Literature DB >> 21124649

Specific Investigation of Sample Handling Effects on Protease Activities and Absolute Serum Concentrations of Various Putative Peptidome Cancer Biomarkers.

Irene van den Broek, Rolf W Sparidans, Jan H M Schellens, Jos H Beijnen.   

Abstract

INTRODUCTION: In the search for novel cancer biomarkers, various proteolytically derived peptides have been proposed to exhibit cancer or cancer-type specificity. As these peptides are presumably also generated after sample collection by tumor-specific proteases, extensive investigation of the involved proteolytic processes is crucial for further research.
MATERIALS AND METHODS: Using two previously developed and fully validated liquid-chromatography coupled to tandem-mass spectrometry assays, absolute quantification of, in total, 13 proteolytically derived peptides in human serum was accomplished. The analytes included eight peptides derived from inter-α-trypsin inhibitor heavy chain-4 (ITIH(4)-30, ITIH(4)-29, ITIH(4)-28, ITIH(4)-27, ITIH(4)-26, ITIH(4)-25, ITIH(4)-22, and ITIH(4)-21), bradykinin, des-Arg(9)-bradykinin, Hyp(3)-bradykinin, and fragments from fibrinogen-α-chain (Fib-α ([605-629])) and complement component 4a (C4a ([1337-1350])). Samples were obtained from different healthy individuals and prepared with variable tube types, clotting times, and temperatures. Furthermore, stabilities in the serum fraction were assessed and compared to stabilities in serum from breast cancer patients. RESULTS AND DISCUSSION: The quantitative analyses showed either increasing or decreasing serum concentrations during blood coagulation, while comparable effects were observed in serum separated from the blood clot. Furthermore, comparisons of inter- and intra-individual variations suggested better reflection of an individual's protease activity after prolonged ex vivo incubation. This was illustrated for the putative breast cancer marker ITIH(4)-22, revealing better differentiation after incubation of serum at ambient temperature for 24 h.
CONCLUSION: The presented study provides suggestions for more specific and optimized sample preparation, as well as extended knowledge necessary to further explore the opportunities of these proteolytic peptides as cancer biomarkers.

Entities:  

Year:  2010        PMID: 21124649      PMCID: PMC2970821          DOI: 10.1007/s12014-010-9054-z

Source DB:  PubMed          Journal:  Clin Proteomics        ISSN: 1542-6416            Impact factor:   3.988


Introduction

Mass spectrometry-based profiling of the serum proteome is a well-known approach in the search for biomarker proteins able to predict specific cancer types in an early stage [1, 2]. As a result, also the low molecular weight serum proteome, or peptidome, has attracted increasing attention [3-5], and this has resulted in the proposal of various peptides with putative diagnostic characteristics for different types of cancer in the past years [6-11]. In addition to the classical principle that altered protein levels are directly caused by the cancer type, the upregulated or downregulated peptide concentrations have been related to cancer-specific interferences with protein or peptide breakdown pathways [3, 5]. Moreover, tumor-specific proteases, including endo- and exopeptidases, have been postulated to contribute to different serum peptidome profiles, also suggesting ex vivo generation of candidate discriminatory peptides after blood collection [10, 12, 13]. This hypothesis has received much criticism. On the one hand, because it is likely to be highly subjected to uncontrollable variables during sample collection, and on the other hand, because of the questionability of the tumor’s influence on the ex vivo peptide generation. As this process depends on the activity of coagulation and complement cascades, influences of other factors such as coagulation disturbances or infections are suggested [14-16]. The contribution of various non-cancer-related factors to serum peptidome profiles is widely accepted as a major source of bias and one generally agrees on strict adherence to completely standardized procedures [17-19]. Several studies on the influence of pre-analytical factors on the serum peptidome profile have been performed to further optimize the standardized protocols. Especially the type of blood collection tube, variations in clotting time and temperature, storage conditions, and amount of freeze-thaw cycles have been investigated and shown to have significant effects on the serum peptidome profile [18-24]. For example, effects of clotting time have been categorized by Umemura et al. [25] as types A, B, or C, in which types A and B indicate decreasing and increasing serum concentrations, respectively, with increased clotting time. Type C is defined as showing an initial increase, while remaining relatively stable thereafter. However, the abovementioned studies on sample handling effects were not quantitative and based on general observations of spectral changes, not providing any specific information on particular peptides. Therefore, to better understand the effects of sample handling variables on the specific expression in serum of putative peptidome markers generated after blood collection, novel quantitative methods will be beneficial. Two methods using liquid chromatography coupled to tandem mass spectrometry (LC-MS/MS) have previously been developed in our laboratory for the absolute quantification of, in total, 13 putative biomarker peptides in human serum. One method allows simultaneous quantification of eight proteolytic cleavage products of inter-alpha trypsin inhibitor heavy chain 4 (ITIH4-30, ITIH4-29, ITIH4-28, ITIH4-27, ITIH4-26, ITIH4-25, ITIH4-22, and ITIH4-21; corresponding with ITIH4 [658-687]–ITIH4 [667-687]) [26, 27], each associated with different types of cancer [7, 9–11]. The other method involves the quantification of bradykinin, Hyp3-bradykinin, des-Arg9-bradykinin, and fragments of fibrinogen α-chain (Fib-α [605-629]), inter-α-trypsin inhibitor heavy chain 4 (ITIH4 [666-687]), and complement component 4a (C4a [1337-1350]) [28]. These peptides were all significantly increased in serum from breast cancer patients in the study of Villanueva et al. [10], which could be confirmed for des-Arg9-bradykinin and ITIH4-22 after analysis of a large set of clinical serum samples from breast cancer patients and matched controls in our laboratory [29]. In addition, absolute quantification of the eight ITIH4-derived peptides in a similar sample set revealed statistically significant up-regulation of ITIH4-29 in serum from breast cancer patients [30]. The Fib-α fragment has furthermore been proposed as a marker for HER2-positive breast cancer in another study [8] and as a tumor marker for oral cancer [6]. An overview of the investigated specific proteolytic peptides and their respective amino acid sequence are shown in Table 1.
Table 1

Amino acid sequences of the investigated proteolytic peptides

NameFragment a Amino acid sequence
Fib-α [605–629] Fib-α [605–629] DEAGSEADHEGTHSTKRGHAKSRPV
C4a [1337–1350] C4a [1337–1350] NGFKSHALQLNNRQ
BradykininHMWK [381–389] RPPGFSPFR
Hyp3-BradykininHMWKb [381–389] RPP°GFSPFR b
Des-Arg9-bradykininBradykinin [1–8] RPPGFSPF
ITIH4-21ITIH4 [667–687] SRQLGLPGPPDVPDHAAYHPF
ITIH4-22ITIH4 [666–687] SSRQLGLPGPPDVPDHAAYHPF
ITIH4-25ITIH4 [663–687] GVLSSRQLGLPGPPDVPDHAAYHPF
ITIH4-26ITIH4 [662–687] PGVLSSRQLGLPGPPDVPDHAAYHPF
ITIH4-27ITIH4 [661–687] RPGVLSSRQLGLPGPPDVPDHAAYHPF
ITIH4-28ITIH4 [660–687] FRPGVLSSRQLGLPGPPDVPDHAAYHPF
ITIH4-29ITIH4 [659–687] NFRPGVLSSRQLGLPGPPDVPDHAAYHPF
ITIH4-30ITIH4 [658–687] MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF

aAmino acid sequence of precursor proteins derived from NCBI protein database [35]

bContains a hydroxylated proline amino acid residue, indicated by °

Fib-α Fibrinogen-α chain; C4a complement component 4a; HMWK high molecular weight kininogen; ITIH inter-α-trypsin inhibitor heavy chain 4

Amino acid sequences of the investigated proteolytic peptides aAmino acid sequence of precursor proteins derived from NCBI protein database [35] bContains a hydroxylated proline amino acid residue, indicated by ° Fib-α Fibrinogen-α chain; C4a complement component 4a; HMWK high molecular weight kininogen; ITIH inter-α-trypsin inhibitor heavy chain 4 Now, with the use of these quantitative methods, we specifically investigated the effects of clotting time, the blood collection tube, and clotting temperature on the serum concentrations and stabilities of these peptides. Furthermore, the effects of ex vivo protease activities in serum were compared between several breast cancer patients and controls. Expanded knowledge on the abovementioned effects is required to further explore the biomarker potential of the different peptides for early-cancer diagnosis. For example, little differences in sample handling can be a possible explanation for the observed differences between the study of Villanueva et al. [10] and the recently reported quantitative results [29, 30]. The specific investigations described here can help in optimizing sample handling protocols for each particular peptide, ideally resulting in (1) the lowest possibility of confounding factors to affect the serum peptide concentration; (2) the highest expression of the peptide formed after proteolytic cleavages; and (3) the most significant differentiation between protease activities in serum from controls and cancer patients.

Materials and Methods

Blood Collection and Serum Preparation

Blood was collected at three different locations. At Saltro Diagnostic Center Utrecht (Utrecht, The Netherlands), blood was collected from four healthy individuals in micronized silica-coated plastic (polyethylene terephthalate; PET) tubes from Greiner Bio-One (Alphen a/d Rijn, The Netherlands), either with (4 ml #454071) or without (4 ml #454314) an inert olefinoligomer barrier gel. From one of these four individuals, additional blood samples were taken at two other locations with time intervals of ca. 1 month between each occasion of blood collection. In the Utrecht Medical Center (UMC, Utrecht, The Netherlands), plastic (PET) silicone-coated tubes with clot activator (micronized silica particles) and a polymer gel separator from Becton Dickinson (Breda, The Netherlands) were used (Vacutainer 3.5 ml SST tubes, #367057). At the third location, Sports Medical Center Papendal (SMCP, Arnhem, The Netherlands), blood was collected in the same plastic tubes with clot activator and gel separator as used at Saltro (Greiner Bio-One; 4 ml #454071). In all cases, blood of each volunteer was collected in seven tubes that contained clot activator and gel separator and were thereafter allowed to clot at room temperature (RT) for 0.5, 1, 2, 4, 6, 8, or 24 h. From the four individuals, one additional tube with gel separator was allowed to clot for 24 h at 5°C, while the two plastic tubes without gel separator were kept either at RT for 1 h or at 5°C for 24 h. After the specified clotting time, all samples were centrifuged at 1,500×g for 10 min at 23°C. Subsequently, three 100-μl aliquots of serum were taken, while the remaining serum was divided into 500-μl portions. All aliquots were immediately stored at −80°C after preparation.

Sample Preparation

All samples were thawed and further processed on ice. Aliquots of 500 and 100 μl were purified by solid-phase extraction on mixed-mode weak cation exchange [28] or silica C2 reversed-phase sorbents [27], respectively. For assessing the stabilities in serum, 100 μl aliquots from the sample with the shortest clotting time (30 min) were left at RT for 0.5, 1.5, 3.5, 5.5, 7.5, and 23.5 h. This was also performed with 500-μl aliquots of the blood collected at the SMCP from one individual. Furthermore, for all individuals, additional serum aliquots were left at RT for 4 h, using two serum samples from both tube types, with clotting procedures of either 1 h at RT or 24 h at 5°C.

LC-ESI-MS/MS Analysis

The LC-MS/MS analyses were performed as described in detail previously [27, 28]. Both assays were performed using an Accela high-speed chromatographic system coupled to a TSQ Quantum Ultra triple quadrupole mass spectrometer equipped with a heated electrospray ionization source (all from Thermo Fischer Scientific, San Jose, CA, USA), using multiple reaction monitoring for detection. For both procedures, calibration standards and quality control (QC) samples were prepared in analyte-free bovine plasma, using stable-isotope labeled peptides or structural analogs as internal standards. Accuracies and precisions of the QC samples were determined to monitor analytical performance, and the quantitative analysis was accepted when deviations from the expected concentrations and variations were below 15%.

Protease Activities in Serum from Breast Cancer Patients

Serum aliquots of 500 μl from nine breast cancer patients, as well as from nine controls were incubated at RT for 24 h, subsequently analyzed by LC-MS/MS to quantify serum levels of the six putative breast cancer marker peptides. Furthermore, 100 μl aliquots from 13 different patients and controls were prepared in duplicate to obtain absolute serum concentrations of the eight ITIH4-derived peptides: one aliquot was directly further processed, while the other sample was left at RT for 24 h before further processing. All serum samples were obtained uniformly following a strict standardized protocol at two different locations: the Slotervaart Hospital and the Netherlands Cancer Institute/Antoni van Leeuwenhoek Hospital (both in Amsterdam, The Netherlands) after approval by the local medical ethics committees of both hospitals, and after receiving individuals’ written informed consent. The serum samples from the breast cancer patients were obtained prior to surgery, and none of them was undergoing treatment. Most breast cancer patients were postmenopausal except for five premenopausal and two menopausal women. The serum samples from the controls (median age 56.1 years; inter-quartile range (IQR) 46.4–69.5 years) were matched to the serum samples from the breast cancer patients for age (median age 56.2 years; IQR 44.7–69.9 years) and storage duration (median 41 months for both groups). Blood was collected in 9.5 ml BD Vacutainer® SST™ tubes (Beckton-Dickinson) and allowed to clot for exactly 30 min at RT, after which they were centrifuged at 1,500×g for 15 min at RT and subsequently aliquoted and stored at −80°C.

Results and Discussion

Effect of Clotting Time

The effects of the clotting time on the serum concentrations of Fib-α [605-629], C4a [1337-1350], bradykinin, and des-Arg9-bradykinin from healthy individuals are shown in Fig. 1. The Fib-α [605-629] fragment showed increasing concentrations with prolonged clotting time (Fig. 1a) in all individuals. This type B-effect [25] can for Fib-α [605-629] be related to increased breakdown of fibrinogen and fibrinogen-alpha chain during blood coagulation and fibrinolysis [31].
Fig. 1

Effects of clotting time at RT on serum concentrations of a Fib-α [605–629]; b C4a [1337–1350]; c bradykinin; and d des-Arg9-bradykinin in four healthy individuals (represented by different lines). The dotted line represents the assay’s LLOQ

Effects of clotting time at RT on serum concentrations of a Fib-α [605-629]; b C4a [1337-1350]; c bradykinin; and d des-Arg9-bradykinin in four healthy individuals (represented by different lines). The dotted line represents the assay’s LLOQ The concentrations of C4a [1337-1350] were low in all serum samples (max. 2.3 ng/ml) and below the lower limit of quantification (LLOQ) for several samples (Fig. 1b). Nevertheless, a small initial increase in the serum concentration could be observed during the first 2 h of clotting, thereafter slightly decreasing and this type of effect was classified as type C [25]. This effect probably indicates a reduced amount of the founder peptide, i.e., complement component 4a, with C4a [1337-1350] as an intermediate in further proteolytic processing. Besides the formation of proteolytic cascades, blood clotting can stimulate complement activation, although the exact mechanism of this interplay remains unclear [32]. On the other hand, activation of the complement cascade by blood coagulation can explain the initial increase in the proteolytic fragment of C4a, which is thereafter susceptible to consecutive proteolytic cleavages. Bradykinin, des-Arg9-bradykinin, and Hyp3-bradykinin showed rapid decreases with prolonged clotting time (Fig. 1c, d), and maximum serum concentrations were measured in the sample with the shortest clotting time (type A [25]). However, for des-Arg9-bradykinin, a C-type initial increase during the first 30 min can be expected due to proteolytic cleavage of bradykinin. Bradykinin is a key component in the intrinsic pathway of coagulation as the first step is activation of kallikrein, a serine proteinase which cleaves high molecular weight kininogen and releases bradykinin [31, 33]. However, bradykinin is also known to be rapidly degraded ex vivo, for example by carboxypeptidases N at the 8–9 position to yield des-Arg9-bradykinin. Both bradykinin and des-Arg9-bradykinin are predominantly cleaved by angiotensin I converting enzyme at the 7–8 and 5–6 positions [34]. The type-A effect for both peptides indicates that bradykinin is generated at the beginning of the ex vivo intrinsic pathway [10] and then rapidly degraded to mainly des-Arg9-bradykinin which is thereafter highly susceptible to further proteolytic cleavages. Clotting time effects on the serum concentrations of the ITIH4-derived peptides are shown in Fig. 2, revealing increasing serum concentrations upon increased clotting time (type B [25]). Only for ITIH4-27 and ITIH4-30 (Fig. 2e, h), decreasing serum concentrations were observed after ±4–6 h clotting at RT. The effect of clotting time on ITIH4-27 and ITIH4-30 was, therefore, categorized as type C [25], simply defined in this study as initially increasing, while thereafter decreasing within 6 h after blood collection. ITIH4 is known to be very sensitive to cleavage by plasma kallikrein [35], followed by trypsin-like cleavages and subsequent terminal truncations by common plasma proteases [36]. The carboxy termini of the ITIH4 fragments measured in this study are identical and consistent with a previously reported cleavage site [37]. The effects of prolonged clotting times on the serum concentrations of these peptide fragments indicate that the peptides are mainly generated ex vivo, with ITIH4-27 and ITIH4-30 as most sensitive to subsequent proteolysis. This is in agreement with previously observed highest susceptibility to degradation of synthetic ITIH4-27 in plasma and serum, thereby apparently generating ITIH4-25 [26].
Fig. 2

Effects of clotting time at RT on serum concentrations of a ITIH4-21; b ITIH4-22; c ITIH4-25; d ITIH4-26; e ITIH4-27; f ITIH4-28; g ITIH4-29 and h ITIH4-30 in four healthy individuals (represented by different lines). The dotted line represents the assay’s LLOQ

Effects of clotting time at RT on serum concentrations of a ITIH4-21; b ITIH4-22; c ITIH4-25; d ITIH4-26; e ITIH4-27; f ITIH4-28; g ITIH4-29 and h ITIH4-30 in four healthy individuals (represented by different lines). The dotted line represents the assay’s LLOQ Although these results show that blood coagulation affects the serum concentrations of all peptides, they cannot be solely attributed to the clotting process. Thorough investigation of the specific role of the involved proteases and the founder peptides as well as their relation with blood coagulation and fibrinolysis is, therefore, required. For example, it remains unclear whether the different extent of the observed effects between the four individuals is caused by the presence of different proteases or by differences in activities of the same combination of proteolytic enzymes. On the other hand, these results indicate the relevance of adherence to strict standardized protocols as the ongoing proteolytic breakdown in blood during the clotting process easily introduces pre-analytical variance. Furthermore, the protease activities can have completely opposite effects on the various peptides, apparently necessitating different blood collection procedures for the different peptide types. For example, adequate quantification of the ITIH4 peptide fragments in clinical serum samples, with clotting times of exactly 30 min, was seriously complicated by the low expression of these peptides [26, 29]. Prolonged clotting time of the blood samples could be beneficial for more accurate analytical measurements. Contrary, analysis of bradykinin and Hyp3-bradykinin likely requires very short clotting times, although their ex vivo degradation occurs so rapidly that robust serum preparation will still be seriously complicated. Interestingly, Yi et al. [24] suggest the addition of protease inhibitors prior to blood collection to reduce artificial generation of bradykinin by activation of the kallikrein–kinin system by surface contact with blood collection devices. Nevertheless, as long as the tumor’s effect on the endo- and/or exoprotease activity, and thus eventually on the bradykinin serum concentrations, is not elucidated, the most appropriate sample preparation procedures remain speculative.

Effect of Clotting Temperature

Serum concentrations for the various peptides were compared after clotting of the blood for 24 h at either RT or 5°C. Unfortunately, this clotting time was too long to present any results for the rapidly degraded bradykinin and Hyp3-bradykinin. Results for the other peptides are presented in Fig. 3, in which the average concentrations after clotting at RT are expressed as% of the average concentrations measured after clotting at 5°C. As can be seen in Fig. 3, peptides which are most likely being degraded after 24 h (type B/C) such as Des-Arg9-bradykinin, C4a [1337-1350], ITIH4-27, and ITIH4-30 show higher concentrations in the tubes stored at lower temperature, whereas peptides which are generated along with blood clotting (type A), generally show higher concentrations in the tubes stored at higher temperature. This is not surprising as the protease activities are likely to be lower at lower temperatures. The only exception is ITIH4-26, still showing increasing concentrations after 24 h clotting at RT, but with higher concentrations when clotting occurred at 5°C. This once more suggests interference of various specific proteases, either degrading or generating ITIH4-26, with the degrading proteases more specifically inhibited by the lower temperatures. Similarly, ITIH4-29 concentrations appeared more or less unaffected by the clotting temperature, while some of the type-C peptides showed remarkable high concentrations when clotting occurred at 5°C (e.g., 4.1 ± 1.8 ng/ml for C4a [1337-1350] and >10 times the upper limit of quantification for ITIH4-30). This agrees with the suggestion that proteolysis of these peptides is apparently more reduced at lower temperatures than the degradation of their respective founder peptides. Moreover, the mentioned peptides, C4a [1337-1350], ITIH4-26 and ITIH4-30, are all preceded by an arginine amino acid residue at their N terminus [38], indicating involvement of the same (trypsin-like) enzyme that is not inhibited by the reduced temperature.
Fig. 3

Effect of clotting temperature on the serum concentrations of the various peptides, expressed as% average response after 24 h clotting at RT compared to 5°C. Error bars indicate the standard deviation (n = 4)

Effect of clotting temperature on the serum concentrations of the various peptides, expressed as% average response after 24 h clotting at RT compared to 5°C. Error bars indicate the standard deviation (n = 4) With the observed influence of clotting temperature on the final serum concentrations, careful control and registration of the clotting temperature are required. Additionally, clotting at lowered temperatures can be beneficial to minimize the effects of small variations in clotting time and/or to provide higher and more accurately measurable concentrations for specific peptides as observed for C4a [1337-1350] and likely expected for bradykinin peptides.

Effect of Collection Tube

Two types of silica-coated plastic serum collection tubes were compared. Besides the silica to activate the coagulation process, one tube contained a separation gel in the base of the tube, forming a barrier between serum and blood cells after centrifugation. Figure 4 shows the measured concentrations of the different peptides in serum from four healthy individuals (♦, ■, ▲, and X) after 1 h clotting at RT in the different tube types (when concentrations were too low after 1 h clotting, shown results were obtained after 24 h clotting at 5°C). Besides the effect of the serum collection tube on the measured serum concentration of the different peptides, the separate presentation of the four healthy individuals provides additional insight in the complex formation and degradation processes of the proteolytic peptides.
Fig. 4

Measured serum concentrations after blood collection from four healthy individuals (diamonds, squares, triangles, and ex symbols, represented by different lines) in tubes with and without gel separator for the different peptides. Asterisk indicates clotting time of 24 h at 5°C, other samples were allowed to clot for 1 h at RT

Measured serum concentrations after blood collection from four healthy individuals (diamonds, squares, triangles, and ex symbols, represented by different lines) in tubes with and without gel separator for the different peptides. Asterisk indicates clotting time of 24 h at 5°C, other samples were allowed to clot for 1 h at RT For most peptides, serum concentrations were higher if prepared in tubes with gel separator (Fig. 4). Only for A-type peptides, with observed ex vivo degradation, lower concentrations were measured, suggesting increased protease activity by the gel. However, C4a [1337-1350], des-Arg9-bradykinin, ITIH4-21, and ITIH4-28 showed some contrasting results for at least one individual. For C4a [1337-1350], this could possibly be attributed to the absence of the gel barrier between serum and blood clot after centrifugation in one of the tubes (▲). Des-Arg9-bradykinin on the other hand showed contrasting effects for the samples with a low concentration in the tubes with gel, compared to the samples with a clearly higher concentration, due to higher bradykinin concentrations in these individuals (Fig. 1). Therefore, reduced breakdown of bradykinin in the tubes without gel results in lower concentrations of des-Arg9-bradykinin for these individuals compared to the concentrations obtained in tubes with gel separator. In agreement, des-Arg9-bradykinin concentrations after 24 h clotting (not shown) were higher in serum from tubes without gel for all individuals due to the absence of bradykinin and reduced proteolysis of des-Arg9-bradykinin in this tube type. The results for Hyp3-bradykinin showed the same pattern as for bradykinin, although lower concentrations were measured (not shown). Nevertheless, observed deviations for some peptides in one or more healthy individuals suggest possible interference of the gel with peptide’s formation, introducing unexplained inter-individual variations. For example, ITIH4-21 showed an opposite (increased) effect for one individual (x) in the tube without gel. Interestingly, for the same individual (x) the increase in ITIH4-21 concentration with prolonged clotting time at RT was less pronounced compared to the other individuals (Fig. 2a), while the increase in serum left at RT for similar periods of time was remarkably higher for this individual (Fig. 5a). However, as discussed before, the exact mechanism behind the observed different effects between the four individuals remains unclear.
Fig. 5

Comparison between effects of incubation time at RT in serum during blood clotting (straight line) and serum after rapid removal of the blood clot (dotted line) on the absolute serum concentrations of a ITIH4-21 and b ITIH4-25 in four healthy individuals (diamonds, squares, triangles, and ex symbols)

Comparison between effects of incubation time at RT in serum during blood clotting (straight line) and serum after rapid removal of the blood clot (dotted line) on the absolute serum concentrations of a ITIH4-21 and b ITIH4-25 in four healthy individuals (diamonds, squares, triangles, and ex symbols)

Stability in Serum

Similar as during the clotting process, continuing protease activities caused alterations in the serum concentrations when serum was left at RT after removal of the blood clot. The ITIH4-derived peptides were measured in serum from which the solid material was removed after clotting for 30 min and which was subsequently incubated at RT for different periods of time. All peptides showed similar patterns, concerning the changes in serum concentrations, compared to the effect of incubation at RT in the presence of the blood clot, as presented in Figs. 1 and 2. Moreover, for some individuals, identical concentrations were measured in serum left at RT for the same period of time either during or after clotting. Examples of the measured concentrations in serum from healthy individuals with similar incubation times at RT with or without the presence of the solid clot material are shown for ITIH4-21 and ITIH4-25 in Fig. 5. For Fib-α [605-629], C4a [1337-1350], bradykinin, Hyp3-bradykinin, and Des-Arg9-bradykinin similar comparisons were performed for only one healthy individual as their quantification required a larger serum volume (500 μl). Nevertheless, an indication of the ex vivo stabilities of these peptides in the serum fraction was provided by comparing serum concentrations after incubation at RT for 4 h to directly analyzed serum concentrations. These measurements showed that Fib-α [605-629] was less obviously generated in serum after removal of the blood clot as during blood clotting, as shown for one individual in Fig. 6. This is not surprising as Fib-α [605-629] is a degradation product of the alpha chain of fibrinogen and is probably generated by plasmin cleavages during the fibrinolysis process in the remaining blood clot [31].
Fig. 6

Comparison between effects of incubation time at RT in serum during blood clotting (straight line) and serum after rapid removal of the blood clot (dotted line) on the absolute serum concentrations of Fib-α [605–629] in one healthy individual

Comparison between effects of incubation time at RT in serum during blood clotting (straight line) and serum after rapid removal of the blood clot (dotted line) on the absolute serum concentrations of Fib-α [605-629] in one healthy individual For the other peptides, similar changes in serum concentrations were generally observed for all healthy individuals in the different serum samples after 4 h incubation at RT as compared to the effects in the presence of the blood clot (Table 2). Nonetheless, Fib-α [605-629] and ITIH4-30 concentrations were lower after 4 h incubation at RT in serum preceded by 24 h clotting at 5°C (except for Fib-α [605-629] from tubes with separator gel), in contrast to their increased concentrations in serum preceded by 1 h clotting (Table 2). Apparently, observed effects merely depend on the amount of the generated, or yet degraded, founder peptides during coagulation than on different protease activities in serum compared to blood during coagulation. Most interesting is the observation of completely identical ex vivo effects in either blood or serum on the concentrations of several peptides in some individuals (Fig. 5). This indicates that for these peptides protease activities are not solely depending on blood coagulation, which is a major argument in questioning putative tumor specificity in ex vivo peptide generation.
Table 2

Average relative changes in serum concentrations after incubation of serum from four healthy individuals for 4 h at RT

PeptideRelative difference (%) ±standard deviation
Serum preparationClotting time (h); temperature (°C)Tube with gelTube without gel
Fib-α [605–629] 1; RT+ 48.3 ± 30+ 7.4 ± 8
Fib-α [605–629] 24; 5+18.9 ± 8−19.0 ±12
C4a [1337–1350] 24; 5−54.5 ± 17−55.5 ± 18
Bradykinin1; RT−64.3 ± 18−53.9 ± 23
Des-Arg9-bradykinin24; 5−82.9 ± 3−87.1 ± 5
ITIH4-2124; 5+ 151.6 ± 20+ 298.1 ± 124
ITIH4-2224; 5+ 95.3 ± 40+ 75.4 ± 17
ITIH4-2524; 5+ 417.5 ± 99+ 361.7 ± 108
ITIH4-2624; 5+ 35.2 ± 13+ 30.0 ± 11
ITIH4-2724; 5+ 202.5 ± 43+139.0 ± 52
ITIH4-2824; 5+ 90.4 ± 12+ 127.7 ± 42
ITIH4-2924; 5+ 109.4 ± 46+ 71.9 ± 10
ITIH4-301; RT+ 33.1 ± 23+ 18.8 ± 14
ITIH4-3024; 5−10.9 ± 12−11.7 ± 20
Average relative changes in serum concentrations after incubation of serum from four healthy individuals for 4 h at RT

Intra- vs. Inter-Individual Variations

As partly discussed above and illustrated in Figs. 1, 2, 3, 4, and 5, large variations in the serum concentrations of the peptides were already observed between four healthy individuals. Lowest inter-individual relative standard deviations (RSD) in samples with the shortest clotting time were observed for Fib-α [605-629] and ITIH4-29 (10.8% and 14.1%, respectively), while variations were particularly high for bradykinin, des-Arg9-bradykinin, and ITIH4-28 (138, 57% and 44% RSD, respectively). Additionally, effects of clotting time on the serum concentrations of the various peptides were compared for one individual from whom blood was collected on three different days. Examples of intra-individual variations in C4a [1337-1350], des-Arg9-bradykinin, ITIH4-22, and ITIH4-27 serum concentrations are presented in Fig. 8.
Fig. 8

Box plots indicating the median ±25th percentile (IQR) for ITIH4-22 in serum from breast cancer patients (BC, n = 22) and controls (CO, n = 22) after direct measurement, as well as after incubation of the serum for 24 h at RT. The lower and upper bars indicate the lowest and highest value within 1.5 IQR, respectively, while dots represent values between 1.5-3 IQR (outliers) and asterisks values above 3 IQR (extremes)

Interestingly, intra-individual variations were obviously much lower after 24 h clotting as compared to the inter-individual variations for most peptides, especially for the ITIH4-derived peptides (varying from 1.4% RSD for ITIH4-22 to 15.0% RSD for ITIH4-28). This is clearly indicated for ITIH4-22, showing similar high concentrations after 24 h clotting in one individual (Fig. 7), although ITIH4-22 concentrations were obviously much lower in the other individuals after prolonged clotting (Fig. 2).
Fig. 7

Examples of intra-individual variations (diamonds) in clotting time effects at RT on the serum concentrations of a C4a [1337–1350], b Des-Arg9-bradykinin, c ITIH4-22 and d ITIH4-27 in samples collected on three different days at Saltro (dark-gray), UMC (light-gray) or SMCP (black). The dotted line represents the assay’s LLOQ

Examples of intra-individual variations (diamonds) in clotting time effects at RT on the serum concentrations of a C4a [1337-1350], b Des-Arg9-bradykinin, c ITIH4-22 and d ITIH4-27 in samples collected on three different days at Saltro (dark-gray), UMC (light-gray) or SMCP (black). The dotted line represents the assay’s LLOQ These results suggest that prolonged incubation, allowing further proteolytic breakdown, likely increases inter-individual variabilities, while reducing intra-individual variations, although observed for only one individual at three different moments. Eventually, prolonged ex vivo processing possibly reduces the effect of confounding factors, providing a better reflection of one individual’s endo- and/or exoprotease activity as well as a better differentiation between protease activities in different individuals. However, it is difficult to say whether these variations are wanted (expressing variations in the activity of proteases of interest) or unwanted (caused by factors other than disease-related activities of proteases, e.g., coagulation status). Nonetheless, if variations between the four healthy individuals are only caused by haemostatic differences, one would expect similar inter-individual variations for all peptides. This is clearly not the case, e.g., the individual that showed much higher concentrations of ITIH4-22 after prolonged clotting (Fig. 2) than the other individuals, showed more or less similar protease dependent formation of the other ITIH4 fragments. This suggests interferences of more specific proteases than those solely depending on the coagulation and complement activation. Moreover, the complicated history of the studied peptides is likely to contribute to the observed variations as their formation depends on (1) generation of founder peptides by ex vivo proteolysis, eventually activated during clotting, (2) cleavage of these founder peptides by exo- and or endoproteases, and (3) simultaneous breakdown of the peptide itself.

Comparison Between Breast Cancer Patients and Healthy Controls

Measured minimum, maximum, and median concentrations of the 13 peptides after direct measurement or 24 h incubation at RT are presented in Table 3. These measurements were especially intended to investigate the effects of prolonged ex vivo exposure to protease activities on the eventual discriminatory properties of the different peptides in breast cancer. The comparison of absolute serum concentrations to investigate the actual discriminatory properties of ITIH4-22, Fib-α [605-629], C4a [1337-1350], bradykinin, and des-Arg9-bradykinin has been described earlier in a larger population (n = 62) [29]. That measurement revealed that from these peptides, which were all proposed by Villanueva et al. [10] to exhibit putative discriminative properties for breast cancer, only ITIH4-22 and des-Arg9-bradykinin showed significantly up-regulated serum concentrations in breast cancer patients [29]. In addition, a similar comparison of absolute serum concentrations of the eight ITIH4-derived peptides recently revealed significant upregulation of particularly ITIH4-29 [30].
Table 3

Measured concentrations of the various peptides in serum from breast cancer (BC) patients and controls (CO) after direct measurement or after 24 h incubation at RT

Direct measurementAfter 24 h at RT
Median concentration [Range]a (ng/ml) P valuec Median concentration [Range]a (ng/ml) P valuec
Peptide n BCCOBCCO
Fib-α [605–629] 9157.9 [81–238]186.6 [85–493].402336.4 [112–423]319.4 [180–571].453
C4a [1337–1350] 91.7 [0.5–5]2.2 [0.5–8].2511.7 [1–2]1.3 [0.5–3].566
Bradykinin d 994.2 [38–165]76.3 [57–140].56635.1 [8–102]38.4 [26–98].566
Des-Arg9-bradykinin997.6 [69–152]87.3 [46–168].40266.3 [13–120]78.9 [59–114].453
ITIH4-21136.2[1–54]3.1 [1–11].11840.1 [4–139]33.0 [1–84].555
ITIH4-22221.1 b [1–18]0.5 b [1–5].1356.3 [1–53]4.0 [1–13] .046
ITIH4-25132.7 [1–22]1.4 [1–2].06128.3 [6–358]20.8 [4–74] .033
ITIH4-26136.3 [2–672]4.0 [1–8].07714.3 [2–605]8.7 [3–44].144
ITIH4-27131.7 [1–22]1.0 [1–4].2745.0 [1–43]2.8 [1–16].077
ITIH4-28134.2 [2–50]2.4 [1–7].06131.2[4–82]23.6 [1–44].522
ITIH4-29135.2 [1–101]2.7[1–6] .043 25.9 [4–306]13.7 [1–58] .043
ITIH4-301337.2 [5–4078]19.0 [3–58] .038 33.6 [5–279]20.7[6–94] .038

aMeasurements below the LLOQ are set at 1/2 LLOQ; measurements above the ULQ are presented as the extrapolated value

bQuantified with two methods (13 samples together with the ITIH4-derived peptides and nine with the putative breast cancer markers). All values below 1 ng/ml were set at 0.5 ng/ml

cUsing Mann–Whitney U test. Values in bold indicate P values <.05

dResults for bradykinin were similar as for bradykinin, though at lower concentrations and are not presented

Measured concentrations of the various peptides in serum from breast cancer (BC) patients and controls (CO) after direct measurement or after 24 h incubation at RT aMeasurements below the LLOQ are set at 1/2 LLOQ; measurements above the ULQ are presented as the extrapolated value bQuantified with two methods (13 samples together with the ITIH4-derived peptides and nine with the putative breast cancer markers). All values below 1 ng/ml were set at 0.5 ng/ml cUsing Mann–Whitney U test. Values in bold indicate P values <.05 dResults for bradykinin were similar as for bradykinin, though at lower concentrations and are not presented Here, comparison of the measured concentrations after direct measurement between the control and breast cancer group, using Mann Whitney U tests, showed statistically significant differences (P < 0.05) for ITIH4-29 and ITIH4-30 (Table 3). The differences for these peptides were still significant after 24 h incubation of the serum at RT, while with these conditions also ITIH4-22 and ITIH4-25 showed significantly upregulated serum concentrations in breast However, the sample size in this study was relatively small and significances only marginal, complicating adequate interpretation of the results. This study does not provide evidence on the existence of differential ex vivo proteolytic processing in breast cancer, which was investigated in more detail in other studies [29, 30]. On the other hand, prolonged exposure to ex vivo proteolysis appeared effective for improved differentiation between breast cancer and controls for ITIH4-22 and ITIH4-29, visualized in a box plot for ITIH4-22 in Fig. 8. Furthermore, it should be noted that when breast cancer-specific proteases simply have no influence on the generation of these proteolytic peptides, no significant effects after prolonged protease exposure can be expected. For future investigations, prolonged exposure to ex vivo proteolysis might, therefore, be seriously considered. Box plots indicating the median ±25th percentile (IQR) for ITIH4-22 in serum from breast cancer patients (BC, n = 22) and controls (CO, n = 22) after direct measurement, as well as after incubation of the serum for 24 h at RT. The lower and upper bars indicate the lowest and highest value within 1.5 IQR, respectively, while dots represent values between 1.5-3 IQR (outliers) and asterisks values above 3 IQR (extremes)

Conclusions

Owing to the recent development of two selective and specific LC-MS/MS methods for the absolute quantification of, in total, 13 proteolytic peptides in human serum, it was possible to accurately determine the specific influence of several sample handling variables on the serum concentrations of these putative cancer biomarkers. The results presented in this manuscript show that clotting time, temperature, and type of collection tube drastically affect the final serum concentrations. The different impact of these effects on the various peptides demonstrates the necessity of more specific sample preparation procedures to provide more consistent results and further investigate the large number of proteolytic peptides proposed as putative biomarkers for different types of cancer by various semi-quantitative studies. This study, therefore, very well provides suggestions for follow-up investigations to better explore the potential of these peptides as possible biomarkers. Furthermore, similar ex vivo degradation and/or generation of the various peptides by proteases in serum as during coagulation showed that the protease activities are not solely depending on blood coagulation. This implies that other factors than haemostatic conditions are very likely to contribute to altered protease activities. Moreover, the increased discriminative value of the potential breast cancer marker ITIH4-22 after excessively long exposure to ex vivo proteolysis could support the hypothesis of tumor specific proteases and prolonged incubation of serum samples therefore deserves consideration for future quantitative comparisons of specific peptide fragments. Ultimately, the presented study provides improved awareness of the pitfalls and opportunities of the low molecular weight peptidome in the search for novel cancer biomarkers.
  37 in total

Review 1.  Basic mechanisms in blood coagulation.

Authors:  E W Davie; K Fujikawa
Journal:  Annu Rev Biochem       Date:  1975       Impact factor: 23.643

2.  Effects of the time intervals between venipuncture and serum preparation for serum peptidome analysis by matrix-assisted laser desorption/ionization time-of-flight mass spectrometry.

Authors:  Hiroshi Umemura; Masahiko Nezu; Yoshio Kodera; Mamoru Satoh; Asako Kimura; Takeshi Tomonaga; Fumio Nomura
Journal:  Clin Chim Acta       Date:  2009-06-09       Impact factor: 3.786

Review 3.  The coagulation-kinin pathway of human plasma.

Authors:  A P Kaplan; M Silverberg
Journal:  Blood       Date:  1987-07       Impact factor: 22.113

4.  Quantitative assay for six potential breast cancer biomarker peptides in human serum by liquid chromatography coupled to tandem mass spectrometry.

Authors:  Irene van den Broek; Rolf W Sparidans; Jan H M Schellens; Jos H Beijnen
Journal:  J Chromatogr B Analyt Technol Biomed Life Sci       Date:  2010-01-18       Impact factor: 3.205

5.  Quantification of fragments of human serum inter-alpha-trypsin inhibitor heavy chain 4 by a surface-enhanced laser desorption/ionization-based immunoassay.

Authors:  Jin Song; Manisha Patel; C Nicole Rosenzweig; Yee Chan-Li; Lori J Sokoll; Eric T Fung; Nam-Ho Choi-Miura; Michael Goggins; Daniel W Chan; Zhen Zhang
Journal:  Clin Chem       Date:  2006-03-30       Impact factor: 8.327

6.  Classification of cancer types by measuring variants of host response proteins using SELDI serum assays.

Authors:  Eric T Fung; Tai-Tung Yip; Lee Lomas; Zheng Wang; Christine Yip; Xiao-Ying Meng; Shanhua Lin; Fujun Zhang; Zhen Zhang; Daniel W Chan; Scot R Weinberger
Journal:  Int J Cancer       Date:  2005-07-10       Impact factor: 7.396

7.  Declining plasma fibrinogen alpha fragment identifies HER2-positive breast cancer patients and reverts to normal levels after surgery.

Authors:  Qian Shi; Lyndsay N Harris; Xin Lu; Xiaochun Li; Justin Hwang; Robert Gentleman; J Dirk Iglehart; Alexander Miron
Journal:  J Proteome Res       Date:  2006-11       Impact factor: 4.466

Review 8.  Proteomic approaches for serum biomarker discovery in cancer.

Authors:  Priyanka Maurya; Paula Meleady; Paul Dowling; Martin Clynes
Journal:  Anticancer Res       Date:  2007 May-Jun       Impact factor: 2.480

9.  Liquid chromatography/tandem mass spectrometric method for the quantification of eight proteolytic fragments of ITIH4 with biomarker potential in human plasma and serum.

Authors:  Irene van den Broek; Rolf W Sparidans; Jan H M Schellens; Jos H Beijnen
Journal:  Rapid Commun Mass Spectrom       Date:  2008-09       Impact factor: 2.419

10.  Cloning and characterization of cDNA for inter-alpha-trypsin inhibitor family heavy chain-related protein (IHRP), a novel human plasma glycoprotein.

Authors:  K Saguchi; T Tobe; K Hashimoto; Y Sano; Y Nakano; N H Miura; M Tomita
Journal:  J Biochem       Date:  1995-01       Impact factor: 3.387

View more
  4 in total

1.  Biomarker candidates for the detection of an infectious etiology of febrile neutropenia.

Authors:  Martin E Richter; Sophie Neugebauer; Falco Engelmann; Stefan Hagel; Katrin Ludewig; Paul La Rosée; Herbert G Sayer; Andreas Hochhaus; Marie von Lilienfeld-Toal; Tom Bretschneider; Christine Pausch; Christoph Engel; Frank M Brunkhorst; Michael Kiehntopf
Journal:  Infection       Date:  2015-08-15       Impact factor: 3.553

2.  Robust substrate profiling method reveals striking differences in specificities of serum and lung fluid proteases.

Authors:  Douglas S Watson; Kalyani Jambunathan; David S Askew; Krishna Kodukula; Amit K Galande
Journal:  Biotechniques       Date:  2011-08       Impact factor: 1.993

Review 3.  The impact of biosampling procedures on molecular data interpretation.

Authors:  Karl Sköld; Henrik Alm; Birger Scholz
Journal:  Mol Cell Proteomics       Date:  2013-02-04       Impact factor: 5.911

Review 4.  Systematic evaluation of immune regulation and modulation.

Authors:  David F Stroncek; Lisa H Butterfield; Michael A Cannarile; Madhav V Dhodapkar; Tim F Greten; Jean Charles Grivel; David R Kaufman; Heidi H Kong; Firouzeh Korangy; Peter P Lee; Francesco Marincola; Sergio Rutella; Janet C Siebert; Giorgio Trinchieri; Barbara Seliger
Journal:  J Immunother Cancer       Date:  2017-03-21       Impact factor: 13.751

  4 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.