Literature DB >> 21660187

Modulation of HIV Binding to Epithelial Cells and HIV Transfer from Immature Dendritic Cells to CD4 T Lymphocytes by Human Lactoferrin and its Major Exposed LF-33 Peptide.

Laetitia Carthagena1, Pierre Becquart, Hakim Hocini, Michel D Kazatchkine, Hicham Bouhlal, Laurent Belec.   

Abstract

Lactoferrin (LF), a multifunctional molecule present in human secretions, has potent inhibitory activities against human immunodeficiency virus (HIV). The aim of the study was to evaluate whether human LF (hLF) and its exposed domain LF-33 represented by the peptide (LF-33-GRRRRSVQWCAVSQPEATKCFQWQRNMRKVRGP) involved in LF-HIV gag binding and endotoxines neutralization, may inhibit early steps of HIV mucosal transmission. Human LF and the peptide LF-33 inhibited the attachment of primary X4-tropic HIV-1(NDK) and R5-tropic HIV-1(JR-CSF) strains to human endometrial (HEC-1) and colorectal (HT-29) CD4-negative epithelial cells, the purified hLF being more potent (up to 80%) than the LF-33 peptide. In addition, the hLF, but not the LF-33 peptide, inhibited up to 40% the transfer in trans of HIV-1(JR-CSF) and HIV-1(NDK,) from immature dendritic cells to CD4 T lymphocytes, likely in a DC-SIGN-dependent manner. Altogether, these findings demonstrate that hLF can interfere with HIV-1 mucosal transmission by blocking virus attachment to epithelial cells and by inhibiting virus transfer from dendritic cells to CD4 T cells, two crucial steps of HIV dissemination from mucosae to lymphoid tissue.

Entities:  

Keywords:  HIV-1; Lactoferrin; mucosal transmission.

Year:  2011        PMID: 21660187      PMCID: PMC3109640          DOI: 10.2174/1874357901105010027

Source DB:  PubMed          Journal:  Open Virol J        ISSN: 1874-3579


INTRODUCTION

Lactoferrin (LF) is a major iron-binding protein of innate immunity against microbial infections, abundantly present in mucosal secretions [1]. An exposed site containing 33 residues (LF-33-GRRRRSVQWCAVSQPEATKCFQWQR NMRKVRGP) constitutes the glycosaminoglycans recognizing site of the human LF (hLF), whose first six N-terminus residues are critical for its anti-endotoxin activity [2]. Human LF has also been shown to exhibit potent antiviral activity in vitro against a wide range of viruses, including human immunodeficiency virus type 1 (HIV-1) [3-5]. The inhibitory activities of hLF against HIV-1 take place in early steps of infection, probably during adsorption of the virus to target cells [6]. The presence of two mutations in HIV-1 env gene in bovine LF-resistant HIV-1 variants further suggests that LF targets the HIV-1 entry process [7]. Following sexual transmission, epithelial cells, immature dendritic cells (iDC) present in the mucosa tissue, together with CD4 T lymphocytes, are the first cells to encounter the virus [8]. Infectious HIV-1 particles that are not sequestrated at apical surface of epithelial cells are captured by iDC and transported to the draining lymph nodes where the virus is efficiently transfered to CD4 T cells. In the initial phase, HIV-1 interacts with receptors expressed on iDC such as C-type lectin receptors (CLR). The dendritic cell-specific intercellular adhesion molecule-3-grabbing non-integrin (DC-SIGN) molecule plays a crucial role in binding HIV-1 through the gp120/41 envelope and in transmitting HIV-1 to target cells [9]. Recently, we demonstrated that hLF limited specifically the adsorption of R5- and X4- tropic free HIV-1 particles on endometrial HEC-1 epithelial cells by inhibiting virus adsorption on heparin-sulfated proteoglycans [10]. Furthermore, hLF was shown to strongly bind to DC-SIGN on dendritic cells, and prevent HIV-1 capture and transmission to CD4 T cells [11]. The region of the hLF involved in these mechanisms remains still to be clarified. The aim of the present study was to evaluate whether hLF and its exposed domain LF-33 involved in LF-HIV gag binding and endotoxines neutralization, may inhibit early steps of HIV mucosal transmission, including HIV-1 attachment to epithelial and dendritic cells, and HIV-1 transfer from iDC to CD4 T lymphocytes.

MATERIALS AND METHODOLOGY

Reagents and Antibodies

The hLF purified from human breastmilk was purchased from Sigma Aldrich (St Louis, Montana, USA); the Oregon Green 488 fluorescence conjugated lactoferrin from Molecular Probes (Oregon Green 488 fluorescence, Molecular probes, Belgium); the cytokines GM-CSF, IL-4, IL-2, the fluochrome-conjugated directed against CD4, CD1a, DC-SIGN, CD86, CD83, CXCR4 and CCR5, from R&D (R&D system, Oxon, UK) and BD Pharmingen (Le pont de Claix, France); the goat anti-rabbit-FITC from Jackson Immunoresearch, USA. The peptide LF-33 GRRRSVQWCAVSQPEATKCFQWQRNMRKVRGP was synthesized by Sequentia (SA, Evry, France). The [342-371]-DC-SIGN peptide YWNRGEPNNVGEEDCAEFSGN GWNDDKCNL, which corresponds to the carbohydrate recognition domain (CRD), was synthesized by Sigma Aldrich. Polyclonal anti-gp160 IgG were purified from a pool of sera sampled from HIV-1-infected patients (laboratoire de virologie, Hôpital Européen Georges Pompidou, Paris, France). The concentrations of hLF and LF-33 peptide in µg/ml correspond to 12.8 nM and 250 nM, respectively.

Cells

The human colorectal epithelial cells line HT-29, and endometrial cells HEC-1A were provided by the American Type Culture Collection, Manassas, VA (ATCC HTB-38). Cells were grown in RPMI 1640 medium complemented with 10% fetal calf serum (FCS), penicillin (100 IU/ml) and streptomycin (100 µg/ml). The HT-29 cells were CD4-, DC-SIGN-, CXCR4high+, CCR5low+ and GalCerhigh+, and the HEC-1 cells were CD4-, DC-SIGN-, CXCR4high+, CCR5-, GalCer high+ (not shown). Choice of cells were an intestinal cell line (HT-29) and an endometrial cell line (HEC-1), corresponding to two mucosal tissue largely involved in HIV acquisition in exposed people (intestinal and genital mucosae). Peripheral blood mononuclear cells (PBMC) were isolated from cytapheresis of healthy adult donors by Ficoll density gradient centrifugation on medium for separate of lymphocytes (Eurobio, Courtaboeuf, France). Purification of monocytes was performed using the so-called “roseting” technic. In brief, PBMC (107/ml) were incubated for 20 min in ice with sheep erythrocytes treated with 2-aminoethylisothiouronium bromide (AET) (vol/vol), and subjected to a second Ficoll centrifugation. The iDC were obtained by culturing monocytes (106/ml) in RPMI 1640 in heat-inactivated human serum (10%) in plastic culture plates for 1 h at 37°C. After washing, mononuclear adherent cells were cultured for 6 days in RPMI 1640 containing 10% FCS, penicillin (100 IU/ml), streptomycin (100 µg/ml), and IL-4/GM-CSF (R&D Systems Europe, Abingdon, Oxon, UK) both at 10 ng/ml by changing medium every 48 h. Autologous lymphocytes (PBL) were obtained from the pellet of the second Ficoll centrifugation after lysis of sheep erythrocytes (5 min NH4Cl). After washing, PBL were cultured in the presence of IL-2 (10 ng/ml) and phytohemaglutinin (PHA; 2.5 µg/ml) for 48 h at 37°C, 5% CO2. After washing, an additional culture was carried out for 24 h in the presence of IL-2 (10 ng/ml). The purity of iDC and T cells was assessed by morphological criteria and flow cytometry analysis (iDC: 90% or more pure; CD4 T cells: 85% or more pure).

Viral Strains

Primary X4-tropic strain HIV-1NDK and R5-tropic strain HIV-1JR-CSF were a gift of Prof. F. Barré-Sinoussi (Institut Pasteur, Paris, France). The HIV-1NDK viral stock was obtained by growing virus in IL-2-activated lymphocytes of healthy donors. The R5-tropic HIV-1BaL and HIV-1JR-CSF were amplified in monocyte-derived macrophages cultures. Primary strains are thought to be representative of viral strains not adapted to their microcellular environment. In addition, both monocytotropic (R5-tropic) and lymphocytotropic (X4-tropic) HIV-1 strains are present in genital secretions, and may participate to HIV mucosal crossing in an exposed receptive individual.

Flow Cytometry Assessment of hLF Binding to Epithelial and Dendritic Cells

The constitutive expression of LF by epithelial cells used in all experiments and the binding of exogenous hLF were analysed by flow cytometry. Briefly, iDC, HEC-1 and HT-29 cells (106 cells) were incubated with polyclonal antibody to LF for 30 min at 4°C, and the expression of LF was assessed after fixation of cells with 1% paraformaldehyde (PFA), by FACSCalibur™ and the CELL QUEST™ software (Becton Dickinson, New Jersey, USA). To analyse the binding of hLF and LF-33 peptide to epithelial cells and iDC, 106 cells were incubated with the Oregon Green 488 fluorescence conjugated LF at 10 and 30 µg/ml for 1 h in ice. Cells were fixed with 1% PFA, and subjected to flow cytometry. In order to evaluate possible involvement of the LF-33 peptide in the attachment of hLF in some experiments, cells were pre-incubated with LF-33 peptide at 20 µg/ml before addition of stained hLF.

Modulation of HIV Attachment to Epithelial Cells by hLF and LF-33 Peptide

To investigate the effect of LF-33 peptide and hLF on attachment of HIV-1 particles to epithelial cells, epithelial HT-29 and HEC-1 cells (106 cells/well) were incubated with various quantities of LF-33 peptide or hLF for 30 min at room temperature. Afterwards, viral particles from HIV-1BaL, HIV-1JR-CSF and HIV-1NDK strains (5 ng of p24 antigen) were added on epithelial cells, for 1 h at 37°C. After intensive washings (5-fold) with RPMI 1640, cells were lysed by addition of 1% Triton in PBS during 15 min at 37°C. Cell lysates were centrifuged, and the HIV-1 p24 antigen concentration was measured in the supernatant fractions by means of immunocapture enzyme-linked immunosorbent assay (HIV-1 core profile ELISA, DuPont de Nemours, Les Ulis, France).

Binding of hLF and LF-33 to DC-SIGN

The interactions between the HIV-1 glycoprotein gp160, the DC-SIGN and the hLF or LF-33 peptide were analysed by ELISA. Briefly, a synthetic [342-371]-DC-SIGN peptide YWNRGEPNNVGEEDCAEFSGNGWNDDKCNL, corresponding to the CRD domain including the gp120 binding site, was adsorbed on plastic plate (10 µg/ml) for 18 h at 4°C. The wells were then satured with PBS/skimmed milk (1%) for 2 h at 37°C. After washing, the DC-SIGN peptide was incubated with hLF (100 µg/ml) for 18 h at 4°C. The fixed LF was detected using hLF-specific antibodies coupled to peroxydase (1 µg/ml) and streptavidin (1/100, Perkin Elmer, Boston, USA). The optical density was meseared at 590 nm before ortho-phenylene diamine (OPD) (Pierce, Rockforf, USA) addition.

Inhibition Experiments of HIV Attachment and Transfer by hLF and LF-33

The immature phenotype of dendritic cells was checked before each experiment by flow cytometry for their expression of CD1a, CD83 and CD86, and of HIV-1 receptors and co-receptors (CD4, CCR5, CXCR4 and DC-SIGN), using FITC-conjugated anti-CCR5 and CD83 and PE-conjugated anti-CD4, CXCR4, DC-SIGN, CD1a and CD86 antibodies, for 30 min at 4°C. Cells (105 cells/ml) were washed in PBS/BSA (0.5%) and fixed in PFA (1%) before FACSCalibur™ and the CELL QUEST™ software analyses. Immature dendritic cells (105 cells per essay) were incubated with primary R5-tropic HIV-1JR-CSF and with X4-tropic HIV-1NDK (1 ng/ml of p24 antigen) for 1 h at 37°C. For inhibition experiments, cells were incubated with 30 and 100 µg of hLF and LF-33, respectively, before virus addition. Cells were then extensively washed, and the p24 antigen was measured by ELISA after Triton treatment of supernatants. Inhibition of HIV-1 transfer in trans to CD4 T lymphocytes by hLF and LF-33 peptide was investigated by incubation of cells with hLF and LF-33 before addition of virus. Cells were then washed, and IL-2- and PHA- activated autologous CD4 T lymphocytes (5x106 cells) were added, and the p24 antigen was measured at 3 days of co-culture.

Statistical Analyses

The non parametric Wilcoxon signed-rank and Friedman’s tests were used for statistical analyses.

RESULTS

Inhibition of HIV-1 Attachment to Epithelial Cells by hLF and LF-33 Peptide

We investigated whether hLF and LF-33 peptide were capable to inhibit attachment of free R5-tropic HIV-1BaL and HIV-1JR-CSF, and X4-tropic HIV-1NDK strains to HT-29 and HEC-1 epithelial cells. We first determined the LF baseline expression by epithelial cells. A neglected percent of epithelial cells expressed hLF, 0.6 and 0.8%, respectively (Fig. ). The HT-29 and HEC-1 cells were incubated with hLF conjugated to the Oregon Green 488 fluorochrome (10 µg and 30 µg), fixed and analysed by flow cytometry. The hLF binding to HEC-1 cells was at 17% (MFI 56) and 30% (MFI 70) when used at 10 µg and 30 µg, respectively. The hLF binding to the HT-29 cells was at 82% (MFI 27) and at 96% (MFI 50) when used at 10 µg and 30 µg/ml, respectively (Fig. , ). In order to evaluate whether the exposed LF-33 domain may be involved in hLF attachment to cells, competition experiments between fluorescent hLF and unconjugated-fluorochrome (used as control) or LF-33 peptide were carried out. The epithelial cells were pre-incubated with LF-33 peptide (or the cold lactoferrin), then washed and incubated with the fluorescent hLF. Attachment of hLF was determined by flow cytometry. Results of these experiments were analysed at two levels, according to the affinity of LF binding on epithelial cells. Thus, M1 gate allowed to estimate all cells binding hLF, while M2 gate was specific of the cells binding hLF with high affinity (stronger signal) (Fig. ). M1 and M2 gates were defined function of the fluorescent hLF alone control dot. As expected, a decrease of conjugated hLF attachment was observed when cells were pre-incubated with cold LF (Fig. ). Interestingly, the competition with LF-33 peptide experiment revealed an inhibition of hLF binding on HEC-1 and HT-29. Indeed, pre-incubation of the peptide was associated with a decreased total hLF binding, from 50% to 40% on HEC-1 cells, and from 43% to 17% on HT-29 cells (Fig. ). The competitor effect of LF-33 peptide were mainly observed on cell binding hLf with high affinity (Gate M2), since there was decrease from 10% to 3%, and from 33% to 4% of the LF binding on HEC-1 and HT-29, respectively. Moreover, LF-33 peptide inhibited more efficiently the hLF binding on HT-29 than HEC-1 (Fig. ). These results indicate that the LF-33 peptide binds on epithelial cells with a high affinity, and also on hLF cell membrane receptors. We further investigated whether hLF and LF-33 peptide were able to inhibit the attachment of free R5-tropic HIV-1JR-CSF and X4-tropic HIV-1NDK particles to HT-29 and HEC-1 epithelial cells. Cells were incubated with viruses in the presence of hLF and LF-33 peptide for 1 h at 37°C. Under these experimental conditions, we assume that internalisation of HIV particles via alternative receptor in CD4-negative epithelial cells can be considered as negligible. Cells were then washed and HIV-1 p24 antigen was measured. Pre-incubation of cells with human LF at 10 µg, 30 µg and 60 µg, leads to a decrease of 38%, 56% and 76% of the attachment of HIV-1JR-CSF (non parametric Friedman’s test for three paired groups; p<0.01) and of 43%, 58% and 60% of the attachment of HIV-1NDK (p<0.03), on HEC-1 cells (Fig. ), respectively; and of 24%, 47% and 64% of the attachment of HIV-1JR-CSF (p<0.01), and of 49%, 70% and 68% of the attachment of HIV-1NDK (p<0.02), on HT-29 cells (Fig. ). Irrelevant peptide control used instead LF-33 showed not effect on virus attachment (not shown). The LF-33 peptide exhibited a lower inhibitory effect on HIV-1 attachment to epithelial cells as compared to hLF. Indeed, the observed reductions of HIV-1JR-CSF binding on HEC-1 cells at 10 µg, 30 µg and 60 µg of LF-33 peptide were 28%, 41% and 38% (p<0.04), respectively, and those of HIV-1NDK bound on HEC-1 cells were 30%, 27% and 30% (p<0.05), respectively (Fig. ). The decreases of HIV-1JR-CSF attachment to HT-29 cells at 10 µg, 30 µg and 60 µg of LF-33 peptide were of 52%, 52% and 47% (p<0.04), respectively, and those of HIV-1NDK attachment on HEC-1 cells were 39%, 32% and 31% (p<0.05), respectively (Fig. ).

Inhibition of HIV-1 Transfer from iDC to T Cells by hLF, but Not by LF-33 Peptide

The dendritic cells used in all experiments presented an immature phenotype as demonstrated by the low expression of CD83 and the high expression of CD86 and CD1a; the iDC expressed also CD4 (70%), CXCR4 (22%), CCR5 (10%) and DC-SIGN at 85% (Fig. ). The incubation of iDC with hLF and LF-33 had no effect on the immature phenotype (data not shown). The Oregon-conjugated hLF used at 10 µg and 30 µg linked, in a dose-dependent manner, to iDC at 21 and 32%, respectively (Fig. ). The effect of hLF and LF-33 on the transfer of HIV-1 from iDC to autologous CD4 T lymphocytes was further investigated. Dendritic cells were incubated with HIV-1 and hLF or LF-33 peptide before washing and addition of IL2-activated T lymphocytes (1/5 ratio). Measurement of HIV-1 p24 antigen released at 72 h in the co-culture supernatant showed that at 30 µg and 100 µg, the percentages of HIV-1JR-CSF transfer by hLF were decreased by 56% and 61% (non parametric Wilcoxon signed-rank; p<0.01), respectively (Fig. ); and those of HIV-1NDK transfer were 44% and 64% (p<0.01), respectively (Fig. ). No inhibitory effect was observed when the LF-33 peptide was used. Unexpectedly, the incubation with the LF-33 peptide enhanced 3 to 6 fold the HIV-1 transfer from iDC to autologous CD4 T cells (p<0.01 for HIV-1JR-CSF and p <0.02 for HIV-1NDK), as shown in Fig. (), likely because the peptide increased the HIV-1 attachment to iDC (p<0.02 for HIV-1JR-CSF and p <0.03 for HIV-1NDK), as demonstrated by binding inhibition experiments (Fig. ). Irrelevant peptide control used instead LF-33 showed not effect on virus attachment to iDC nor on virus transfer from iDC to T cells (not shown). Finally, the interactions between hLF and DC-SIGN molecule were assessed by indirect ELISA using for coating the synthetic peptide «DC-SIGN 342-371» corresponding to CRD domain of DC-SIGN interacting with HIV-1 gp120. The ELISA optical densities were 1.36 in the presence of DC-SIGN peptide, and only 0.03 in its absence (Fig. ), demonstrating that hLF binds to the DC-SIGN peptide.

DISCUSSION

In the present study, purified hLF inhibited the attachment of free HIV-1 to epithelial cells. Indeed, hLF inhibited as much as 90% of the attachment of X4- and R5- tropic primary HIV-1 to human endometrial HEC-1 and colorectal epithelial HT29 cell lines. In addition, the effect of hLF on viral attachment on epithelial cells is likely mediated by the exposed domain LF-33. Indeed, the peptide LF-33 also inhibited significantly the attachment of primary X4- and R5- tropic HIV-1 to HEC-1 and HT-29 epithelial cells. Taken together, these findings demonstrate that the inhibitory effect of hLF on HIV attachment on epithelial cells previously reported by Saïdi and colleagues [10] is associated with the external domain LF-33 peptide. We further evaluated the ability of hLF to inhibit the transfer in trans of HIV-1 from iDC to CD4 T lymphocytes, which constitute one of the major steps of the rapid dissemination of HIV-1 from mucosa to lymphoid tissues [12]. In our hands, purified hLF inhibited up to 60% the virus transfer to CD4 T lymphocytes, whereas no inhibitory effect could be observed when using the LF-33 peptide. By comparison, the most neutralizing monoclonal antibody to gp120, IgGb12, induced up to 90% HIV-1 inhibition [13]. By contrast to hLF, the LF-33 peptide enhanced HIV-1 transfer from iDC to autologous CD4 T cells. These results suggest that the LF-33 exposed domain is not involved in hLF-associated inhibition of HIV-1 transfer to CD4 T lymphocytes. Since hLF binds to DC-SIGN, one can hypothesize that hLF could block the virus transfer to lymphocytes by hampering the iDC-PBL interaction. One can also speculate that LF-33 increases HIV-1 transfer to CD4 T lymphocytes by enhancing the virus binding to iDC. We showed that Oregon fluorescence-conjugated hLF was able to bind to epithelial cells in a dose-dependent manner reaching 40% of positive cells. The mechanisms by which hLF interacts with CD4-negative epithelial cells remains speculative. However, although both CD4 and coreceptors are essential for HIV-1 entry process, the initial association of HIV-1 particles to cells could occur in the absence of these receptors. Several observations pointed out that the attachment of HIV-1 particles to the cell surface occurs through interactions with heparan-sulfate proteoglycans and with the cell surface-expressed nucleolin [14-16], suggesting their possible involvement in HIV-1 attachment inhibition on epithelial cells by hLF. Thus, LF likely could exert its effect at the level of viral adsorption or penetration, in accordance with its highest effectiveness when administered before or simultaneous with the viral inoculum, as it occurs in vivo during breastfeeding and sexual transmission of HIV-1 [6]. The role of hLF in HIV-1 mucosal transmission remains unknown. The amounts of hLF used in our study (30 and 100 µg/ml) were largely below physiological concentrations, suggesting that the blocking properties of hLF on HIV-1 attachment, replication or transfer in trans, could likely modulate the efficiency of HIV acquisition through mucosal routes. However, reported observations about hLF levels in saliva and breast milk from HIV-1-infected individuals remain conflicting. Thus, both increases [17-19] and decreases [20, 21] in LF levels were reported. Although a linear correlation between low LF serum levels in HIV-infected pregnant women and perinatal transmission of HIV-1 to the neonate has been reported [22], no correlation could be found between the level of breast milk hLF in HIV-infected breastfeeding mothers and the transmission of virus to their children [18]. Finally, the presence of natural antibodies to hLF present in mucosal secretions may modulate the HIV-inhibitory activity of hLF [10]. Taken together, our observations demonstrate that hLF may interfere with HIV-1 mucosal transmission by blocking virus attachment to epithelial cells and by inhibiting virus transfer from iDC to CD4 T lymphocytes, two crucial steps of HIV dissemination from mucosae to lymphoid tissue. The differential effects of the LF-33 peptide on HIV attachment and HIV transfer suggest that hLF-mediated inhibition of early steps of HIV mucosal crossing may use two different pathways.
  21 in total

Review 1.  The role of mucosal immunity in prevention of HIV transmission.

Authors:  Pamela A Kozlowski; Marian R Neutra
Journal:  Curr Mol Med       Date:  2003-05       Impact factor: 2.222

2.  Pleiotrophin inhibits HIV infection by binding the cell surface-expressed nucleolin.

Authors:  Elias A Said; José Courty; Josette Svab; Jean Delbé; Bernard Krust; Ara G Hovanessian
Journal:  FEBS J       Date:  2005-09       Impact factor: 5.542

Review 3.  Lactoferrin structure and functions.

Authors:  Dominique Legrand; Annick Pierce; Elisabeth Elass; Mathieu Carpentier; Christophe Mariller; Joël Mazurier
Journal:  Adv Exp Med Biol       Date:  2008       Impact factor: 2.622

4.  Differential modulation of human lactoferrin activity against both R5 and X4-HIV-1 adsorption on epithelial cells and dendritic cells by natural antibodies.

Authors:  Héla Saidi; Jobin Eslahpazir; Jobin Eslaphazir; Cédric Carbonneil; Laetitia Carthagena; Mary Requena; Nadine Nassreddine; Laurent Belec
Journal:  J Immunol       Date:  2006-10-15       Impact factor: 5.422

Review 5.  Lactoferrin and the inflammatory response.

Authors:  R D Baynes; W R Bezwoda
Journal:  Adv Exp Med Biol       Date:  1994       Impact factor: 2.622

6.  Secretory anti-human immunodeficiency virus (HIV) antibodies in colostrum and breast milk are not a major determinant of the protection of early postnatal transmission of HIV.

Authors:  P Becquart; H Hocini; M Lévy; A Sépou; M D Kazatchkine; L Bélec
Journal:  J Infect Dis       Date:  2000-02       Impact factor: 5.226

7.  Inhibition with lactoferrin of in vitro infection with human herpes virus.

Authors:  K Hasegawa; W Motsuchi; S Tanaka; S Dosako
Journal:  Jpn J Med Sci Biol       Date:  1994-04

8.  Surface nucleolin participates in both the binding and endocytosis of lactoferrin in target cells.

Authors:  Dominique Legrand; Keveen Vigié; Elias A Said; Elisabeth Elass; Maryse Masson; Marie-Christine Slomianny; Mathieu Carpentier; Jean-Paul Briand; Joël Mazurier; Ara G Hovanessian
Journal:  Eur J Biochem       Date:  2004-01

Review 9.  Midkine, a cytokine that inhibits HIV infection by binding to the cell surface expressed nucleolin.

Authors:  Ara G Hovanessian
Journal:  Cell Res       Date:  2006-02       Impact factor: 25.617

10.  Comprehensive cross-clade neutralization analysis of a panel of anti-human immunodeficiency virus type 1 monoclonal antibodies.

Authors:  James M Binley; Terri Wrin; Bette Korber; Michael B Zwick; Meng Wang; Colombe Chappey; Gabriela Stiegler; Renate Kunert; Susan Zolla-Pazner; Hermann Katinger; Christos J Petropoulos; Dennis R Burton
Journal:  J Virol       Date:  2004-12       Impact factor: 5.103

View more
  5 in total

1.  Colorectal mucus binds DC-SIGN and inhibits HIV-1 trans-infection of CD4+ T-lymphocytes.

Authors:  Martijn J Stax; Emily E I M Mouser; Thijs van Montfort; Rogier W Sanders; Henry J C de Vries; Henk L Dekker; Carolina Herrera; Dave Speijer; Georgios Pollakis; William A Paxton
Journal:  PLoS One       Date:  2015-03-20       Impact factor: 3.240

Review 2.  Lactoferrin: A Glycoprotein Involved in Immunomodulation, Anticancer, and Antimicrobial Processes.

Authors:  Quintín Rascón-Cruz; Edward A Espinoza-Sánchez; Tania S Siqueiros-Cendón; Sayuri I Nakamura-Bencomo; Sigifredo Arévalo-Gallegos; Blanca F Iglesias-Figueroa
Journal:  Molecules       Date:  2021-01-03       Impact factor: 4.411

3.  Postnatally-transmitted HIV-1 Envelope variants have similar neutralization-sensitivity and function to that of nontransmitted breast milk variants.

Authors:  Genevieve G Fouda; Tatenda Mahlokozera; Jesus F Salazar-Gonzalez; Maria G Salazar; Gerald Learn; Surender B Kumar; S Moses Dennison; Elizabeth Russell; Katherine Rizzolo; Frederick Jaeger; Fangping Cai; Nathan A Vandergrift; Feng Gao; Beatrice Hahn; George M Shaw; Christina Ochsenbauer; Ronald Swanstrom; Steve Meshnick; Victor Mwapasa; Linda Kalilani; Susan Fiscus; David Montefiori; Barton Haynes; Jesse Kwiek; S Munir Alam; Sallie R Permar
Journal:  Retrovirology       Date:  2013-01-10       Impact factor: 4.602

4.  Adaptive HIV-specific B cell-derived humoral immune defenses of the intestinal mucosa in children exposed to HIV via breast-feeding.

Authors:  Sandrine Moussa; Mohammad-Ali Jenabian; Jean Chrysostome Gody; Josiane Léal; Gérard Grésenguet; Alain Le Faou; Laurent Bélec
Journal:  PLoS One       Date:  2013-05-21       Impact factor: 3.240

Review 5.  Interactions of Whey Proteins with Metal Ions.

Authors:  Agnieszka Rodzik; Paweł Pomastowski; Gulyaim N Sagandykova; Bogusław Buszewski
Journal:  Int J Mol Sci       Date:  2020-03-20       Impact factor: 5.923

  5 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.