Literature DB >> 23468933

Cysteine (C)-x-C receptor 4 undergoes transportin 1-dependent nuclear localization and remains functional at the nucleus of metastatic prostate cancer cells.

Ayesha S Don-Salu-Hewage1, Siu Yuen Chan, Kathleen M McAndrews, Mahandranauth A Chetram, Michelle R Dawson, Danaya A Bethea, Cimona V Hinton.   

Abstract

The G-protein coupled receptor (GPCR), Cysteine (C)-X-C Receptor 4 (CXCR4), plays an important role in prostate cancer metastasis. CXCR4 is generally regarded as a plasma membrane receptor where it transmits signals that support transformation, progression and eventual metastasis. Due to the central role of CXCR4 in tumorigenesis, therapeutics approaches such as antagonist and monoclonal antibodies have focused on receptors that exist on the plasma membrane. An emerging concept for G-protein coupled receptors is that they may localize to and associate with the nucleus where they retain function and mediate nuclear signaling. Herein, we demonstrate that CXCR4 associated with the nucleus of malignant prostate cancer tissues. Likewise, expression of CXCR4 was detected in nuclear fractions among several prostate cancer cell lines, compared to normal prostate epithelial cells. Our studies identified a nuclear pool of CXCR4 and we defined a nuclear transport pathway for CXCR4. We reveal a putative nuclear localization sequence (NLS), 'RPRK', within CXCR4 that contributed to nuclear localization. Additionally, nuclear CXCR4 interacted with Transportinβ1 and Transportinβ1-binding to CXCR4 promoted its nuclear translocation. Importantly, Gαi immunoprecipitation and calcium mobilization studies indicated that nuclear CXCR4 was functional and participated in G-protein signaling, revealing that the nuclear pool of CXCR4 retained function. Given the suggestion that functional, nuclear CXCR4 may be a mechanism underlying prostate cancer recurrence, increased metastatic ability and poorer prognosis after tumors have been treated with therapy that targets plasma membrane CXCR4, these studies addresses a novel mechanism of nuclear signaling for CXCR4, a novel mechanism of clinical targeting, and demonstrate an active nuclear pool that provides important new information to illuminate what has been primarily clinical reports of nuclear CXCR4.

Entities:  

Mesh:

Substances:

Year:  2013        PMID: 23468933      PMCID: PMC3585330          DOI: 10.1371/journal.pone.0057194

Source DB:  PubMed          Journal:  PLoS One        ISSN: 1932-6203            Impact factor:   3.240


Introduction

Prostate cancer (PCa) is the second leading cause of increased cancer incidence and cancer-related deaths among men in the United States [1], [2]. Despite treatment, the high mortality rates in PCa are attributed to metastasis, which is the main obstacle in PCa treatment [3]. Several molecules and mechanisms contribute to cancer cell metastasis. For instance, chemoattractant cytokines (chemokines) enhances the metastatic potential of PCa by binding and activating a family of G-protein coupled receptors (GPCRs) [4], [5], [6], [7] that initiate signals to enhance cell adhesion, invasion and movement, and subsequently, tumor survival at the new site of metastasis. GPCRs constitute the largest family of transmembrane plasma membrane (PM) receptors [8]. In conventional GPCR signaling, receptors are localized to the PM and influence the activity of PM-localized enzymes, ion channels, and/or second messengers. Their activation by an appropriate ligand triggers signaling through G-protein alpha (Gα) and/or beta-gamma (Gβγ) subunits [9], leading to context-dependent outcomes, which may positively and/or negatively regulate the activity of effector molecules in signaling cascades within the cell [10], [11]. Additionally, activated GPCRs also trigger a series of molecular interactions that allow for feedback regulation of G-protein coupling and receptor endocytosis to attenuate receptor signals [12], [13], [14], [15], [16], [17], [18]. Müller et al. initially described the involvement of chemokine GPCR receptors in cancer metastasis [19] and Akashi et al. reported that the chemokine GPCR, CXCR4, was highly expressed in human malignant PCa compared to normal prostate [20]. Numerous studies have documented the involvement of CXCR4 in key steps of PCa metastasis: (i) signaling; [21], [22]; (ii) invasion and migration [23]; and (iii) the establishment of a vascular network [24]. Hence, several therapeutics for cancer cell metastasis have been designed to antagonize CXCR4-mediated signaling [25], [26]. In conventional CXCR4 signaling, stromal cell-derived factor 1 alpha (SDF1α) is the exclusive ligand for CXCR4 [27], which leads to activation of pathways makes this receptor favorable to tumorigenesis: (i) G-protein coupled receptor (GPCR) signaling; (ii) PI3K/AKT; (iii)MAPK; (iv) JAK/STAT; (v) Src kinase and (vi) HER2 [28], [29], [30]. Interestingly, GPCRs have been detected in subcellular organelles distinct from its classical PM location [31]. These organelles include the Golgi apparatus [32], endoplasmic reticulum [33], the cytoskeleton [34] and the nucleus/nuclear membrane [35]. Hanyaloglu and von Zastrow postulated that default recycling of GPCRs by endosomes may contribute to enhanced re-delivery of GPCRs to the PM, or to alternate organelles within the cell, without destroying their signaling capacity [36]. Nevertheless, these alternately-localized GPCR receptors reveal a new level of complexity that may be important in modulating their function. An increasing number of GPCRs have been observed within the nucleus or nuclear membrane, such as lysophosphatidic acid receptors, metabotropic glutamate receptors, platelet-activating factor receptors, angiotensin 2 type I receptors, prostaglandin receptors, endothelin receptors, gonadotropin releasing hormone type I receptor [37] and β-adrenergic receptors [38], [39], [40], [41], [42], [43], [44]. Nuclear GPCRs have been suggested to regulate a number of physiological processes, including cell proliferation, survival, inflammatory responses, tumorgenesis, DNA synthesis and transcription [43], [45], [46], [47], [48], [49], [50]. Nuclear GPCRs may be constitutively active, or activated by internal, newly synthesized ligands that are bound for secretion [51]. Subsequently, classical second messenger signaling pathways, such as adenylyl cyclase-induced Protein Kinase A (PKA) activation [38], phospholipase-induced release of intranuclear calcium, diacyglycerol-induced Protein Kinase C (PKC) [39], [52], ERK1/2, p38 MAP Kinases and Protein Kinase B (PKB) [49], [50] have been shown to be activated by nuclear GPCRs. Nuclear localization of proteins is dictated by nuclear import and export through nuclear pore complexes [53]. Small proteins (<30–50 kDa) can pass through the nuclear pore by free diffusion; however, most cargo proteins require active transport to enter the nucleus [54]. Larger proteins use active transport mechanisms, which require assistance by transport proteins [55], [56], [57]. Many proteins targeted to the nucleus contain a classical nuclear localization signal (NLS) that is recognized by a heterodimeric import receptor comprised of importin alpha and importin beta. Many of these receptors directly recognize cargo proteins and target them directly to the nuclear pore [58]. In the case of this large family, the targeting signals within the cargo proteins are often not well-defined [59]. Each protein that localizes to the nucleus must possess a functional NLS or is required to bind to cargo proteins which possess a NLS(s). Importin alpha recognizes the NLS in the cargo protein while importin beta targets the import complex to the nuclear pore [58], [60]. Importin beta is part of a larger family of transport receptors often termed importins/exportins [59]. While a putative NLS has been identified in CXCR4 [61], the function of this nuclear targeting signal in the context of CXCR4 has not been examined. A distinct importin-dependent transport pathway has been implicated in the transport of C-C chemokine receptor type 2 (CCR2) [62]. Favre et al. found that an engineered, HA-tagged CCR2 associated with a member of the importin family of nuclear transport receptors, Transportinβ1 (TRN1), in a CCR2-null cell line [62]. An interaction of CCR2 with TRN1 was required to detect CCR2 in nuclear fractions, suggesting that CCR2 transported to the nucleus via TRN1 [62]. TRN1 has been implicated in GPCR internalization and desensitization [63]. Furthermore, TRN1 serves as a receptor for NLS-null proteins in NLS-containing cargo substrates [64], making it an essential protein for import through the nuclear pore complex [65]. Taken together, these studies suggest that both the classical nuclear import machinery and TRN1 are candidates that play a role in CXCR4 nuclear translocation [66]. Nuclear CXCR4 protein expression has been observed in malignant hepatocellular, colorectal, renal cell and nasopharyngeal carcinomas [67], [68], [69], [70]. These studies, however, were reported as clinical observations, and failed to investigate the mechanisms of CXCR4 localization or any biological function associated with the nuclear receptor. These data are consistent with reports that have demonstrated functional GPCRs associated with the nucleus, and further contribute to ongoing cancer therapeutic interventions against CXCR4. Importantly, a functional nuclear CXCR4 may contribute to PCa relapse despite current antagonists and monoclonal antibodies against PM-bound CXCR4 and may not be designed to cross the PM, which would be required to antagonize active CXCR4 at the nucleus. Furthermore, identification of transport pathways required for nuclear localization of CXCR4 may reveal additional targets for therapeutic development to hinder prostate cancer metastasis and improve patient survival.

Materials and Methods

Cell Culture, Antibodies and Reagent Conditions

PC3, DU145, 22RV1 human prostate cancer cell lines (PCa), RWPE1 human prostate cell line and 293T human embryonic kidney cell line were obtained from American Type Culture Collection (ATCC). PC3, DU145, 22RV1 and 293T cells were maintained in complete RPMI media: RPMI 1640 containing 10% fetal bovine serum (FBS), 1% non-essential amino acids and 1% antibiotic-antimycotic at 37°C in 5% CO2. RWPE1 cells were maintained in keratinocyte serum-free medium (KSFM) containing 50 mg/ml gentamycin, 0.05 mg/ml bovine pituitary extract (BPE), and 5 ng/ml epidermal growth factor (Invitrogen) at 37°C in 5% CO2. All cells were maintained at 60% to 80% confluency. PC3 cells were originally isolated from a prostate vertebral metastasis, while DU145 cells were obtained from prostate brain metastasis. 22RV1 cells were from a human prostate carcinoma epithelial cell line derived from a xenograft that was serially propagated in mice, and RWPE1 cells were isolated from normal human prostate epithelium. Cell culture supplies and kanamycin sulfate (61-176-RG) were from MediaTech; SDF1α (300-28A) was from PeproTech. The following reagents and human antibodies were from Cell Signaling: 10× cell lysis buffer (9803), mouse anti-rabbit IgG (5127), anti-CD44 (156-3C11), anti-GFP (2956S) and anti-Gαi (5290). Anti-CXCR4 (MAB172) was from R&D Systems. Anti-Topoisomerase1 (SC-271285), anti-Lamin A/C (SC-20681), Fusin (H-118)-CXCR4 (SC-9046), Fusin (4G10)-CXCR4 (SC- 53534), anti-Fibronectin IgG2B (SC-271098), anti-GFP (sc-9996), Protein A/G Plus-Agarose beads (SC-2003), anti-Karyopherinβ2 (SC-166127), Karyopherinβ2 siRNA (h) (SC-35737) and DAPI (SC-3598) were from Santa Cruz Biotech. NE-PER Nuclear and Cytoplasmic Extraction Kit (78833), Protease Inhibitor Cocktail Kit (78410) and Halt TM Phosphate Inhibitor Cocktail (78420) were from Thermo Scientific. Anti-αTubulin (T5168), Anti-βActin (A5441) Triton X-100 (T8532) and propidium iodide (P4170) were from Sigma-Aldrich. Prostate disease spectrum tissue array (PR8011) was purchased from Biomax. JetPRIME® Polypus transfection reagent (114-07) was from VWR International. Nonidet P-40 Substitute (M158) was from BioExpress and FluoForte Calcium Assay Kit (ENZ-51016) was from Enzo Life Sciences.

Characterization of CXCR4 IgG2B (R&D systems) Antibody

Specificity of anti-human CXCR4 mouse monoclonal antibody (R&D Systems) to CXCR4 protein was determined by immunoprecipitation and western blot analysis using CXCR4-positive PC3 and CXCR4-null 293T whole cell lysates. Briefly, PC3 and 293T cells (5×106) were grown on 100 mm dishes in complete media overnight, followed by incubation in RPMI only (serum-starvation) for 24 hrs. Cell were washed with 1× phosphate-buffered saline (PBS) and harvested in 1× Cell Signaling lysis buffer. Equal protein concentrations were estimated by Bradford assay (BioRad) and equal amounts were assessed for western blot analysis with CXCR4-IgG2B mouse monoclonal antibody or 1 mg of supernatant was immunoprecipitated (IP) with CXCR4-IgG2B mouse monoclonal antibody or Fibronectin-IgG2B mouse monoclonal antibody overnight at 4°C (Santa Cruz; 1 µg per 250 µg of protein), followed by incubation with Protein A/G Plus-Agarose beads for 2 hrs at 4°C. Protein-bound agarose beads were separated from lysates by a series of 3 washes with 1× PBS and centrifugation (max speed/2 min/room temperature [RT]). Beads in Lammelli buffer were separated by 10% SDS-PAGE, transferred to polyvinylidenefluoride (PVDF) membranes and probed for CXCR4-IgG2B (1∶1000). To confirm that PC3 cells expressed Fibronectin, 25 µg of whole cell lysate was harvested for western blot analysis. Beta-actin was used as a loading control.

Immunohistochemistry (IHC)

IHC analysis was performed on a prostate disease spectrum tissue array (Biomax) ranging from normal to high grade metastatic tissues. The array consisted of 80 total tissue cores including adenocarcinoma, metastatic, hyperplasia, chronic inflammation, adjacent normal tissue and normal tissue. Each individual core had a diameter of 1.5 mm and a thickness of 0.5 µm. Briefly, formalin-fixed, paraffin-embedded specimens were retrieved in washes of xylene, ethanol, and antigen retrieval solution, pH 6.0, (Biocare Medical) at 125°C for 30 sec. Specimens were neutralized in 0.3% hydrogen peroxide for 15 min at room temperature (RT), washed with 1× PBS in a humidified chamber and blocked with blocking solution (5% normal goat serum/Tris-buffered saline/Tween-20; TBST) for 30 min. CXCR4 was detected with a mouse anti-human CXCR4 monoclonal antibody (R&D Systems; 1∶1000) in blocking solution overnight at 4°C, followed by a biotinylated affinity purified goat anti-mouse IgG (H+L) secondary antibody (Vector Laboratories;1∶1000), in blocking solution for 30 min at RT. Specimens were washed thoroughly between incubations, developed in diaminobenzidine (Vector Laboratories) for 3 min at RT, and counterstained with Meyer's hematoxylin using standard techniques. A negative control tissue sample was prepared by incubating in biotinylated affinity purified goat anti-mouse IgG (H+L) antibody, only, as described above. The specimens were analyzed and photographed by Dr. Dezhi Wang [71] at the Center for Metabolic Bone Disease Core Laboratory, UAB School of Medicine, Birmingham, Alabama. The distribution of positive cells for CXCR4 was recorded to portray the diffuse or focal nature of the positive cells as sporadic (positive cells <5%); focal (positive cells >11% but less than 50%); or diffuse (positive cells >50%) according to the average density of positive cells for CXCR4 (DAB stained), to see the obvious difference in strength of CXCR4 expression.

Histomophometry Measurement of Staining Intensity for CXCR4 in Prostate Cancer Tissues

The average density of positive cells (DAB stained) was measured by using Bioquant® Image Analysis Software (RtmBometrics) and an Olympus BX51 Microscope with a Q-Imaging camera. The software analyzed an average group of pixels and returned a data value based on the color value of the pixels in stained samples. Three random fields of prostate tissues were selected at a magnification of (400X) for each section based on the size of the tissue. In each random area, those cells (a group of pixels) that were stained positively (brown) with the CXCR4 antibody were selected by the thresholding tool of the software. The specimen light source is known to affect density measurement; therefore, all sections were measured utilizing the same background correction supplied by Bioquant.

Subcellular Fractionation

PCa and normal prostate epithelial cells (1×106) were serum-starved for 3 hrs (22RV1 and RWPE1) or 24 hrs (PC3 and DU145), prior to treating with SDF1α (100 ng/ µl) for 30 min. Subcellular fractionations were performed per the manufacturer's instructions (Thermo Scientific). Briefly, cells were lysed in a series of buffers and centrifugation steps to obtain a non-nuclear fraction and an intact nuclear pellet, followed by further lysing to isolate nuclear proteins. Forty to one hundred micrograms of nuclear and non-nuclear fractions were separated by SDS-PAGE electrophoresis and transferred to PVDF membranes. Expression of CXCR4 or GFP-CXCR4 fusion protein was detected with a mouse monoclonal GFP antibody (Santa Cruz; 1∶500) or anti-human CXCR4 antibody (R&D Systems; 1∶1000). Anti-topoisomerase I (Santa Cruz; 1∶1000) and anti-CD44 (Cell Signaling; 1∶1000) antibodies were used to ensure the integrity of fractions and as loading controls. X-ray films were scanned and Quantity One software program was used for densitometry analysis.

Indirect Immunocytochemistry (ICC) for CXCR4

Cells (3×105) were plated on glass coverslips (Fisher), serum-starved as described, prior to treatments with SDF1α (100 ng/ µl). Cells were fixed with ice-cold 100% methanol for 5 min at −20°C and washed with 1× PBS. Non-specific proteins were blocked in blocking solution (3% normal donkey serum/1% BSA/0.1% Triton X-100 in 1× PBS) for 30 min at RT, prior to incubating with CXCR4 (R&D Systems, 1∶100), Lamin A/C (Santa Cruz, 1∶100), or GFP mouse monoclonal antibody (Santa Cruz, 1∶100) in blocking solution at 4°C overnight. Secondary detection was with Cy3-conjugated donkey anti-mouse IgG or FITC conjugated anti-rabbit IgG (Jackson Immuno Research, 1∶1000) in blocking solution at RT for 1 hr, followed by three washes in 1× PBS. In some cases, nuclei were detected with propidium iodide (1 µg/ µl) or DAPI (1∶250) in 1× PBS prior to mounting in Aqua-Polymount (Polyscience, Inc). Images were taken at Georgia Institute of Technology, Atlanta, GA with a 63x Plan-Apochromat 63x/1.40 Oil DIC objective on a Zeiss LSM-510 UV Confocal Microscope at excitation 488 nm for FITC and 543 nm for Cy3 or at Clark Atlanta University, Atlanta, GA with Axiovision software 4.8.2 on a Zeiss Axio Imager.z1 fluorescence microscope at 40× magnification at excitation 470 nm for FITC, 358 nm for DAPI and 551 nm for Cy3.

Mutagenesis

R146A and R148A point mutations within the NLS, and deletion of the NLS, within GFP-CXCR4 fusion protein were generated using the Quik Change XL Site-Directed Mutagenesis Kit (Stratagene); pEGFPN1-CXCR4 served as the template [72]. The forward and reverse primers of R146A, R148A and the deleted NLS were (Integrated DNA Technologies): (i) R146A: FWD5′-CACGCCACCAACAGTCAGGCACCAAGGAAGCTGTTGGCTG-3′, REV 5′-CAGCCAACAGCTTCCTTGG; (ii) R148A: FWD5`-CCAACAGTCAGAGGCCAGCGAAGCTGTTGGCTGAAA-3`, REV 5`-TTTCAGCCAACAGCTTCGCTGGCCTCTGACTGTTGG-3`; and (iii) NLS deletion: FWD5′-CGCCACCAACAGTCAGCTGTTGGCTGAAAAGG-3′ and REV5′-CCTTTTCAGCCAACAGCTGACTGTTGGTGGCG-3′. The resultant plasmids were pEGFPN1-CXCR4R146A, pEGFPN1-CXCR4R148A and pEGFPN1-CXCR4ΔNLS. Positive CXCR4 mutant clones were selected with kanamycin and further purified by maxi-prep (Omega Bio-tek). Accuracy of the mutations was confirmed by DNA sequencing on an ABI 3130 xl Gene Analyzer Sequencer at Morehouse School of Medicine, Atlanta, GA.

Transient Transfections

Transient transfections were performed with 2 µg of concentrated DNA and jetPRIME® Polypus transfection, per the manufacturers' instructions. Briefly, PC3 cells were incubated with jetPRIME®-DNA complexes in 15% FBS/RPMI for 4 hrs and the media was replaced with 15% FBS in RPMI for an additional 18 hrs, prior to serum-starvation (24 hrs). Cells were then harvested for respective experiments.

Expression of Transportinβ1 (TRN1)

Serum-starved cells (5×106) were treated with SDF1α for 30 min prior to harvesting 60 µg of whole cell lysates for western blot analysis. Expression of TRN1 was detected with a mouse monoclonal antibody (Santa Cruz; 1∶1000); α-Tubulin or β-Actin was used as a loading control.

Immunoprecipitation

One milligram of PC3 whole cell lysates were immunoprecipitated for CXCR4 (Santa Cruz; 1 µg per 250 µg of protein) overnight at 4°C, followed by incubation with Protein A/G Plus-Agarose beads (Santa Cruz) for 2 hrs at 4°C. CXCR4-bound agarose beads were separated from lysate by a series of 3 washes with PBS and centrifugation at maximum speed for 1 min at 4°C. Beads were processed for western blot analysis for TRN1 (Santa Cruz; 1∶1000) and subsequently reprobed for CXCR4 with rabbit anti-CXCR4 (Santa Cruz, 1∶500) antibody followed by incubation with mouse anti-rabbit IgG (Cell Signaling) secondary antibody. Thirty micrograms of the supernatant obtained after incubation with agarose beads were also separated by 10% SDS-PAGE, and processed for western blot analysis for CXCR4 as described in characterization of CXCR4 antibody.

Short Interfering RNA Transfection

Transient transfection of TRN1 specific siRNA (Santa Cruz) was performed on PC3 cells plated on glass coverslips using JetPRIME®. Briefly, cells (2×105) were plated in 35 mm, 6 well dishes and transfected with 50 nM TRN1-siRNA (Santa Cruz) in 15% FBS/RPMI media at 37°C in 5% CO2 for 24 hours. Subsequently, transfected cells were serum-starved for 24 hrs, prior to immunocytochemistry analysis.

Immunoprecipitation of Gαi

Serum-starved cells (5×106) were treated with SDF1α for 30 min prior to harvesting for immunoprecipitation. Briefly, cells were washed in 1× PBS and gently scraped in NP-40 lysis buffer (1× PBS pH 7.4, 0.1% Triton × 100, 0.1% NP40 and 1× cocktail inhibitor). After 30 min incubation on ice, the lysate was centrifuged at 600 rcf/5 min/4°C). The supernatant was gently decanted, and the nuclear pellet was resuspended in lysis buffer, 10 times the volume of the nuclei pellet, and sonicated on ice for 3 sec. The lysate was centrifuged at 600 rcf/5 min/4°C, and 1 mg of supernatant was immunoprecipitated for CXCR4 (mouse monoclonal, Santa Cruz) overnight at 4°C, followed by incubation with Protein A/G Plus-Agarose beads (Santa Cruz) for 2 hrs at 4°C. CXCR4-bound agarose beads were separated from lysate by a series of 3 washes with NP40 lysis buffer and centrifugation (5000 pm/2 min/RT). The final wash was with 1× PBS. Beads were processed for western blot analysis and membranes were probed for Gαi (Cell Signaling; 1∶1000). Subsequently, the blots were reprobed for CXCR4 with rabbit anti-CXCR4 (Santa Cruz, 1∶500) antibody followed by incubation with mouse anti-rabbit IgG (Cell Signaling) secondary antibody. Topoisomerase1 (Santa Cruz) and anti-CD44 (Cell Signaling) were used to assess the purity of nuclei lysates.

Intranuclear Calcium (Ca2+) Mobilization

Serum-starved PC3 cells (2.5×105) were harvested to obtain intact nuclei in NP-40 lysis buffer as described above, prior to performing assay per the manufacturer's instructions (Enzo Life Sciences). Briefly, untreated isolated nuclei were resuspended in 100 µl of FluoForte dye-loading solution (Enzo Life Sciences) for 45 min at 37°C and 15 min at RT, then centrifuged at 600 rcf/5 min/RT. Solutions of AMD3100 (100 ng/ µl) and pertussis toxin (PTX) (200 ng/ml) were prepared in calcium free, phenol free RPMI. Nuclei samples were resuspended in 100 µl of AMD3100 and PTX, aliquoted into black-walled, clear bottom 96well plates, and incubated for 1 hr. Next, the SDF1α was added to samples in plates, (final dilution 100 ng/ µl) and incubated for 30 min at RT. Intranuclear calcium mobilization was determined by the intensity (increase) of fluorescent (FluoForte)-bound Ca2+ in the media. Results were measured on a microplate reader at excitation 490 nm and emission 525 nm. Each sample was prepared in triplicate per experiment, and performed at least three times.

Statistical Analysis

Where applicable, data were analyzed by a paired student's t-test or ANOVA using GraphPad Prism (GraphPad) software. P values less than 0.05 were considered significant.

Results

CXCR4 is Expressed in the Nucleus of Prostate Tissues

Previous domain analysis of CXCR4 suggested that CXCR4 contains a nuclear targeting signal between amino acids 90–170 [73]. A bioinformatics analysis using the PSORT II NLS prediction software (http://psort.ims.u-tokyo.ac.jp/) revealed a putative nuclear localization sequence, ‘RPRK’ [72], [74], [75], [76] between amino acids 146–149 within CXCR4 (Table 1). Additionally, a HomoloGene/NCBI database search for the NLS within CXCR4 revealed that ‘RPRK’ is been conserved among species, including chicken, mouse, chimpanzee and others (Table 2). Moreover, CXCR4 has been detected in the nucleus of several cancer tissues [68], [70]. Based on these data, we tested whether CXCR4 protein could be detected within the nucleus of prostate tissues. Using a prostate tissue microarray ranging from normal to high-grade metastatic lesions, we detected positive immunoreactivity for CXCR4 in prostate samples. Positive immunoreactivity was detected as sporadic (CXCR4 positive cells <5%), focal (CXCR4 positive cells >11%, but less than 50%), or diffuse (CXCR4 positive cells >50%), compared to the average total density of positive cells for CXCR4 (DAB stained). Samples with immunohistochemical scores of negative, weak or moderate staining, with sporadic to focal distributions, were considered to have ‘low’ expression, whereas diffuse distributions of staining were considered to have ‘high’ expression for CXCR4. Staining intensity was sporadic to focal in the nucleus of low grade prostate tissues (Fig. 1A), while high grade malignant tissues (Fig. 1A), displayed an increased staining intensity and diffuse expression of CXCR4 throughout the tissue compared to low grade. In both low and high grade tumors, a fraction of CXCR4 clearly co-localized with the nucleus. Staining intensity for CXCR4 was weak, or even null, in normal tissues (Fig. 1A).
Table 1

PSORT Prediction of Nuclear Localization Sequence (NLS) in CXCR4.

GeneNuclear localization sequenceAmino acid sequencePosition
CXCR4RPRKArg, Pro, Arg, Lys146 to 149

PSORT is a NLS prediction server to determine the NLS scores of amino acid residues of a protein. It receives amino acid sequence information of a source, e.g., human CXCR4, as inputs and subsequently analyzes the input sequence by applying stored rules for various sequence features of known protein sorting signals. Finally, it reports possible sequences for the input protein to be localized at each candidate site with additional information. The human CXCR4 sequence (NCBI assession number NP_001008540) was searched by the server, which provided a NLS score for each of the 356 residues comprising CXCR4. http://psort.hgc.jp/.

Table 2

Multiple Sequence Alignment of the Nuclear Localization Sequence (NLS) Region in CXCR4.

SpeciesMultiple sequence alignment
Human (NP003458.1)130ISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANV177
Mouse (NP034041.2)132ISLDRYLAIVHATNSQRPRKLLAEKAVYVGVWIPALLLTIPDFIFADVSQ181
Norway rat (NP071541.2)127ISLDRYLAIVHATNSQRPRKLLAEKAVYVGVWIPALLLTIPDIIFADV174
Dog (NP001041491.1)131ISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANV178
Chicken (NP989948.2)140ISLDRYLAIVHATNSQRPRKLLAEKIVYVGVWLPAVLLTVPDIIFAST187
Chimpanzee (NP001009047.1)130ISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANV177

HomoloGene database (NCBI) is a system for automated detection of homologs among the annotated genes of several completely sequenced eukaryotic genomes. Sequences of input organisms are compared then matched into groups using a taxonomic tree built from sequence similarity; highly related organisms are matched up first. http://www.ncbi.nlm.nih.gov/homologene/20739.

Figure 1

Immunohistochemical (IHC) Staining of Prostate Tissues for CXCR4.

, A human prostate tissue array, ranging from normal to high-grade prostate cancer, was evaluated by IHC for CXCR4 expression using standard methods. Samples were evaluated at magnification 40X, using a Q-Imaging camera of Olympus BX51 Microscope with Bioquant® Image Analysis Software (RtmBometrics). Normal prostate tissues demonstrated slightly weak or undetectable brown staining for CXCR4 (positive cells<5%), and no CXCR4 expression in the nucleus. Representative low grade prostate tissue (grade 2, stage II, T2N0M0, adenocarcinoma) demonstrated random/focal positive staining for CXCR4 in the nucleus (positive cells >11%, but less than 50%), indicating low expression of CXCR4. Representative high grade metastatic prostate tissue (grade 4, stage IV, T4N1M1, adenocarcinoma) demonstrated diffuse/intense staining (positive cells >50%), indicating high expression for CXCR4 in the nucleus. Scale bar represents 50 µm. , CXCR4 IgG2B mouse monoclonal antibody was evaluated for specificity to CXCR4 protein by western blot analysis in PC3 (CXCR4 positive) or 293T (CXCR4 null) cell lines. , CXCR4 antibody was evaluated for specificity to CXCR4 protein by immunoprecipitation for CXCR4 and western blot analysis for CXCR4. , CXCR4 IgG2B antibody was evaluated for specificity to CXCR4 protein by immunoprecipitation with Fibronectin IgG2B mouse monoclonal antibody (unrelated isotype control) and western blot analysis for CXCR4; expression of Fibronectin protein was confirmed by western blot analysis. Beta-actin was used as a loading control.

Immunohistochemical (IHC) Staining of Prostate Tissues for CXCR4.

, A human prostate tissue array, ranging from normal to high-grade prostate cancer, was evaluated by IHC for CXCR4 expression using standard methods. Samples were evaluated at magnification 40X, using a Q-Imaging camera of Olympus BX51 Microscope with Bioquant® Image Analysis Software (RtmBometrics). Normal prostate tissues demonstrated slightly weak or undetectable brown staining for CXCR4 (positive cells<5%), and no CXCR4 expression in the nucleus. Representative low grade prostate tissue (grade 2, stage II, T2N0M0, adenocarcinoma) demonstrated random/focal positive staining for CXCR4 in the nucleus (positive cells >11%, but less than 50%), indicating low expression of CXCR4. Representative high grade metastatic prostate tissue (grade 4, stage IV, T4N1M1, adenocarcinoma) demonstrated diffuse/intense staining (positive cells >50%), indicating high expression for CXCR4 in the nucleus. Scale bar represents 50 µm. , CXCR4 IgG2B mouse monoclonal antibody was evaluated for specificity to CXCR4 protein by western blot analysis in PC3 (CXCR4 positive) or 293T (CXCR4 null) cell lines. , CXCR4 antibody was evaluated for specificity to CXCR4 protein by immunoprecipitation for CXCR4 and western blot analysis for CXCR4. , CXCR4 IgG2B antibody was evaluated for specificity to CXCR4 protein by immunoprecipitation with Fibronectin IgG2B mouse monoclonal antibody (unrelated isotype control) and western blot analysis for CXCR4; expression of Fibronectin protein was confirmed by western blot analysis. Beta-actin was used as a loading control. PSORT is a NLS prediction server to determine the NLS scores of amino acid residues of a protein. It receives amino acid sequence information of a source, e.g., human CXCR4, as inputs and subsequently analyzes the input sequence by applying stored rules for various sequence features of known protein sorting signals. Finally, it reports possible sequences for the input protein to be localized at each candidate site with additional information. The human CXCR4 sequence (NCBI assession number NP_001008540) was searched by the server, which provided a NLS score for each of the 356 residues comprising CXCR4. http://psort.hgc.jp/. HomoloGene database (NCBI) is a system for automated detection of homologs among the annotated genes of several completely sequenced eukaryotic genomes. Sequences of input organisms are compared then matched into groups using a taxonomic tree built from sequence similarity; highly related organisms are matched up first. http://www.ncbi.nlm.nih.gov/homologene/20739. We have reported that PC3 cells were positive and 293T cells were null, respectively, for CXCR4 protein [21]. To ensure the specificity of CXCR4 monoclonal antibody (MAB172IgG2b) used to detect its corresponding protein in the nucleus of prostate tissues, we re-analyzed PC3 and 293T for CXCR4 with CXCR4 antibody (MAB172IgG2b) by western blot analysis (Fig. 1B). Similar to our previous studies, CXCR4 was detected in PC3 but not in 293T whole cell lysates (Fig. 1B). Subsequent analysis of cell lysates by immunoprecipitation with MAB172 IgG2b followed by western blot analysis with MAB172 IgG2b detected CXCR4 only in PC3 lysates (Fig. 1C). To further confirm the specificity of MAB172IgG2b to CXCR4, PC3 cell lysates were subjected to immunoprecipitation with Fibronectin IgG2b, an isotype control, followed by western blot analysis with MAB172 IgG2b (Fig. 1D). Fibronectin was not detected by IP with CXCR4, but was detected by western blot with a Fibronectin antibody (Fig. 1D).

CXCR4 is Present in Nuclear Fractions of Prostate Cancer Cells

We used biochemical fractionation to confirm the nuclear localization of CXCR4 detected in our tissue staining. PCa cell lines were fractionated into nuclear and non-nuclear samples for detection of CXCR4 by western blot analysis (Fig. 2A). We found that normal prostate epithelial cells (RWPE1) were null for CXCR4 [77]; however, three CXCR4-expressing PCa cell lines (22RV1, DU145 and PC3) dually expressed CXCR4 in both nuclear and non-nuclear fractions independent of SDF1α stimulation (Fig. 2A). The purity of subcellular fractions was confirmed by expression of CD44, a non-nuclear marker [78], and topoisomerase 1, a nuclear marker [79], which ruled out the possibility that expression of CXCR4 observed in nuclear fractions was due to contamination.
Figure 2

Nuclear CXCR4 Expression in Prostate Cancer Cell Lines.

, Normal prostate epithelial (RWPE1) and PCa (PC3, DU145, 22RV1) cells were stimulated with SDF1α (100 ng/ µl) prior to subcellular fractionation into non-nuclear and nuclear fractions. Immunoblots were probed with anti-CXCR4. Anti-CD44 (non-nuclear) and anti-Topoisomerase1 (Topo 1, nuclear) were used as markers for fractionation purity and as loading controls. The bar graphs are quantitative results of the band density representing expression of CXCR4 in each fraction. Data were mean +S.E. from three independent experiments. *, P<0.05. , Immunocytochemistry of PCa cell lines for CXCR4. PCa cells were stimulated with SDF1α (100 ng/ µl), fixed with methanol, blocked then incubated with an antibody mixture containing a mouse anti-CXCR4 monoclonal antibody and a rabbit polyclonal anti-Lamin A/C antibody, followed by secondary mixture containing a Cy3-conjugated anti-mouse antibody and FITC-conjugated anti-rabbit antibody. Imaging was with a Zeiss LSM-510 UV Confocal Microscope using the 63× Plan-Apochromat 63x/1.40 Oil DIC objective at excitation 488 nm for FITC and 543 nm for Cy3. Confocal images demonstrating the plasma membrane and cytosolic localization of CXCR4 (red), intact nuclear membrane (green), and nuclear-associated localization of CXCR4 (yellow/orange) are shown. Small arrows indicate co-localization of CXCR4 with the nucleus (yellow/orange). Scale bars represent 50 µm.

Nuclear CXCR4 Expression in Prostate Cancer Cell Lines.

, Normal prostate epithelial (RWPE1) and PCa (PC3, DU145, 22RV1) cells were stimulated with SDF1α (100 ng/ µl) prior to subcellular fractionation into non-nuclear and nuclear fractions. Immunoblots were probed with anti-CXCR4. Anti-CD44 (non-nuclear) and anti-Topoisomerase1 (Topo 1, nuclear) were used as markers for fractionation purity and as loading controls. The bar graphs are quantitative results of the band density representing expression of CXCR4 in each fraction. Data were mean +S.E. from three independent experiments. *, P<0.05. , Immunocytochemistry of PCa cell lines for CXCR4. PCa cells were stimulated with SDF1α (100 ng/ µl), fixed with methanol, blocked then incubated with an antibody mixture containing a mouse anti-CXCR4 monoclonal antibody and a rabbit polyclonal anti-Lamin A/C antibody, followed by secondary mixture containing a Cy3-conjugated anti-mouse antibody and FITC-conjugated anti-rabbit antibody. Imaging was with a Zeiss LSM-510 UV Confocal Microscope using the 63× Plan-Apochromat 63x/1.40 Oil DIC objective at excitation 488 nm for FITC and 543 nm for Cy3. Confocal images demonstrating the plasma membrane and cytosolic localization of CXCR4 (red), intact nuclear membrane (green), and nuclear-associated localization of CXCR4 (yellow/orange) are shown. Small arrows indicate co-localization of CXCR4 with the nucleus (yellow/orange). Scale bars represent 50 µm. We further confirmed CXCR4 in nuclei of PCa cell lines by indirect immunohistochemistry (ICC) (Fig. 2B). In all three cell lines, we found CXCR4 to be ubiquitously expressed throughout the cells, or as distinct foci around the nucleus, at the PM and in the cytoplasm, independent of SDF1α treatment. Collectively, these observations suggest that CXCR4 is expressed at the PM, but also associated with the nucleus of PCa cells.

A Putative NLS in CXCR4

Nuclear-localized PM receptors must contain a nuclear localization sequence (NLS) to permit transport to and/or into the nucleus [80]. To determine whether the PSORT II-predicted NLS, ‘146RPRK149’ was functional and contributed to nuclear expression of CXCR4, we evaluated the intracellular distribution of wildtype GFP-tagged CXCR4 (pEGFPN1-CXCR4, GFP-CXCR4 fusion protein), two mutated fusion proteins in which arginine 146 and 148 were separately mutated to an alanine (CXCR4R146A and CXCR4R148A, respectively), as well as a fusion protein where the NLS was deleted (CXCR4ΔNLS). Plasmids encoding GFP-CXCR4 were transfected into PC3 cells and examined by ICC microscopy (Fig. 3). The localization pattern of GFP-CXCR4 at the plasma membrane and in the cytoplasm was consistent with endogeneous CXCR4 (Fig. 3A). Previous studies have reported an expression pattern for GFP-CXCR4 similar to our observation in other cancer cell lines [81], [82]. Wild-type GFP-tagged CXCR4 was localized predominantly at the PM, with some localization at the nucleus in untreated cells (Fig. 3B). However, an increase in punctate staining was observed at the nucleus/nuclear membrane upon treatment with SDF1α. Interestingly, both CXCR4R146A (Fig. 3B) and CXCR4R148A (data not shown) were detectable at the nucleus, suggesting that neither R146A nor R148A mutations in the NLS were sufficient to inhibit CXCR4 localization to the nucleus. To further examine the requirement of this NLS to localize CXCR4 to the nucleus, we deleted the NLS, ‘146RPRK149’, within pEGFPN1-CXCR4 (CXCR4ΔNLS). We detected CXCR4ΔNLS at the PM and diffusely throughout the cytosol, similar to wild-type GFP-CXCR4, but we did not detect CXCR4ΔNLS at the nucleus (Fig. 3B). To further confirm that CXCR4ΔNLS was excluded from the nucleus, PC3 cells were transiently transfected with wildtype GFP-CXCR4 or CXCR4ΔNLS then fractionated into nuclear and non-nuclear samples for analysis by western blot analysis (Fig. 3C). Consistent with ICC observations, we found that wild type GFP-CXCR4 and CXCR4ΔNLS were both detectable in non-nuclear fractions, while only GFP-CXCR4 was detected in nuclear fractions. Collectively, these data suggest that the ‘RPRK’ motif may be involved in localization of CXCR4 to the nucleus in prostate cancer.
Figure 3

A Putative Functional NLS within CXCR4.

, GFP-CXCR4 fusion protein localized similar to endogenous CXCR4. CXCR4-pEGFPN1 transfected PC3 cells were stimulated with SDF1α, fixed with methanol, blocked then incubated with a mouse anti-CXCR4 monoclonal antibody, followed by a Cy3-conjugated anti-mouse secondary antibody. Nuclei were stained with DAPI (blue). Images were taken at 40× maginification using Axiovision software 4.8.2 with a Zeiss Axio Imager.z1 fluorescence microscope at ex = 470 nm for FITC, ex = 358 nm for DAPI and ex = 551 nm for Cy3. Images demonstrate the co-localization (yellow) of endogenous CXCR4 (red) with GFP-tagged CXCR4 (green). , Localization analysis of wild type CXCR4 (CXCR4-pEGFPN1), NLS-mutant of CXCR4 (pEGFPN1-CXCR4R146A,) and deleted NLS of CXCR4 (CXCR4ΔNLS) by immunocytochemistry in PC3 cells. Nuclei were stained with propidium iodide (red) and CXCR4 was detected as the fusion protein GFP-CXCR4 (green). Imaging was with a Zeiss LSM-510 UV Confocal Microscope using the 63× Plan-Apochromat 63x/1.40 Oil DIC objective at ex = 488 nm for FITC and ex = 543 nm for Cy3. Scale bars represent 50 µm. , Transfected cells were stimulated with SDF1α prior to subcellular fractionation into non-nuclear and nuclear fractions. Immunoblots were probed with anti-GFP to detect the fusion protein GFP-CXCR4. Anti-CD44 (non-nuclear) and anti-Topoisomerase1 (Topo 1, nuclear) were used as markers for fractionation purity and as loading controls.

A Putative Functional NLS within CXCR4.

, GFP-CXCR4 fusion protein localized similar to endogenous CXCR4. CXCR4-pEGFPN1 transfected PC3 cells were stimulated with SDF1α, fixed with methanol, blocked then incubated with a mouse anti-CXCR4 monoclonal antibody, followed by a Cy3-conjugated anti-mouse secondary antibody. Nuclei were stained with DAPI (blue). Images were taken at 40× maginification using Axiovision software 4.8.2 with a Zeiss Axio Imager.z1 fluorescence microscope at ex = 470 nm for FITC, ex = 358 nm for DAPI and ex = 551 nm for Cy3. Images demonstrate the co-localization (yellow) of endogenous CXCR4 (red) with GFP-tagged CXCR4 (green). , Localization analysis of wild type CXCR4 (CXCR4-pEGFPN1), NLS-mutant of CXCR4 (pEGFPN1-CXCR4R146A,) and deleted NLS of CXCR4 (CXCR4ΔNLS) by immunocytochemistry in PC3 cells. Nuclei were stained with propidium iodide (red) and CXCR4 was detected as the fusion protein GFP-CXCR4 (green). Imaging was with a Zeiss LSM-510 UV Confocal Microscope using the 63× Plan-Apochromat 63x/1.40 Oil DIC objective at ex = 488 nm for FITC and ex = 543 nm for Cy3. Scale bars represent 50 µm. , Transfected cells were stimulated with SDF1α prior to subcellular fractionation into non-nuclear and nuclear fractions. Immunoblots were probed with anti-GFP to detect the fusion protein GFP-CXCR4. Anti-CD44 (non-nuclear) and anti-Topoisomerase1 (Topo 1, nuclear) were used as markers for fractionation purity and as loading controls.

CXCR4 Demonstrated an Interaction with Transportinβ1

We identified a putative NLS motif that could be critical for CXCR4 nuclear localization; however, the motif ‘RPRK’ is not a typical classical NLS [60]. In fact, such sequences can also mediate direct binding to other transport receptors. Among the different molecules that are involved in the transport of various cargos to the nucleus, members of the karyopherin beta (β) family contribute directly or indirectly to the nuclear shuttling of molecules [83]. Transportinβ1 (TRN1), also known as Karyopherinβ2, is a transport molecule of the importin-β family that has been linked to desensitization [63] and nuclear-cytoplasmic shuttling of receptors [84], [85], [86], [87], [88], [89]. To test whether TRN1 was involved in CXCR4 transport to the nucleus, we first established that PC3 cells expressed TRN1 by western blot analysis (Fig. 4A); 293T cells served as a positive control for TRN1 expression. Next, we tested for an interaction between CXCR4 and TRN1. We immunoprecipitated CXCR4 from whole cell lysates and tested for co-purification of TRN1 by western blot analysis. Figure 4B demonstrates that CXCR4 and TRN1 associated in PC3 cell lysates. To test whether the association between CXCR4 and TRN1 led to CXCR4 translocation to the nucleus, we decreased TRN1 protein expression by siRNA (Fig. 4C), then determined CXCR4 localization by ICC. We first confirmed an effective siRNA-mediated depletion of TRN1 by western blot analysis (Fig. 4C). As previously described in control cells, CXCR4 localized to the PM, in the cytoplasm and in distinct foci around the nucleus. When TRN1 expression was diminished, CXCR4 was undetectable around the nucleus, even in the presence of SDF1α (Fig. 4D).
Figure 4

CXCR4 and TRN1 Demonstrate an Interaction.

, Sixty micrograms of total protein were analyzed for TRN1 expression by western blot analysis using a TRN1 specific antibody. Alpha-tubulin served as a loading control. , One milligram of PC3 whole cell lysate was immunoprecipitated with anti-CXCR4 and separated by SDS-PAGE. Immunocomplexes were probed with anti-TRN1 or anti-CXCR4 to ensure that CXCR4 interacted with TRN1 and was immunoprecipitated, respectively. Thirty micrograms of whole cell PC3 supernatant, post-immunoprecipitation, were separated by SDS-PAGE and harvested for western blot analysis to assess the efficiency of CXCR4 immunoprecipitation. , Cells were transiently transfected with TRN1-specific siRNA to determine an effective concentration ( ), prior to harvesting for immunohistochemistry with anti-Lamin A/C and anti-CXCR4 ( ). Images were taken using Zeiss Axio Imager.z1 fluorescence microscope at 40× magnification at excitation 470 nm for FITC and 551 nm for Cy3. Small arrows indicate co-localization of CXCR4 with the nucleus (yellow/orange). Scale bar represents 50 µm.

CXCR4 and TRN1 Demonstrate an Interaction.

, Sixty micrograms of total protein were analyzed for TRN1 expression by western blot analysis using a TRN1 specific antibody. Alpha-tubulin served as a loading control. , One milligram of PC3 whole cell lysate was immunoprecipitated with anti-CXCR4 and separated by SDS-PAGE. Immunocomplexes were probed with anti-TRN1 or anti-CXCR4 to ensure that CXCR4 interacted with TRN1 and was immunoprecipitated, respectively. Thirty micrograms of whole cell PC3 supernatant, post-immunoprecipitation, were separated by SDS-PAGE and harvested for western blot analysis to assess the efficiency of CXCR4 immunoprecipitation. , Cells were transiently transfected with TRN1-specific siRNA to determine an effective concentration ( ), prior to harvesting for immunohistochemistry with anti-Lamin A/C and anti-CXCR4 ( ). Images were taken using Zeiss Axio Imager.z1 fluorescence microscope at 40× magnification at excitation 470 nm for FITC and 551 nm for Cy3. Small arrows indicate co-localization of CXCR4 with the nucleus (yellow/orange). Scale bar represents 50 µm.

Nuclear-associated CXCR4 is Functional

Finally, we sought to determine whether CXCR4 receptors at the nucleus are functional. Upon ligand stimulation and activation, GPCRs, including CXCR4, dissociates from a trimer of G-proteins (Gα and Gβγ) which initiates secondary signaling pathways, such as increased cyclic AMP, increased intracellular calcium levels, and others [90]. Thus, a reduction in the G-alpha protein, Gαi, associated with CXCR4 represents an active state of a receptor. Therefore, we co-immunoprecipitated CXCR4 and Gαi and determined Gαi expression levels by Western blot analysis, to assess whether nuclear-associated CXCR4 was active. Whole cells were stimulated with SDF1α then harvested to isolate intact nuclei (Fig. 5A). Nuclei were lysed, then immunoprecipitated with anti-CXCR4, prior to immunobloting for associated Gαi. In untreated cells, we observed a basal level in Gαi expression, which decreased upon treatment with SDF1α, suggesting that nuclear-associated CXCR4 is functional and can respond to SDF1α.
Figure 5

Nuclear CXCR4 was Functional at the Nucleus.

, Representative light images of whole cells and isolated nuclei confirmed the integrity of nuclear isolation at 20× magnification. , Whole cells were treated with SDF1α prior to isolating and lysing intact nuclei. Nuclei lysates (1 mg) were immunoprecipitated with anti-CXCR4 and separated by SDS-PAGE. Immunocomplexes were probed for Gαi (first row) or CXCR4 antibody (second row), respectively. Anti-CD44 (non-nuclear) and anti-Topoisomerase1 (Topo1, nuclear) were used as markers for fractionation purity and as loading controls. , PC3 nuclei were isolated, incubated with FluoForte dye Ca2+ probe, followed by incubation with AMD3100 or pertussis toxin (PTX) for 1 hr, then stimulated with SDF1α for 30 min. An increase in fluorescent-bound Ca2+ was measured on a microplate reader at ex = 490 nm/em = 525 nm.

Nuclear CXCR4 was Functional at the Nucleus.

, Representative light images of whole cells and isolated nuclei confirmed the integrity of nuclear isolation at 20× magnification. , Whole cells were treated with SDF1α prior to isolating and lysing intact nuclei. Nuclei lysates (1 mg) were immunoprecipitated with anti-CXCR4 and separated by SDS-PAGE. Immunocomplexes were probed for Gαi (first row) or CXCR4 antibody (second row), respectively. Anti-CD44 (non-nuclear) and anti-Topoisomerase1 (Topo1, nuclear) were used as markers for fractionation purity and as loading controls. , PC3 nuclei were isolated, incubated with FluoForte dye Ca2+ probe, followed by incubation with AMD3100 or pertussis toxin (PTX) for 1 hr, then stimulated with SDF1α for 30 min. An increase in fluorescent-bound Ca2+ was measured on a microplate reader at ex = 490 nm/em = 525 nm. We further tested the functionality of nuclear-associated CXCR4 by assessing whether the receptor stimulated release of intra-nuclear Ca2+. Isolated intact PC3 nuclei were incubated with Ca2+-binding fluorescent probe (FluoForte® dye), then incubated with CXCR4 antagonist, AMD3100, or Gαi/Gαo inhibitor pertussis toxin (PTX), separately for one hour, followed by treating with SDF1α. Calcium mobilization was determined by an increase in fluorescent probe in the media, and measured at ex = 490 nm/em = 525 nm. We observed a significant increase in intra-nuclear Ca2+ release from nuclei stimulated with SDF1α, compared to untreated samples. Further, AMD3100 antagonized CXCR4 function, which resulted in decreased Ca2+ levels, lower than SDF1α-treated samples. PTX prevents G-proteins from interacting with GPCRs, thus interfering with intracellular communication. As such, we did not observe an increase in Ca2+-mobilization in PTX-treated nuclei, even in the presence of SDF1α, supporting that the intra-nuclear Ca2+ surge was evoked by CXCR4, yet sensitive to PTX inhibition. Our results are in agreement with earlier studies that observed functional GPCRs associated with the nucleus, and that these nuclear GPCRs mobilized Ca2+ [40], [91], [92].

Discussion

This study established that CXCR4 receptor protein is expressed in PCa cells and is associated with the nucleus in these cells. Additionally, we provide insight into a specific nuclear protein import mechanism that contributes to nuclear localization of CXCR4. Importantly, CXCR4 responded to its ligand, SDF1α, at the nucleus. Nuclear localization of CXCR4 may be a mechanism by which prostate cancer cells employ to survive, even after the insult of chemotherapy. Therefore, antagonizing nuclear transport pathways and/or the action of nuclear CXCR4, could provide a rational approach to prevention and management of prostate cancer. PCa mortality is often a result of metastasis to secondary organs. CXCR4 is involved in the metastatic spread of primary tumor cells through activation of requisite pathways, which signals to downstream targets for invasion and movement through the vasculature, the establishment of a blood supply at the new tumor site and inhibition of immunosurveillance mechanisms that will destroy the new tumor [22]. Taichman et al. [23] initially observed that CXCR4 facilitated PCa metastasis to the bone, the primary site of distal PCa colonization. SDF1α was constitutively expressed in the bone marrow by osetoblasts, fibroblasts, and endothelial cells, which directed cell migration, by attracting PCa cells that expressed CXCR4 on the plasma membrane. To date, CXCR4, like all GPCRs, is regarded as a plasma membrane receptor. However, an emerging concept is that GPCRs are translocated to the nucleus and other intracellular organelles, possibly after internalization [93]. For instance, Wright et al. reported that endogenous α1-adrenergic receptors (α1-ARs) localized to and signaled at nuclei in adult cardiac myocytes [94], and in 2012, the group described that α1-AR nuclear localization drove the formation of receptor oligomers and regulated signaling in adult cardiac myocytes [95], suggesting that GPCRs at the nucleus exhibited the same behavior as their PM counterparts. The biochemical mechanisms of CXCR4 intracellular localization to the nucleus, and subsequent functions, are not well understood. The generally accepted view of CXCR4 localization and signaling centers upon a PM-localized receptor that is activated by an extracellular ligand, SDF1α. This ligand then initiates intracellular signals through G-proteins that support favorable responses for tumor development. Following activation and subsequent signaling, the canon concept of events is that CXCR4 is rapidly internalized from the PM to attenuate signaling communication, and then recycled back to the PM as an inactivated receptor, or sorted to the lysosome for degradation; both processes are important for receptor signal termination [96], [97], [98]. Consistent with our findings reported here, GPCRs that have been detected at the nucleus were reported to have originated from the PM [38], [40], [99], [100]. The results of this study support an alternately-localized and functional CXCR4 receptor. As assessed by decreased Gαi expression and Ca2+ mobilization in the presence of SDF1α, CXCR4 participates in intra-nuclear signaling at the nucleus. Nuclear CXCR4 was initially observed in diverse tumor tissues [69], [70], [101], [102], [103] and correlated with significant predictors for poor overall malignant survival [103], lymphovascular invasion [104] and lymph node metastasis [105]. Our findings extended these observations further and provide evidence that: (i) CXCR4 was present at the nucleus of prostate tumor tissues and cell lines; (ii) nuclear CXCR4 contained a putative, functional NLS which excluded CXCR4 from the nucleus when deleted; and (iii) CXCR4 associated with TRN1 and depletion of TRN1 decreased localization of CXCR4 to the nucleus. To date, considerable evidence supports the presence of GPCRs at the PM, or within the perinuclear/nuclear compartments of cells, following ligand activation [40], [99], [106], [107]. It is well known that CXCR4 is highly expressed in malignant PCa cells [108] and is involved in metastasis [21], [22], [24], [109]; however, few reports have observed a subcellular localization for CXCR4 other than the PM and endosomes in tumor tissues. We observed positive staining for CXCR4 in the nucleus of PCa tissues; furthermore, the amount of nuclei positively stained for CXCR4 increased with the grade of the tumor. In PCa cell lines, unexpectedly, we detected CXCR4 in nuclear fractions of untreated cells; nuclear CXCR4 expression increased with SDF1α stimulation. Sun et al. demonstrated that PCa cells expressed SDF1α mRNA and secreted a biologically active protein [110]. Perhaps the nuclear expression of CXCR4 in untreated cells may result from autocrine signaling [111], [112]. Endogenous SDF1α ligand secreted by PCa cells may act upon PM-localized CXCR4 in an autocrine manner, resulting in receptor internalization and subsequent nuclear targeting of CXCR4. Our results do not support a correlation between increased nuclear CXCR4 expression and PCa metastasis, or the clinical relevance of nuclear CXCR4 expression in predicting PCa prognosis survival. However, Woo et al. predicted that high expression of nuclear CXCR4 in hormone receptor negative breast cancer was associated with the high possibility of lymph node metastasis [113]. The origin and functional relevance of nuclear CXCR4, and the precise mechanisms involved in its nuclear translocation, have yet to be established. Wang et al. presumed the presence of a non-traditional, nuclear localization sequence, ‘146RPRK149’, within CXCR4, using C-terminal deletant plasmid constructs to reveal expression of CXCR4 at the nucleus [73]. Nuclear localization sequences are a stretch of positively charged, highly basic amino acids (lysines or arginines) [114] and are divided into two types: (i) the classical monopartite type containing a single cluster of 4–6 lysine(K)/arginine (R) amino acid residues; and the (ii) the bipartite type contains two clusters of basic amino acid residues separated by 10–12 amino acids [115]. The majority of non-classical types of NLSs consist of a single 20–40 long stretch of non-basic amino acids [116], [117], [118]. Some non-classical NLSs do not follow these rules, as they consist of a single short stretch of one or more basic amino acids that are distinct from the monopartite NLS [66], [119], [120], [121], [122], such as the motif ‘RPRK’. Ren et al. reported that mammalian target of rapamycin (mTOR) contained ‘RPRK’, and upon deletion, onion cells loss nuclear expression of mTOR [75]. Transportinβ1 studies on plasma membrane GPCRs have reported that they are functional and able to initiate signaling at the nucleus [38], [40], [91], [99]. Of particular interest, the importins beta, to which TRN1 belongs, were involved in nuclear localization of GPCRs, such as angiotensin 1, opiod growth factor, fibroblast growth factor receptors and CCR2 chemokine receptor [57], [84], [88], [123], [124], [125]. The canon concept of GPCR signaling is that signal transduction cascades are initiated at the PM, but not at the nuclear membrane. However, this concept has been disapproved by evidence which demonstrated that the nuclear envelope plays a major role in signaling cascades. For instance, GPCR-associated heterotrimeric G proteins [126], and downstream signaling molecules, such as adenylate cyclase [127], phospholipase C [128] and phospholipase D [126], have been found localized at the nucleus. Moreover, nuclear membranes have been shown to possess signaling molecules such as 1,4,5-triphosphate and inositol 1,3,4,5-tetrakisphosphate [128], further confirming the role that nuclear membranes play in signal transduction. We observed that nuclear CXCR4 was associated with Gαi in untreated samples; Gαi dissociated from CXCR4 upon SDF1α stimulation, compared to untreated samples, further confirming that nuclear CXCR4 is functional. Most studies that have reported functional nuclear GPCRs observed an increase in intra-nuclear Ca2+ levels upon stimulation with an appropriate agonist [40], [45], [91], emphasizing an importance of nuclear GPCRs to cells, since nuclear Ca2+ play pivotal roles in nuclear functions (cell division, proliferation, protein import, apoptosis, and gene transcription) [129]. Among the various reports where nuclear calcium was mobilized from organelles, such as the cytoplasm [130], nuclear lumen [131] and nucleoplasmic reticulum [132], the latter two have been suggested to increase/enhance signals initiated in the cytoplasm, and/or generate its own Ca2+ transients [131], [133]. Additionally, the amplitude and duration of calcium signals have also been shown to differentially control activation of transcription factors [134]. For instance, transcription factors, such as NF-κB, c-Jun, and N-terminal kinase are activated by transient increases in Ca2+ [134]. Taken together, data herein, and by our colleagues, emphasize a secondary GPCR signaling network at the nucleus, which may ensure, or enhance, the communication and coordination of numerous biochemical signals that are critical in regulating tumorigenic paradigms within the cell. In conclusion, the data presented provides the first clear evidence of CXCR4 located at the nucleus of cancer cells and existing as a functional, ligand-responsive receptor in advanced metastatic PCa cells. Therefore, antagonizing the action of nuclear CXCR4 could provide a rational approach to the prevention and management of PCa metastasis. Lee et al. [135] described a unique survival system in breast cancer cells by which VEGF acted as an intracrine survival factor through its binding to nuclear VEGFR1. This theory may hold true for tumor cells that express CXCR4 at the nucleus, and secrete SDF1α from the same cell. This study is significant to therapeutic development, as a functional CXCR4 receptor that can initiate signaling from inside the cell may escape from chemotherapeutic agents that are designed to antagonize the PM receptor, and/or cannot pass through the hydrophobic regions of the PM to reach nuclear receptors.
  121 in total

1.  Nuclear calcium signaling evoked by cholinergic stimulation in hippocampal CA1 pyramidal neurons.

Authors:  John M Power; Pankaj Sah
Journal:  J Neurosci       Date:  2002-05-01       Impact factor: 6.167

Review 2.  Calcium microdomains in mitochondria and nucleus.

Authors:  María Teresa Alonso; Carlos Villalobos; Pablo Chamero; Javier Alvarez; Javier García-Sancho
Journal:  Cell Calcium       Date:  2006-10-25       Impact factor: 6.817

Review 3.  G protein-coupled receptor adaptation mechanisms.

Authors:  S S Ferguson; M G Caron
Journal:  Semin Cell Dev Biol       Date:  1998-04       Impact factor: 7.727

4.  Identification of a novel nuclear localization signal in Sam68.

Authors:  T Ishidate; S Yoshihara; Y Kawasaki; B C Roy; K Toyoshima; T Akiyama
Journal:  FEBS Lett       Date:  1997-06-09       Impact factor: 4.124

5.  Target of rapamycin regulates development and ribosomal RNA expression through kinase domain in Arabidopsis.

Authors:  Maozhi Ren; Shuqing Qiu; Prakash Venglat; Daoquan Xiang; Li Feng; Gopalan Selvaraj; Raju Datla
Journal:  Plant Physiol       Date:  2011-01-25       Impact factor: 8.340

6.  Expression of CXCR4 and CXCL12 (SDF-1) in human prostate cancers (PCa) in vivo.

Authors:  Yan-Xi Sun; Jingcheng Wang; Charles E Shelburne; Dennis E Lopatin; Arul M Chinnaiyan; Mark A Rubin; Kenneth J Pienta; Russell S Taichman
Journal:  J Cell Biochem       Date:  2003-06-01       Impact factor: 4.429

7.  Involvement of an autocrine stromal cell derived factor-1/CXCR4 system on the distant metastasis of human oral squamous cell carcinoma.

Authors:  Daisuke Uchida; Tomitaro Onoue; Yoshifumi Tomizuka; Nasima Mila Begum; Yoshihiro Miwa; Hideo Yoshida; Mitsunobu Sato
Journal:  Mol Cancer Res       Date:  2007-07       Impact factor: 5.852

Review 8.  Classical nuclear localization signals: definition, function, and interaction with importin alpha.

Authors:  Allison Lange; Ryan E Mills; Christopher J Lange; Murray Stewart; Scott E Devine; Anita H Corbett
Journal:  J Biol Chem       Date:  2006-12-14       Impact factor: 5.157

Review 9.  Heptahelical receptor signaling: beyond the G protein paradigm.

Authors:  R A Hall; R T Premont; R J Lefkowitz
Journal:  J Cell Biol       Date:  1999-05-31       Impact factor: 10.539

10.  A nuclear localization domain in the hnRNP A1 protein.

Authors:  H Siomi; G Dreyfuss
Journal:  J Cell Biol       Date:  1995-05       Impact factor: 10.539

View more
  29 in total

1.  Intracellular GPCRs Play Key Roles in Synaptic Plasticity.

Authors:  Yuh-Jiin I Jong; Steven K Harmon; Karen L O'Malley
Journal:  ACS Chem Neurosci       Date:  2018-02-16       Impact factor: 4.418

Review 2.  GPCR signalling from within the cell.

Authors:  Yuh-Jiin I Jong; Steven K Harmon; Karen L O'Malley
Journal:  Br J Pharmacol       Date:  2017-10-03       Impact factor: 8.739

3.  Osteoblast regulation via ligand-activated nuclear trafficking of the oxytocin receptor.

Authors:  Adriana Di Benedetto; Li Sun; Carlo G Zambonin; Roberto Tamma; Beatrice Nico; Cosima D Calvano; Graziana Colaianni; Yaoting Ji; Giorgio Mori; Maria Grano; Ping Lu; Silvia Colucci; Tony Yuen; Maria I New; Alberta Zallone; Mone Zaidi
Journal:  Proc Natl Acad Sci U S A       Date:  2014-11-05       Impact factor: 11.205

Review 4.  New insights into mechanisms of nuclear translocation of G-protein coupled receptors.

Authors:  Vikrant K Bhosle; José Carlos Rivera; Sylvain Chemtob
Journal:  Small GTPases       Date:  2017-02-10

5.  Stress-induced CXCR4 promotes migration and invasion of ewing sarcoma.

Authors:  Melanie A Krook; Lauren A Nicholls; Christopher A Scannell; Rashmi Chugh; Dafydd G Thomas; Elizabeth R Lawlor
Journal:  Mol Cancer Res       Date:  2014-03-20       Impact factor: 5.852

6.  CXCR4 is highly expressed at the tumor front but not in the center of prostate cancers.

Authors:  Nicolas Barry Delongchamps; Frédéric Beuvon; Jacques R R Mathieu; Stéphanie Delmas; Isabelle Metzger; Hervé Prats; Florence Cabon
Journal:  World J Urol       Date:  2014-04-19       Impact factor: 4.226

7.  Glioblastoma development in mouse brain: general reduction of OCTs and mislocalization of OCT3 transporter and subsequent uptake of ASP+ substrate to the nuclei.

Authors:  Lilia Y Kucheryavykh; Kimberleve Rolón-Reyes; Yuriy V Kucheryavykh; Serguei Skatchkov; Misty J Eaton; Priscila Sanabria; William D Wessinger; Mikhail Inyushin
Journal:  J Neurosci Neuroeng       Date:  2014-02

8.  CXCR4, CXCL12 and the relative CXCL12-CXCR4 expression as prognostic factors in colon cancer.

Authors:  Luka Stanisavljević; Jörg Aßmus; Kristian Eeg Storli; Sabine Maria Leh; Olav Dahl; Mette Pernille Myklebust
Journal:  Tumour Biol       Date:  2015-12-17

9.  Simultaneous Activation of Induced Heterodimerization between CXCR4 Chemokine Receptor and Cannabinoid Receptor 2 (CB2) Reveals a Mechanism for Regulation of Tumor Progression.

Authors:  Christopher J Coke; Kisha A Scarlett; Mahandranauth A Chetram; Kia J Jones; Brittney J Sandifer; Ahriea S Davis; Adam I Marcus; Cimona V Hinton
Journal:  J Biol Chem       Date:  2016-02-03       Impact factor: 5.157

Review 10.  Insights into Nuclear G-Protein-Coupled Receptors as Therapeutic Targets in Non-Communicable Diseases.

Authors:  Salomé Gonçalves-Monteiro; Rita Ribeiro-Oliveira; Maria Sofia Vieira-Rocha; Martin Vojtek; Joana B Sousa; Carmen Diniz
Journal:  Pharmaceuticals (Basel)       Date:  2021-05-07
View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.