Literature DB >> 18976491

Development and validation of an enzyme-linked immunosorbent assay for antibodies against Mycobacterium bovis in European wild boar.

Olaia Aurtenetxe1, Marta Barral, Joaquín Vicente, José de la Fuente, Christian Gortázar, Ramón A Juste.   

Abstract

BACKGROUND: Bovine tuberculosis (bTB) remains a significant problem in some parts of Spain largely because of contacts between cattle and wildlife reservoirs in extensive grazing systems. European Wild boar (Sus scrofa) is one of the species involved in the transmission of the disease to other species. Fast and simple detection methods would be critical for assessing infection prevalence, study the mechanisms of pathogen transmission and monitoring the effects of TB control measures.
RESULTS: An enzyme-linked immunosorbent assay (ELISA) to detect antibodies against Mycobacterium bovis in wild boar serum was developed and validated on 185 sera from TB positive and negative wild boar. Based on antigen inoculation of captive animals as well as tuberculosis compatible lesions, culture results and molecular analysis of hunted individuals, animals were allocated into two groups: tuberculosis positive group and tuberculosis negative group. After optimization of the positive to negative ratio using different combinations of serum dilutions and conjugate concentrations, the test yielded a sensitivity of 72.60% and a specificity of 96.43% for the best cut-off.
CONCLUSION: Although some negative group animals showed an ELISA positive reaction (< 3%), this assay showed a high potential for accurate diagnosis of TB in wild boar, as its large dynamic range supported a good discriminatory power and a satisfactory balance between sensitivity and specificity.

Entities:  

Mesh:

Substances:

Year:  2008        PMID: 18976491      PMCID: PMC2606677          DOI: 10.1186/1746-6148-4-43

Source DB:  PubMed          Journal:  BMC Vet Res        ISSN: 1746-6148            Impact factor:   2.741


Background

Bovine tuberculosis, caused by Mycobacterium bovis and other closely related mycobacteria of the Mycobacterium tuberculosis complex, is endemic in many countries. These mycobacteria can infect a wide range of domestic and wild animals [1-3]. Wild animals become increasingly important in the spread and maintenance of M. bovis infection, especially when the efforts to eradicate the disease in livestock have reduced its incidence in domestic cattle [2,4]. The existence of wildlife tuberculosis (TB) reservoirs and the difficulty of controlling the disease in these species is the most important complication in eradication programs [3]. Well known examples of wildlife TB reservoirs include the badger (Meles meles) in the United Kingdom and Ireland [5,6], the brushtail possum (Trichosurus vulpecula) in New Zealand [3], the white-tailed deer (Odocoileus virginianus) in the north of the United States of America [7], the buffalo (Syncerus caffer) in South Africa [8,9], or the bison (Bison bison) in Canada [10]. In Spain, TB prevalence is relatively low in cattle (0.42 in 2006), but the infection persists in other livestock including goats and free-ranging swine, and there is a wide range of wild animal species susceptible to this disease [11]. Previous research suggested inter-specific transmission of the M. tuberculosis complex among wild ungulates and livestock [11-14]. The European wild boar (Sus scrofa) is one of the ungulates involved in the epidemiology of tuberculosis in Spain. Recent epidemiological, pathological and microbiological evidence strongly suggests that, at least in Spanish Mediterranean ecosystems, wild boar are able to maintain TB infection in the wild and most likely can transmit the disease to other species, acting as a true wildlife reservoir [15]. Depending on risk factors such as host age and management including feeding and fencing, wild boar TB prevalence ranges based on gross pathology from 18 to 100% [16,17]. The diagnosis of M. bovis infection in live animals generally depends on the cellular immune response to M. bovis antigens in the first stages of the infection [18]. The most usual technique is the hypersensitivity test, based on the intradermal injection of raw antigens [19-21]. This skin testing technique, described by Robert Koch, is still the most widely used tuberculosis diagnostic method in livestock. It is also used in wild ruminants [22,23]. However, skin tests have a limited sensitivity, and non specific reactions may occur in animals sensitized by mycobacteria other than those of the M. tuberculosis complex [24,25]. In wild animals, any diagnostic test has an associated risk during the capture, both for the people who handle the animal and for the animal itself, due to handling stress and injuries. Moreover, preliminary results of skin testing in wild boar of known TB status suggest a low sensitivity (unpublished data). Thus, the possibility of a test based on a single sampling would be highly desirable for assessing the prevalence, studying the mechanisms of transmission and monitoring the effects of control measures. While the delayed-type hypersensitivity reaction is indicative of infection or exposure, antibody formation appears to be more closely related to the extent of bacterial multiplication and antigenic load in the infected individual. ELISA testing is not routinely used in bovine TB control programs mainly due to a reduced sensitivity [26], although it has been suggested to be used as a complement to the tuberculin test, especially for the detection of anergic tuberculous cattle [27,28]. The aim of this study was to develop and validate an ELISA test for the detection of Mycobacterium bovis antibodies in wild boar serum. To achieve this goal, the humoral immune response measured by this test was first measured in captive wild boar sensitized with inactivated bacterial antigens and then results were validated with sera obtained from wild boar of known microbiological TB status.

Results

Humoral response to mycobacterial antigens

The two M. bovis immunized wild boars (WB1 and WB4) developed a large increase in the level of antibodies between pre-immunization (S1) and 30 days post-immunization (S2) serum samples while showing a much smaller increase at 90 days post-immunization (Table 1; Figure 1). The other two wild boar, immunized with M. avium (WB3) and M. paratuberculosis (WB2), showed a much smaller increase in the antibody level against bovine PPD between the pre-immunization sampling and controls S2 and S3 (Table 1).
Table 1

Average OD readings for serum dilution and protein G combination.

Serum dilutionProtein G dilution
1/101/1001/2001/5001/10001/25002.5 μg/ml1 μg/ml0.5 μg/ml0.05 μg/ml
WB1 + WB4S2/S19,28059,26109,61439,58959,11726,45966,30678,336810,70211,129
S3/S110,46511,06111,3811,57411,7309,16667,511610,25212,07413,751
S10,17580,10890,08550,05960,04650,03550,14280,09810,07280,0275
S21,00530,81980,71760,570,42930,25210,78320,7290,66580,3514
S31,07060,90490,78920,66050,53570,34380,87630,82730,75760,4086
WB2S2/S11,48731,26241,28401,15131,20331,18371,27561,29661,33861,1372
S3/S15,93845,56085,03133,69792,85772,33184,02524,78925,10643,0244
S10,09410,06690,0550,05230,04140,03050,0940,0620,04910,0217
S20,14730,08410,07190,0610,05040,03530,1250,08440,06570,0248
S30,57710,38180,28850,20230,12240,06860,41520,33240,27790,0683
WB2S2/S13,12292,43332,61352,09441,83661,41732,21952,32162,57311,8978
S3/S14,06623,33764,06253,18502,80142,18943,03103,35253,72372,9875
S10,11190,06710,0540,06110,04850,03830,10520,07040,05430,0241
S20,35050,16450,1450,13180,09140,05430,25040,84770,15150,0464
S30,410,22150,22690,19940,13740,08390,32130,85770,2130,0731

All protein G concentrations at each serum dilution, and all serum dilutions at each protein G concentration.

WB1+WB4: Sum of wild boar 1 and wild boar 4 results. S2/S1 and S3/S1: Increase rate between pre- and post-immunization results. S1, S2 and S3: OD values.

Figure 1

Increase rate (S2/S1) in the optical density reading of the ELISA with bovine PPD and protein G in WB1 and WB4 (immunized with M. bovis), WB2 (M. avium paratuberculosis) and WB3 (M. avium).

Increase rate (S2/S1) in the optical density reading of the ELISA with bovine PPD and protein G in WB1 and WB4 (immunized with M. bovis), WB2 (M. avium paratuberculosis) and WB3 (M. avium). Average OD readings for serum dilution and protein G combination. All protein G concentrations at each serum dilution, and all serum dilutions at each protein G concentration. WB1+WB4: Sum of wild boar 1 and wild boar 4 results. S2/S1 and S3/S1: Increase rate between pre- and post-immunization results. S1, S2 and S3: OD values. The optical densities (OD) obtained showed better discrimination at greater dilutions, but at serum dilutions higher than 1/200 we observed a decrease in OD values converging to blank readings. Sera reacted with both conjugates, Protein G and Protein A, but OD values were more homogeneous and the discrimination was higher with Protein G. Finally, serum dilution and conjugate Protein G concentration combinations showing the highest increases between S1 and S2 were retained for validation with the known status sera: 1/10–0.05 μg/ml, 1/200–2.5 μg/ml, 1/200–0.5 μg/ml and 1/200–0.05 μg/ml.

Known status sera analysis and determination of cut-off value

The summary of ELISA results in Table 2 shows that at the highest semi-sum, specificities were > 93% and sensitivities > 69% in all combinations. The best semi-sum was obtained at 1/200 serum dilution and 2.5 μg/ml conjugate concentration. These dilutions yielded the highest sensitivity (80.26%) among all tested combinations, but at the same time the specificity was reduced to 95.61%. The next best combination was that of a 1/200 serum dilution and a conjugate concentration of 0.05 μg/ml, with 72.60% sensitivity and 96.43% specificity.
Table 2

Sensitivity, specificity, semi-sum, specificity discriminating index (SpDI) and sensitivity discriminating index (SeDI) values of different combinations of sera and PrG conjugate.

ELISASENSITIVITYSPECIFICITYSEMI-SUMSpDISeDI
1/10–0.05 ug/ml70,67%93,81%0,822411,40763,1979
1/200–2.5 ug/ml80,26%95,61%0,879418,30004,8444
1/200–0.5 ug/ml69,33%97,35%0,833426,11563,1743
1/200–0.05 ug/ml72,60%96,43%0,845220,32883,5196
Sensitivity, specificity, semi-sum, specificity discriminating index (SpDI) and sensitivity discriminating index (SeDI) values of different combinations of sera and PrG conjugate. In order to assess the reproducibility of the ELISA and to validate the test, the two latter combinations (1/200 and 2.5 μg/ml, and 1/200 and 0.05 μg/ml) were repeated in two different days. It was observed that the replicates in case of the combination 1/200 and 0.05 μg/ml varied less than those of the other combination. Besides, the coefficient of variation (CV) between days of each test was smaller and the dynamic range was broader too for the 1/200 and 0.05 μg/ml combination (Table 3).
Table 3

Descriptive statistics at two selected combinations.

COMBINATION 1/200–0.05 μg/mlCOMBINATION 1/200–2.5 μg/ml
ELISA 1ELISA 2ELISA 1ELISA 2
n182182183183
Average0,35780,41520,54850,4862
SD0,46330,54750,38550,3572
CV129%132%70%73%
OD max.1,39021,60461,39071,1906
OD min.0,01270,02130,05440,0604
Range1,37751,58331,33631,1302
CV average13,85%19,91%
CV max.46,74%94,32%

SD: Standard deviation; CV: Coefficient of variation; OD max.: Maximum optical density value; OD min.: Minimum optical density value; CV average: Average of coefficient of variation for each serum two replicates; CV max.: Maximum coefficient of variation for each serum two replicates.

Descriptive statistics at two selected combinations. SD: Standard deviation; CV: Coefficient of variation; OD max.: Maximum optical density value; OD min.: Minimum optical density value; CV average: Average of coefficient of variation for each serum two replicates; CV max.: Maximum coefficient of variation for each serum two replicates. Figure 2 shows the dynamics of sensitivity, specificity, diagnostic value semi-sum, SeDI and SpDI values for the ELISA with 1/200 and 0.05 μg/ml sera/conjugate combination. It can be seen that the range between 0.115 and 0.655 has diagnostic values over 80%, with a slightly higher primary peak between 0.195 and 0.275 and a secondary one between 0.415 and 0.475. The SeDI and SpDI peak on both sides of the first peak, and indicate the optimal performance when either sensitivity or specificity is the main focus for the test. If a good balance is the goal, then an intermediate value should be the choice. In this case, and taking into account the distribution shown in the histogram (Figure 3) a value at around 0.2 appears to provide the best trade-off. This figure shows that there are at least bimodal distributions both for reference negative and positive sera. This bimodal distribution is less clear for the negative set since all but four sera locate below the 0.2 cut-off. The positives have a highly polarized distribution with markedly high modes at both ends of the EI range and an almost continuous distribution between them. Therefore a cut-off of 0.200 was finally chosen as the one yielding the best balance between sensitivity and specificity and locating to a region where no values were found thus indicating a biological separation between EI populations.
Figure 2

Dynamics of sensitivity (Sen), specificity (Spe), diagnostic value semi-sum (SE+SP), specificity discriminating index (SpDI) and sensibility discriminating index (SeDI) at selected conditions (serum sample dilution 1/200 and PrG conjugate 0.05 μg/ml).

Figure 3

Histogram of the distribution of the ELISA index values at the defined conditions (1/200 and 0.05 μg/ml) and according to the status of the animals: positive (POSITIVE) or negative (NEGATIVE). The horizontal line represents the chosen cut-off value.

Dynamics of sensitivity (Sen), specificity (Spe), diagnostic value semi-sum (SE+SP), specificity discriminating index (SpDI) and sensibility discriminating index (SeDI) at selected conditions (serum sample dilution 1/200 and PrG conjugate 0.05 μg/ml). Histogram of the distribution of the ELISA index values at the defined conditions (1/200 and 0.05 μg/ml) and according to the status of the animals: positive (POSITIVE) or negative (NEGATIVE). The horizontal line represents the chosen cut-off value.

Discussion

To date, studies are not available on the experimental use of antigens to characterize the immune response of wild boar and pigs against M. bovis. Herein, inactivated mycobacterial antigens were successfully used to stimulate a specific humoral immune response in healthy wild boar. Injection of the antigens caused an increase of specific antibodies, but the administration of a second antigen dose did not raise the antibody levels so much. A strong cross reaction between antibodies specific for M. avium and M. avium paratuberculosis (WB 2 and WB 3) and the bovine PPD ELISA was not observed except to some extent for WB2 after the boosting. Thus, the immunization assay provided negative and positive M. bovis control sera to use in the development of the ELISA, as well as for reference in the future. It is generally recognized that humoral immunity is not important for tuberculosis diagnosis [29], but it may nonetheless be useful to detect animals with severe illness since antibody concentration is related to lesion distribution and severity, as well as to the number of bacilli [18,22,26,30-32]. Mycobacterial infections induce antibody production in ruminants, but the profile of immunoglobulin (Ig) expression in M. bovis infected animals is poorly understood [33-36]. In previous studies, Ig heavy and light chains were up-regulated in European wild boar infected with M. bovis [37]. However, serum determinations suggested elevated levels of IgG in uninfected wild boar when compared to M. bovis infected animals [38]. The mechanism of Ig differential expression in M. bovis infected wild boar is unknown but may reflect different stages during mycobacterial infection. Furthermore, differential gene expression analysis in response to mycobacterial infection in wild boar suggest that antibody responses against M. bovis may be important in natural infections of wildlife species and may be used for bTB surveillance and treatment monitoring [35,39-41]. Previous studies using ELISA tests achieved 74% sensitivity and 90% specificity in cattle [26], and 79% to 98% specificity and 37% sensitivity in ELISA used in badgers [41-43], although the latter was increased for badgers with progressive tuberculosis [44]. In addition, a positive ELISA result in badgers was correlated with an enhanced likelihood of a future positive culture result [45]. Various mycobacterial antigens have also been used for bovine tuberculosis ELISA in other studies. This includes for example ELISA based on MPB70 and MPB83 in cattle, which have reported specificities of 89% and 96.4%, and sensitivities of 18.1% and 37.5% [46,47]. The results obtained in the current study, thus, indicate that the ELISA performance was substantially better for wild boar, especially in terms of sensitivity (72.60%) and without a significant loss in specificity (96.43%) despite the fact that it is generally recognized that the sensitivities and specificities of ELISA protocols for serodiagnosis of bovine tuberculosis are low as compared to those for other diseases [48]. At the chosen cut-off, there were a few reference negative animals that had medium level antibody reactivity against bovine PPD. It might be possible that some of these animals were infected individuals without visible lesions and bacteria not found, or true non-infected but exposed to M. bovis infection, that is, potentially resistant animals. Actually, ELISA positive results are usually considered only as evidence of exposure [17] and not necessarily of current infection. Infections with other mycobacteria causing cross-reactivity cannot be completely ruled out although, given the origin of the animals in infected areas and the EI gap to the rest of negative controls, we think they are less likely to be involved. On the other hand there were animals where M. bovis was isolated that had very low EI readings. These animals might represent recently infected individuals not having developed yet a humoral immune response or anergic animals with limited immune responses due to poor body condition.

Conclusion

We conclude that the use of the serological ELISA test developed herein may contribute to the diagnosis of TB in wild boar and probably also in pigs, with an acceptable sensitivity and specificity and without the need to handle the animals twice as in the skin test. This ELISA test could be used in the control of TB in wild boar through "test & cull" schemes and in large-scale surveys [49]. These results support the use of the ELISA test to complement other techniques based on cellular response to characterize mycobacterial infection in wild boar.

Methods

Reference sera

Wild boar immunization

In order to obtain serum controls to be used in the ELISA, four captive adult wild boars living in a M. bovis free area were used. On day 0, wild boar 1 (WB1) and 4 (WB4) were immunized by the subcutaneous route with 1 ml of a suspension containing 103–106 colony-forming units (CFU; 2.5 mg) of heat inactivated M. bovis. Wild boar 3 (WB3) was immunized with 1 ml (103–106 CFU) of heat inactivated M. avium (M. bovis and M. avium were kindly provided by CZ Veterinaria), and wild boar 2 (WB2) with 1 ml (2.5 mg) of heat inactivated commercial M. avium paratuberculosis vaccine (Gudair® CZ Veterinaria, S.L., Spain). Prior to immunization a serum sample (S1) was taken from each animal. Thirty days later a second serum sample (S2) was taken and all the animals were re-immunized in the same way. Ninety days later a third serum sample (S3) was taken from the four animals. All sera were stored frozen at -20°C until used for testing. All animal use was supervised by the Neiker Committee on Animal Experimentation in accordance with Spanish laws.

Wild Boar of known TB status

In order to validate the ELISA, 185 sera obtained from known TB status cases (known status sera) were analyzed. This material included 73 sera from naturally TB positive wild boar, defined as individuals with both tuberculosis compatible lesions [50] and M. tuberculosis complex isolation and PCR confirmation (data not shown). The material also included 112 sera from TB negative wild boar, defined as animals with no visible TB-compatible lesions and negative culture. These sera were analyzed with the optimized ELISA protocol, using S3 of WB1 or WB4 as positive control and S1 as negative control.

Indirect ELISA optimization

Bovine tuberculin purified protein derivative (bovine PPD) (CZ Veterinaria, S.L., Spain) was diluted to 5 μg/ml in carbonate buffer (63 mM, pH 9.6). Plates (High binding ELISA microplate, Greiner bio-one, Germany) were coated with 100 μl of diluted PPD and used in fresh, without any storage. Serum samples and controls, were adsorbed (1/1) with Mycobacterium phlei saline suspension (5 gr/l; Dr. O. Fuentes, INIA, Spain), to remove non-specific anti-Mycobacterium spp. antibodies. After an overnight incubation at 4°C, samples were diluted in PBS-Tween (0.14 M NaCl; 3 mM KCl; 10 mM Phosphate buffer; 0.05 Tween 20; pH 7.4) and 100 μl of each dilution were added in duplicate in contiguous wells of the bovine PPD coated plate and incubated for 2 hours at room temperature. After three washings with PBS-Tween, 100 μl of Protein A or G were added and incubated for two hours at room temperature. Again after three washings, 100 μl of ABTS substrate (Sigma-Aldrich) were added to each well and incubated for 20 minutes in the dark at room temperature. Optical densities (OD) were read with 405 and 450 nm filters (MultiskanEX, Thermolabsystems). Sample result was expressed as an ELISA index (EI) that was calculated as the ratio of the mean sample OD to the mean OD of the positive controls. Optimal dilutions of sera were determined by the evaluation of the reactivity of serial dilutions (1/10; 1/100; 1/200; 1/500; 1/1000 and 1/2500) and in combination of serial dilutions of Protein G or Protein A conjugated with recombinant peroxidase from Streptococcus sp. (2.5 μg/ml; 1 μg/ml; 0.5 μg/ml; 0.05 μg/ml) (Sigma-Aldrich) with reference serum samples S1, S2 and S3 from the four immunized wild boar analyzed in duplicate. The serum dilution and Protein G concentration at which the ratio between S2 and S1 ODs were higher and apparently more representative were selected for testing the whole set of known status sera. These sera were then tested only at 4 different combinations (serum dilution-PrG concentration): 1/10–0.05 μg/ml, 1/200–2.5 μg/ml, 1/200–0.5 μg/ml and 1/200–0.05 μg/ml.

Indirect ELISA validation

ELISA indices of the whole set of known status sera were entered in a spreadsheet (RA Juste, unpublished), that allowed to calculate sensitivity and specificity for each cut-off. This spreadsheet also calculates the semi-sum of sensitivity and specificity (diagnostic value ranging from 0 to 100) and the ratios of specificity to sensitivity (specificity discriminating index – SpDI) and of sensitivity to specificity (sensitivity discriminating index – SeDI). The spreadsheet also plots all the values in a single graph that allows seeing at once the behaviour of all these relevant variables along the dynamic range of the test. A verification of these analyses was made using the SigmaPlot (Addlink, Barcelona, Spain) graphics package that was also used to plot the positive and negative known status sera EI histogram and to calculate the 95% sensitivity and specificity confidence intervals at each cut-off. The final cut-off for the test was chosen as that that yielded the highest semi-sum, was located in a region where small changes in its numerical value did not change substantially the semi-sum (Figure 2), and in the histogram was located in the widest gap without values (Figure 3).

Authors' contributions

OA and JV performed the field work and collected all the samples of the study. OA carried out the laboratory work and generated the immunological data. OA, MB, RAJ, JV and CG designed the experiment. The immunological analyses were designed by OA, MB and RAJ. MB was the project leader and coordinated and supervised all the study. RAJ participated on data analysis and study supervision. OA wrote the manuscript and JF, CG, JV, MB and RAJ contributed to draft it. All authors read and approved the final manuscript.
  48 in total

Review 1.  Serology of mycobacteria: characterization of antigens recognized by monoclonal antibodies.

Authors:  D B Young; A Mehlert
Journal:  Rev Infect Dis       Date:  1989 Mar-Apr

Review 2.  Identification of immune response correlates for protection against bovine tuberculosis.

Authors:  Bryce M Buddle; D Neil Wedlock; Michel Denis; Margot A Skinner
Journal:  Vet Immunol Immunopathol       Date:  2005-10-18       Impact factor: 2.046

3.  A field evaluation of serological and cellular diagnostic tests for bovine tuberculosis.

Authors:  P R Wood; L A Corner; J S Rothel; J L Ripper; T Fifis; B S McCormick; B Francis; L Melville; K Small; K de Witte
Journal:  Vet Microbiol       Date:  1992-04       Impact factor: 3.293

4.  Assessment of defined antigens for the diagnosis of bovine tuberculosis in skin test-reactor cattle.

Authors:  J M Pollock; R M Girvin; K A Lightbody; R A Clements; S D Neill; B M Buddle; P Andersen
Journal:  Vet Rec       Date:  2000-06-03       Impact factor: 2.695

5.  Further evaluation of an indirect enzyme-linked immunosorbent assay for the diagnosis of bovine tuberculosis.

Authors:  V Ritacco; B López; L Barrera; A Nader; E Fliess; I N de Kantor
Journal:  Zentralbl Veterinarmed B       Date:  1990-02

6.  The epidemiology of tuberculosis in free-ranging African buffalo (Syncerus caffer) in the Kruger National Park, South Africa.

Authors:  V De Vos; R G Bengis; N P Kriek; A Michel; D F Keet; J P Raath; H F Huchzermeyer
Journal:  Onderstepoort J Vet Res       Date:  2001-06       Impact factor: 1.792

7.  Characterization of the early antibody response in bovine tuberculosis: MPB83 is an early target with diagnostic potential.

Authors:  J McNair; D M Corbett; R M Girvin; D P Mackie; J M Pollock
Journal:  Scand J Immunol       Date:  2001-04       Impact factor: 3.487

Review 8.  The epidemiology of Mycobacterium bovis infections in animals and man: a review.

Authors:  L M O'Reilly; C J Daborn
Journal:  Tuber Lung Dis       Date:  1995-08

9.  Lesions associated with Mycobacterium tuberculosis complex infection in the European wild boar.

Authors:  Maria Paz Martín-Hernando; Ursula Höfle; Joaquin Vicente; Francisco Ruiz-Fons; Dolors Vidal; Marta Barral; Joseba M Garrido; José de la Fuente; Christian Gortazar
Journal:  Tuberculosis (Edinb)       Date:  2007-03-28       Impact factor: 3.131

10.  An ELISA for the detection of anergic tuberculous cattle.

Authors:  P Plackett; J Ripper; L A Corner; K Small; K de Witte; L Melville; S Hides; P R Wood
Journal:  Aust Vet J       Date:  1989-01       Impact factor: 1.281

View more
  13 in total

1.  Spatial distribution and risk factors of Brucellosis in Iberian wild ungulates.

Authors:  Pilar M Muñoz; Mariana Boadella; Maricruz Arnal; María J de Miguel; Miguel Revilla; David Martínez; Joaquín Vicente; Pelayo Acevedo; Alvaro Oleaga; Francisco Ruiz-Fons; Clara M Marín; José M Prieto; José de la Fuente; Marta Barral; Montserrat Barberán; Daniel Fernández de Luco; José M Blasco; Christian Gortázar
Journal:  BMC Infect Dis       Date:  2010-03-05       Impact factor: 3.090

2.  Point of Care Tuberculosis Sero-Diagnosis Kit for Wild Animals: Combination of Proteins for Improving the Diagnostic Sensitivity and Specificity.

Authors:  Maroudam Veerasami; K Venkataraman; Chitra Karuppannan; Arun Attur Shanmugam; Mallepaddi Chand Prudhvi; Thomas Holder; Polavarapu Rathnagiri; K Arunmozhivarman; Gopal Dhinakar Raj; Martin Vordermeier; B Mohana Subramanian
Journal:  Indian J Microbiol       Date:  2017-11-11       Impact factor: 2.461

3.  Sensitive and specific enzyme-linked immunosorbent assay for detecting serum antibodies against Mycobacterium avium subsp. paratuberculosis in fallow deer.

Authors:  José M Prieto; Ana Balseiro; Rosa Casais; Naiara Abendaño; Liam E Fitzgerald; Joseba M Garrido; Ramon A Juste; Marta Alonso-Hearn
Journal:  Clin Vaccine Immunol       Date:  2014-05-28

4.  Development of a Multiplex Bead Assay for Simultaneous Serodiagnosis of Antibodies against Mycobacterium bovis, Brucella suis, and Trichinella spiralis in Wild Boar.

Authors:  Antonia Touloudi; George Valiakos; Shaun Cawthraw; Polychronis Kostoulas; Christian Gortázar; Mariana Boadella; Alexios Giannakopoulos; Periklis Birtsas; Marina Sofia; Labrini V Athanasiou; Maria Satra; Zoi Athanasakopoulou; Maria Kantere; Vassiliki Spyrou; Liljana Petrovska; Charalambos Billinis
Journal:  Microorganisms       Date:  2021-04-23

5.  Seroprevalence and risk factors associated to Mycobacterium bovis in wild artiodactyl species from southern Spain, 2006-2010.

Authors:  Ignacio García-Bocanegra; Bernat Pérez de Val; Antonio Arenas-Montes; Jorge Paniagua; Mariana Boadella; Christian Gortázar; Antonio Arenas
Journal:  PLoS One       Date:  2012-04-16       Impact factor: 3.240

6.  Exposure of wild boar to Mycobacterium tuberculosis complex in France since 2000 is consistent with the distribution of bovine tuberculosis outbreaks in cattle.

Authors:  Céline Richomme; Mariana Boadella; Aurélie Courcoul; Benoît Durand; Antoine Drapeau; Yannick Corde; Jean Hars; Ariane Payne; Alexandre Fediaevsky; María Laura Boschiroli
Journal:  PLoS One       Date:  2013-10-22       Impact factor: 3.240

7.  Effects of repeated comparative intradermal tuberculin testing on test results: a longitudinal study in TB-free red deer.

Authors:  Azlan Che-Amat; Maria Ángeles Risalde; David González-Barrio; Jose Antonio Ortíz; Christian Gortázar
Journal:  BMC Vet Res       Date:  2016-09-05       Impact factor: 2.741

8.  Development and Evaluation of a Serological Assay for the Diagnosis of Tuberculosis in Alpacas and Llamas.

Authors:  Jose A Infantes-Lorenzo; Claire E Whitehead; Inmaculada Moreno; Javier Bezos; Alvaro Roy; Lucas Domínguez; Mercedes Domínguez; Francisco J Salguero
Journal:  Front Vet Sci       Date:  2018-08-13

9.  Progress in Oral Vaccination against Tuberculosis in Its Main Wildlife Reservoir in Iberia, the Eurasian Wild Boar.

Authors:  Beatriz Beltrán-Beck; Cristina Ballesteros; Joaquín Vicente; José de la Fuente; Christian Gortázar
Journal:  Vet Med Int       Date:  2012-07-10

10.  Spatial Analysis of Wildlife Tuberculosis Based on a Serologic Survey Using Dried Blood Spots, Portugal.

Authors:  Nuno Santos; Telmo Nunes; Carlos Fonseca; Madalena Vieira-Pinto; Virgílio Almeida; Christian Gortázar; Margarida Correia-Neves
Journal:  Emerg Infect Dis       Date:  2018-12       Impact factor: 6.883

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.