIDS       Date:  2002-04-12       Impact factor: 4.177

6.  The safety and efficacy of adefovir dipivoxil in patients with advanced HIV disease: a randomized, placebo-controlled trial.

Authors:  E J Fisher; K Chaloner; D L Cohn; L B Grant; B Alston; C L Brosgart; B Schmetter; W M El-Sadr; J Sampson
Journal:  AIDS       Date:  2001-09-07       Impact factor: 4.177

7.  A novel phenotypic drug susceptibility assay for human immunodeficiency virus type 1.

Authors:  C J Petropoulos; N T Parkin; K L Limoli; Y S Lie; T Wrin; W Huang; H Tian; D Smith; G A Winslow; D J Capon; J M Whitcomb
Journal:  Antimicrob Agents Chemother       Date:  2000-04       Impact factor: 5.191

8.  Genotypic correlates of phenotypic resistance to efavirenz in virus isolates from patients failing nonnucleoside reverse transcriptase inhibitor therapy.

Authors:  L Bacheler; S Jeffrey; G Hanna; R D'Aquila; L Wallace; K Logue; B Cordova; K Hertogs; B Larder; R Buckery; D Baker; K Gallagher; H Scarnati; R Tritch; C Rizzo
Journal:  J Virol       Date:  2001-06       Impact factor: 5.103

Review 9.  Nucleoside inhibitors of human immunodeficiency virus type 1 reverse transcriptase.

Authors:  Prem L Sharma; Viktoria Nurpeisov; Brenda Hernandez-Santiago; Thierry Beltran; Raymond F Schinazi
Journal:  Curr Top Med Chem       Date:  2004       Impact factor: 3.295

10.  Human immunodeficiency virus reverse transcriptase and protease sequence database.

Authors:  Soo-Yon Rhee; Matthew J Gonzales; Rami Kantor; Bradley J Betts; Jaideep Ravela; Robert W Shafer
Journal:  Nucleic Acids Res       Date:  2003-01-01       Impact factor: 16.971

View more
  5 in total

1.  Logical-continuous modelling of post-translationally regulated bistability of curli fiber expression in Escherichia coli.

Authors:  Kaveh Pouran Yousef; Adam Streck; Christof Schütte; Heike Siebert; Regine Hengge; Max von Kleist
Journal:  BMC Syst Biol       Date:  2015-07-23

2.  Multiscale Systems-Pharmacology Pipeline to Assess the Prophylactic Efficacy of NRTIs Against HIV-1.

Authors:  S Duwal; V Sunkara; M von Kleist
Journal:  CPT Pharmacometrics Syst Pharmacol       Date:  2016-07-21

3.  Impact of Clinical Parameters in the Intrahost Evolution of HIV-1 Subtype B in Pediatric Patients: A Machine Learning Approach.

Authors:  Patricia Rojas Sánchez; Alberto Cobos; Marisa Navaro; José Tomas Ramos; Israel Pagán; África Holguín
Journal:  Genome Biol Evol       Date:  2017-10-01       Impact factor: 3.416

4.  Exposure to MIV-150 from a high-dose intravaginal ring results in limited emergence of drug resistance mutations in SHIV-RT infected rhesus macaques.

Authors:  Mayla Hsu; Brandon F Keele; Meropi Aravantinou; Noa Krawczyk; Samantha Seidor; Ciby J Abraham; Shimin Zhang; Aixa Rodriguez; Larisa Kizima; Nina Derby; Ninochka Jean-Pierre; Olga Mizenina; Agegnehu Gettie; Brooke Grasperge; James Blanchard; Michael J Piatak; Jeffrey D Lifson; José A Fernández-Romero; Thomas M Zydowsky; Melissa Robbiani
Journal:  PLoS One       Date:  2014-02-27       Impact factor: 3.240

5.  Advancing challenges in Paediatric Virology: An interview with Professor Barbara A. Rath, Co-founder and Chair of the Vienna Vaccine Safety Initiative.

Authors:  Ioannis N Mammas; Demetrios A Spandidos
Journal:  Exp Ther Med       Date:  2019-08-28       Impact factor: 2.447

  5 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.