Literature DB >> 18437235

Meeting Abstracts. Recent Developments in 1,3-beta-Glucan Biology: Proceedings of the 5th Glucan Symposium Tokyo, December 8, 2006.

.   

Abstract

Entities:  

Mesh:

Substances:

Year:  2007        PMID: 18437235      PMCID: PMC2327214          DOI: 10.1155/2007/79648

Source DB:  PubMed          Journal:  Mediators Inflamm        ISSN: 0962-9351            Impact factor:   4.711


× No keyword cloud information.
The following workshops reported on the advancements on 1,3-β-glucan biology in terms of understanding the molecular basis for the cellular reactions induced as well as new methods for analysis and the clinical applications, particularly concerning fungal infections. The first glucan workshop was organized in 1990 with the purpose to draw attention to the importance of 1,3-β-glucan, one of the major constituents of fungal cell walls, as a bioactive agent in our environment [1]. The workshop reviewed available data and through fruitful discussions encouraged further research in the area. This was followed by a succession of similar workshops in 1993, 1994, and 1997 [2-4]. Although the number of researchers in this field has remained fairly limited over the years, progress since the first workshop has been significant. Several subjects at the present workshop are similar to those treated 17 years ago but there has been an imposing increase in depth and breath of the knowledge. In the first workshop, a main interest was the methodology of the measurement of 1,3-β-glucan and the levels present in the environmental and in clinical specimens. Information was also presented on the influence of 1,3-β-glucan on inflammatory and immunological systems. It was suggested that 1,3-β-glucan could be an important environmental and clinical agent related to human diseases but there was a lack of both experimental and clinical studies. Against this short background of previous workshops it is time again to present the advances in the different fields, now with an emphasis on molecular biology for the understanding of the effects and experience from investigations on humans for clinical and environmental risk evaluations.

INTRODUCTION

The mould cell wall agent 1,3-β-glucan has a number of biological effects after inhalation and injection [1]. The purpose of this presentation is to review data from some major studies on the levels of 1,3-β-glucan in occupational and general environments.

METHODOLOGICAL ISSUES

The amount of 1,3-β-glucan in environmental samples can be determined using two different analytical methods. One method is the Limulus assay using a glucan specific lysate [2]. A sample of airborne or sedimented dust is extracted in water with NaOH added or during heating to 130°C. This procedure is required to dissolve the triple helix of the glucan molecule and render it accessible to the reagent in the test. If this treatment is not performed, the analysis will comprise only the water soluble portion of the environmental glucan which is 10% or less than the total [3]. The method is similar to the standard method to analyse bacterial endotoxin where a specific lysate is also used. The method has a high sensitivity (around 1 pg/mL) but is not specific for moulds as pollen and certain vegetable fibres also contain 1,3-β-glucan. Another method to determine that 1,3-β-glucan is based on a specific enzyme immunoassay [4]. It uses purified polyclonal rabbit anti-1,3-β-glucan antibodies and laminarin (a 1,3-β-glucan) as the coated antigen and calibration standard. The detection threshold for this method is 0.26 μg/m3. No data comparing the results from the two methods in the same sample have been published.

ENVIRONMENTAL MEASUREMENTS

The Limulus method

The first study where the level of 1,3-β-glucan was measured in indoor environments comprised a number of flats, daycare centers, and a post-office [5]. After that a number of studies in indoor environments and occupational exposures have been published. The results are summarised in Table 1.
Table 1

1,3-β-glucan (Limulus lysate analysis) in different environments.

Environment n RangeReferences
Airborne ng/m3
Poultry farms394.1–870[3]
Waste collection142.0–34.0[6]
Waste collection255–220[7]
Cotton cardroom151 037–7 286[8]
Mouldy homes260–7.6[9]
Recycling1360–137[11]
Wood processing244.5–330[8]
Horse stables200–76.5[8]
Swine stables978.6–425[8]
Homes, indoor/outdoor190.3–9.4[9]

Airborne agitated ng/m3
Mouldy homes260–9.3[10]
School150–27.4[12]
Row houses750–19.0[13]
Day care91.4–11.0[14]
House65–106[15]

Sedimented dust ng/mg
Mouldy homes261.5–173[9]
Cotton cardroom4572–850[8]
The highest values were recorded in animal confinement buildings. The high levels in cotton cardrooms with a relatively small variation suggest a reaction with the cotton fibre.

The immunological method

A number of field studies report levels of indoor 1,3-β-glucan using the immunological method. They are summarised in Table 2.
Table 2

1,3-β-glucan (immunological method analysis) in different environments.

Environment n RangeReferences
Airborne μg/m3
Waste collectors1180–30.8[16]
Saw mills370.4–92.5[17]

Sedimented dust
Homes (μg/g)47698–10 000[18]
Homes (μg/m2)75157–3 652[19]
Homes (μg/m2, GM)2110–243[20]
Homes (μg/g, percentiles)395469–4 065[21]

Comments

A review of most of the available data on 1,3-β-glucan in different environments demonstrates a variation of dose levels within the different environments. Values using the Limulus method are usually considerably lower illustrating the very high sensitivity of that method. In several of the studies reviewed above, the levels of 1,3-β-glucan have been related to the presence of symptoms or clinical measures of inflammation, either comparing high and low/control exposures or on a dose-response basis. A relation has been found for the extent of respiratory symptoms [11], pulmonary function [19], and blood lymphocyte numbers [6]. Although significant relations have been found, they do not prove causality for 1,3-β-glucan as the environments studied contain a variety of biologically active agents such as bacterial endotoxin, fungal toxins, fungal enzymes, and microbial cell wall agents from a variety of different microbes. Further studies are required to assess the role of 1,3-β-glucan for these effects. For preventive purposes, it could be possible to use the level of 1,3-β-glucan as a descriptor of the exposure and as a basis for “action values”. The available data are not yet sufficient to suggest those action values although 25 ng/mg floor dust has been suggested for an increased risk for high levels of IgE [10]. Further work is required to define such values. It is widely recognized that cell wall components of microorganisms may induce variety of host reactions. The cell wall component lipopolysaccharide of Gram-negative bacteria and peptidoglycan of Gram-positive bacteria can activate macrophages to release proinflammatory molecules, resulting in circulatory shock and multiple organ failure [1, 2]. On the other hand, the bioactivity of cell wall component(s) of fungi has not been fully elucidated, especially in vivo. In a previous study, we isolated soluble 1,3-β-glucan (CSBG) from Candida albicans [3]. In the current work, we investigated the effects of CSBG on the respiratory systems in mice after an intratracheal injection of 50 μg. The animals were sacrificed at 24 hours after this exposure, then, a broncho-alveolar lavage was performed, and the cells were stained with Diff-Quick. The results on cells are found in Figure 1.
Figure 1

Cells in lavage fluid after intratracheal instillation of suspension fluid (vehicle), 1,3-β-glucan (CSBG), and degraded CSBG (DEG-CSBG). n = 8–12 in each group. Data are mean ± SEM. *P > 0.05 versus other treatment.

There was an infiltration of neutrophils, eosinophils, and mononuclear cells, which was concomitant with an increased local expression of proinflammatory cytokines such as tumor necrosis factor-α, interleukin (IL)-1β, IL-6, as well as chemokines such as macrophage inflammatory protein-1α, macrophage chemoattractant protein-1, normal T cells and their secretion, and eotaxin. The lung inflammation with enhanced expression of proinflammatory proteins caused by CSBG was directly related to its structure, since structurally degraded products of CSBG by formic acid induced negligible responses in the lung. Taken together, these data suggest that pulmonary exposure to CSBG in the form and the dose applied here can induce lung inflammation through enhanced expressions of proinflammatory cytokines and chemokines. In contrast to these results, other studies have not found an inflammatory response neither in animals [4] nor in humans [5]. This discrepancy is probably due to differences in dose and solubility of the 1,3-β-glucans used and/or the exposure modes (intratracheal administration versus inhalation exposure). It illustrates the complexity in the effects of different glucans and further studies need to be undertaken to relate the different cellular reactions to risk for diseases. Dectin-1 is a specific receptor for 1,3-β-glucans which is expressed on various kinds of leukocytes, such as macrophages, neutrophils, and dendritic cells. It plays an important role for activating innate immune response to fungal infection and functions as a signaling receptor for the activation of superoxide production and inflammatory gene expression by the NF-κB-activation pathway. There is a need to further characterize the stimulatory 1,3-β-glucan agonists for Dectin-1 in view of the diversity of the various physicochemical properties of 1,3-β-glucans such as branching ratio, length of branched glucosyl residues, degree of polymerization of main glucosyl chain and solubility. In terms of branching structure 1,3-β-glucans may be classified into three major groups: (1) a monoglucosyl branched linear 1,3-β-glucan as represented by Sonifilan (SPG), a soluble glucan obtained from liquid-cultured extracellular polysaccharide of Schizophyllum commune. (2) Tree-like branched main 1,3-glucosyl linkage with 1,6-monoglucosyl branched 1,3-β-glucans as represented by Lentinan and SCG, which are extracted from the fruit body of edible mushrooms. (3) a linear 1,3-β-glucan with various lengths of the 1,6-glucosyl chain as represented by CSBG and OX-CA from yeast (Candida albicans ) or Zymosan (Saccharomyces cerevisiae). In this study, we used several structurally defined and physicochemical different 1,3-β-glucans and evaluated innate immune responses such as NF-κB activation and cytokine production from Dectin-1-expressing cells.

RESULTS AND DISCUSSION

Molecular mechanisms for 1,3-β-glucan recognition and NF-κB activation in Dectin-1 transfectant

Zymosan has been used as a model compound of yeast microorganisms and stimulates macrophages mainly through TLR2- and Dectin-1-mediated recognition. In order to examine the contribution of Dectin-1 in TLR2/MyD88-mediated NF-κB activation, various Dectin-1 mutants were tested in TLR2 coexpressed HE293 transfectant. The NF-κB activation in TLR2 transfectant was significantly enhanced by coexpression of wild-type Dectin-1. The Dectin-1 mutants, in which amino acid residues of extracellular Trp221 and His223 (carbohydrate recognition domain) or intracellular Tyr15 (ITAM motif) are replaced with alanine or phenylalanine, had a lower activation of NF-κB. This is comparable to TLR2-alone-expressed HEK293 [1]. However, wild-type Dectin-1 transfectant without TLR2 did not respond to stimulation with Zymosan. In the case of stimulation of Dectin-1/TLR2 coexpressed HEK293 transfectant with purified particulate 1,3-β-glucan (OX-CA), the cell showed no activation of NF-κB. These results indicate that Dectin-1 functions as a costimulatory signaling receptor for TLR2-mediated NF-κB activation in HEK293, and Zymosan may have multiple agonist effects, not only as a β-glucan, but also involving TLR2 reactive ligands.

Structure-activity relationship on Dectin-1/Card9-mediated NF-κB activation

Card9 is newly identified signaling molecule in innate immune response and mediates Dectin-1-related NF-κB activation. To examine which type of 1,3-β-glucan can stimulate the Dectin-1/Card9/Bcl10 signaling pathway, various 1,3-β-glucans were tested, using Dectin-1/Card9/Bcl10 expressing HEK293T transfectant. Incubation of the cells with Zymosan and OX-CA showed enhanced NF-κB activation, but CSBG (the soluble form of OX-CA), SCG, and SPG did not increase the NF-κB-assisted luciferase expression [2]. These results suggest that the particulate form of 1,3-β-glucan stimulates Dectin-1/Card9/Bcl10 signaling, and that this activation pathway does not require TLR2-reactive ligands.

Innate immune response to soluble 1,3-β-glucans in Dectin-1 knockout mice

Although the above results suggest that only particulate 1,3-β-glucans are active on the Dectin-1-mediated immune response, it has been demonstrated that a soluble 1,3-β-glucan is immune stimulatory to leukocytes [3]. To investigate the Dectin-1-mediated signaling of soluble 1,3-β-glucan, bone marrow-derived dendritic cells (BMDC) from dectin-1−/− mice were used in a cytokine production assay [4]. TNF-α production from dectin-1+/+-derived BMDC was increased by coincubation with OX-CA or SCG, but the cells from dectin-1−/− mice did not show any significant production in response to the 1,3-β-glucans. On the contrary, the lipopolysaccharide-induced TNF-α production by dectin-1−/− BMDC was similar to that of dectin-1+/+. These results suggest that the immune response to soluble 1,3-β-glucan also requires the Dectin-1 molecule for cell activation.

CONCLUSION

Dectin-1 plays an important role for leukocyte activation in response to particulate 1,3-β-glucans and also to soluble forms with tree-like branched 1,3- and 1,6-β-glucosyl linkage. The Dectin-1-mediated activation signaling induced by such soluble 1,3-β-glucans may require other signaling molecules which are defect in HEK293 and which are able to support the known signaling molecules including Syk, Card9, and Bcl10. It has been shown above that 1,3-β-glucans are present in many general and occupational environments and that they induce cell activation through receptors such as Dectin-1. A risk assessment of exposure to 1,3-β-glucans in the environment is complicated by the simultaneous presence of a variety of other agents including microbial cell wall agents such as bacterial endotoxin. An understanding of the biological effects of 1,3-β-glucan must thus be based mainly on information derived from experiments with the pure substance. In the following an attempt is made to synthesize the available information on the toxicity of 1,3-β-glucan with the goal to propose a model for the reactions after inhalation at exposure levels similar to those encountered in occupational and general environments.

EXPERIMENTAL EVIDENCE

The effects of purified 1,3-β-glucan have been studied in a number of studies on animals and humans as previously reported [1]. A possible general error in such studies is that the extraction of 1,3-β-glucan from the fungal cell wall might affect its chemical characteristics and hence the biological effect. It is also important to recognize that any effect studied is dependent on the dose and that the dose-response is not always linear but might have a U-form (Hormesis dose-response). The absence of an effect at a low dose thus does not contradict the possibility that it may occur at a higher dose. This might explain some of the conflicting data in the literature regarding the stimulation of inflammatory cytokines by 1,3-β-glucan. In inhalation experiments with doses similar to those found in the environment, there is no evidence for an inflammatory response [2]. At high dose levels, however, and using water soluble forms of 1,3-β-glucan, an inflammation can be induced and cytokine stimulation has been reported in in vitro experiments (see reviews in [1, 3]). It has been demonstrated that 1,3-β-glucan influences the immune system. The leukocyte invasion into the airways induced by an acute inhalation of endotoxin is blunted by a previous inhalation of 1,3-β-glucan [4]. The secretion of TNFα from peripheral blood monocytes was decreased after an acute inhalation of 1,3-β-glucan [5, 6]. A depression of the inflammatory response could also explain the prolonged survival seen in mice with polymicrobial sepsis, presumably by preventing the increase in transcription factor NF-κB [7]. This blunting of the inflammatory response could be interpreted as beneficial but conceptually it represents an interference with normal defence mechanisms against inhaled agents particularly microbes. In chronic exposures the normal adaptation to endotoxin does not take place if 1,3-β-glucan is given simultaneously; another example of interference with defence mechanisms [8]. Other data suggest that 1,3-β-glucan supports the Th2-related maturation of lymphocytes, increases the number of eosinophils in the airways after long-term inhalation exposure [9], and potentiates an ovalbumin induced eosinophilia [6]. A study in mice demonstrated that 1,3-β-glucan treatment supported a Th2-dependent antibody response to ovalbumin, suggesting that 1,3-β-glucan alters the susceptibility to environmental antigens [10]. There is evidence for this effect of 1,3-β-glucan in population studies. An increased proportion of persons with atopic sensitization or total IgE has been reported from mouldy environments [11]. A relationship has been found between airborne viable spores and total IgE levels in children [12]. A relation between markers of atopy and exposure to moulds was found in several studies [13-15]. An increased incidence of atopic persons was found among persons living in houses with higher levels of 1,3-β-glucan [16]. One study reported an association between 1,3-β-glucan in floor dust and the amount of IgE and the proportion of blood eosinophils but not with cellular markers of inflammation [17]. Among children at risk for allergy, exposure to Aspergillus at home was related to a lower content of Th1 cytokines, such as Interferon γ (IFNγ), TNFα, and Interleukin-2 secreted from T-cells [18]. A previously described development of allergy in adults working in a mouldy daycare centre could also be explained by such a mechanism [19]. In a recent study on young children, an inverse relationship was found between home levels of 1,3-β-glucan and wheezing [20]. As wheezing in this age group is caused by inflammation due to viral infections, these results suggest a blunting of the inflammatory response by 1,3-β-glucan. Several studies report an increased incidence of infection among school children in environments with mould with remediation after cleaning [21-23]. This supports a concept of a reduced resistance to pulmonary infections.

THE MODEL

Based upon the material reviewed above, a model for the effects of 1,3-β-glucan after inhalation is depicted in Figure 2.
Figure 2

Proposed model for 1,3-β-glucan activity after inhalation.

The body has a number of defence mechanisms against external challenges such as infectious, inflammagenic, and allergenic agents. It is suggested that a prolonged exposure to 1,3-β-glucan interferes with these defence mechanisms, leading to an increased risk for disease. If the effect of 1,3-β-glucan is a threshold phenomenon, there will not be a dose-response relationship with the exposure to moulds. Instead, the dose-response for the effective agent (e.g., endotoxin or allergen) in the environment will be shifted downwards and reflect sensitization. It is suggested that the model illustrated in Figure 2 could be used for further explorations on the effects of exposure to 1,3-β-glucan and moulds in the environment. The major components of the fungal cell wall are polysaccharides such as mannan, β-glucan, and chitin. β-glucan is the major component, accounting for approximately 50% of the cell wall mass [1, 2]. It is basically insoluble in water and alkaline solutions. In fungal infection diagnosis, serological and molecular tests are used to detect the fungus antigen, antibody, or gene. These tests are important in the early diagnosis as a supplement to the clinical and mycological diagnosis. The Limulus test using the 1,3-β-glucan-sensitive factor G is useful for the screening of general fungal infections [3]. The measured values correlate with clinical symptoms and pathological changes [4, 5]. Many researchers have examined the fungi-host relationship and antifungal protective immune mechanism. The importance of innate immunity (i.e., macrophages, neutrophils) and cellular immunity (T-helper type 1 cells) in the defense against fungi is widely acknowledged [6, 7]. Little is known about the effects of fungal antibody on the host response to fungal infection, and few fungal antigens have been characterized for their ability to elicit the production of protective antibodies. In this study, we examined the reactivity of the anti-β-glucan antibody (anti-BGAb), the β-glucan-anti-BGAb interaction in vivo and in vitro, and the role of this antibody in fungal infections. The measurements of anti-BGAb titers of sera were performed using an ELISA test, precoating with glucan preparations derived from various fungi. Binding of immunoglobulin was detected by peroxidase-conjugated antibody against each immunoglobulin isotype. The titer and reactivity of the anti-BGAb in healthy human volunteers were examined. Five kinds of polyclonal human immune globulin preparations were also tested. All sera and globulins tested contained anti-BGAb. There was a tenfold or higher variation in anti-BG titer between values from different individuals but there was no significant difference between sampling occasions. Human normal immune globulin showed higher reactivity to Candida solubilized BG (CSBG), a long β-1,6-linked glucan chain attached to the β-1,3-glucan chain from Candida albicans [8] and Aspergillus solubilized BG (ASBG), mainly composed of β-1,3-glucan from Aspergillus niger [9]. There was only a weak immune globulin response to GRN and 6-branched β-1,3-glucan from the mushroom Grifola frondosa [10] (Figure 3).
Figure 3

Comparison of reactivity of human immunoglobulin (polyglobin N × 1000) to various antigen-coated plates. CSBG = Candida solubilized cell wall β-glucan, ASBG = Aspergillus solubilized cell wall β-glucan , GRN = Grifolan from G. frondosa, LPS = lipopolysaccharide.

The lower levels in subjects with infection may be caused by attachment of the antibodies to cell wall β-glucan, similar to the findings in mice where administration of whole Candida cells caused a gradual decrease in antibody titers [11]. The decrease in anti-BGAb titer could thus be related to the progression of a fungal infection in patients with mycosis. Deep mycosis is a clinical problem also in animals. We compared the titer and reactivity of anti-BGAb among several animal species (monkey, horse, bovine, goat, pig, rabbit, mouse, dog, turkey, chicken) by ELISA, using plates precoated with various standard β-glucans or polysaccharides. Although species differences were present, anti-BGAb was found in every species and showed high reactivity to glucan derived from pathogenic fungal cell wall. Furthermore, we compared the anti-BGAb titer among fetal calf, calf and bovine. Fetal calf sera had very low titers but they were higher in calf and bovine sera. Also the titer was higher in the bovine sera than calf sera. These results suggest that anti-BGAb in native bovine sera is induced by fungi in the environment. To assess if anti-BGAb could act on Candida cells, we measured its effect on the candidacidal activity of human macrophages derived from THP-1. Candida albicans cells, anti-BGAb or control were added to the THP-1 and incubated for 3 hours. After incubation, nonphagocytosed Candida cells were collected and placed on YPG agar. anti-BGAb enhanced the candidacidal activity which suggests that it may modify the host defense against Candida through opsonization. We also examined the anti-BGAb interaction in vivo after administration of glucan. The anti-BGAb titer of DBA/2 mice which had received an intravenous dose of CSBG or ASBG decreased in a dose-dependent manner as compared to the titer before administration. These results suggest that anti-BGAb interacted with pathogenic fungal cell wall glucan specifically in vivo and that it was eliminated from the blood as an antigen-antibody complex. In a case study, anti-BGAb titers were measured in patients with aspergillosis (n = 2) and carinii pneumonia (n = 3) and with 1,3-β-glucan positive sera. The average titer in normals was 2371 units/mL, compared to 414 units/mL among those with fungal infection. The patients had significantly lower titers compared with normal volunteers. The anti-BGAb titer was reversely related to the clinical symptoms and galactomannan. It has previously been reported that plasma levels of 1,3-β-glucan are elevated in dialysis patients [12]. We compared the anti-BGAb titer of dialysis patients and healthy volunteers. In dialysis patients, the titer was lower than in healthy volunteers. Long-term (15–40 years) dialysis patients had lower titers than short-term (<5 years) dialysis patients. In conclusion, available data suggest that anti-BGAb could play a role for β-glucan recognition and induce clearance of pathogenic fungi and biological activity through collaboration with other recognition molecules such as β-glucan receptor or complement in human. Anti-BGAb interacted with pathogenic fungal cell wall glucan in vivo and was eliminated from the blood as an antigen-antibody complex. Measurements of anti-BGAb could be useful as a response index of pathogenic fungal cell wall β-glucan.

PURPOSE

To reexamine the efficacy of serum β-glucan assay in the diagnosis of invasive fungal infection.

METHODS

A total of 456 autopsy records consecutive over the 6-year period from January, 2000 to December, 2005 were reviewed for the presence or absence of invasive fungal infection. The sensitivity of the assay was calculated based on those cases that were pathologically proved to be invasive fungal infections and had been tested for serum β-glucan within 2 weeks before death. Likewise the sensitivity of blood culture was obtained for comparison. The specificity of the β-glucan assay was determined on those cases that had no evidence of invasive fungal infection and had had a glucan test within 2 weeks before death. The cutoff was set at 30 pg/mL, because the upper limit of the normal range was 25 pg/mL. The positive and negative predictive values of the test were estimated against cutoffs at 30, 60, and 80 pg/mL based on a model population whose prevalence of invasive fungal infection was simulated to that of the present series. In addition, the concordance between serum β-glucan assay and blood culture was studied by reviewing all the records of blood culture over the same 6-year period and collecting cases that grew fungi. Those who had been tested for serum β-glucan within 2 weeks of blood sampling for culture were selected and the concordance was calculated.

RESULTS

Out of 456 autopsies, 54 (12%) had invasive fungal infections. Leukemias were the most frequent underlying disease (52%), followed by lymphomas (13%) and AIDS (13%). The most frequent causative fungus was Aspergillus (70%). Out of the 54 cases with fungal infection, serum β-glucan was measured within 2 weeks before death in 41 cases, and 39 of those had a concentration higher than the cutoff value. One of the two negative cases was infected with Zygomycetes, a fungus that does not produce β-glucan. With this case excluded, the sensitivity of the serum β-glucan assay was 97.5% (39/40). Blood culture was performed in 48 of the 54 cases, and four of them were positive for fungi. The sensitivity of blood culture was thus only 8.3%. Out of 402 cases without fungal infections, 63 was tested for serum β-glucan within 2 weeks before death, and 54 of them showed the concentration lower than the cutoff. Thus, the specificity of β-glucan assay was 85.7%. The positive and negative predictive values of the β-glucan assay were 46.3% and 99.6% with cutoff at 30 pg/mL; 70.9% and 98.3% at 60 pg/mL, and 87.0% and 97.4% at 80 pg/mL. During the same 6 years, there were 21 fungus-positive blood cultures that were preceded or followed by serum β-glucan measurement within two weeks. The concentration of β-glucan was above 30 pg/mL in 17 cases. The concordance with blood culture, therefore, was 81% with the latter as a gold standard. Serum β-glucan assay is a highly sensitive and highly specific test for invasive fungal infection. With a cutoff set at 80 pg/mL, the test will rule in or rule out the diagnosis of invasive fungal infection with about 90% probability in hospitals where many patients with haematological malignancies and cancers are cared for. Peptide antibiotics exhibit potent antimicrobial activities against both Gram-positive and Gram-negative bacteria, fungi, and viruses, and they form one group of effector components in the innate host defense system. The peptide-based defense in mammals against invading microbes relies on the two evolutionally distinct groups of antimicrobial peptides, defensins, and cathelicidins, which have been identified in several epithelial tissues and in the granules of phagocytes. About 30 cathelicidin members have been identified from various mammalian species; however, only one cathelicidin hCAP18 (human cationic antibacterial protein of 18 kDa) has been found in humans, and its carboxyl terminal antibacterial peptide called LL-37 comprising 37 amino acid residues (L1LGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES37) has been identified. Secondary-structure predictions indicate that LL-37 adopts an α-helical amphipathic conformation; the helical wheel regions are clearly amphipathic and subtended by the hydrophilic (positively charged) and hydrophobic sectors. Among antibacterial peptides, defensins completely lose their antibacterial activities in the extracellular milieu containing a physiological concentration of NaCl (150 mM) and serum. In contrast, LL-37 can exhibit antibacterial activities against Gram-negative and Gram-positive bacteria under these conditions. Furthermore, LL-37 can bind to lipopolysaccharide (LPS) and neutralize its biological activities. Thus, LL-37 and its related derivatives could be attractive candidates for therapeutic agents that can be used not only for bacterial infections but also endotoxin shock/sepsis caused by Gram-negative bacterial infections. A short fragment peptide (18-mer; K15 to V32) of LL-37 displayed an amphipathic α-helical structure as illustrated in Figure 4.
Figure 4

Helical wheel projections for LL-37 and its 18-mer peptide derivatives. Positively charged residues are in white circles, hydrophobic residues are in black circles, neutral hydrophilic residues are in gray circles, and negatively charged residues are boxed.

This fragment possessed antibacterial and LPS-neutralizing activities almost equal to those of the parent LL-37 peptide. To develop the cathelicidin-derived antimicrobial peptides with enhanced biological activities, we utilized the 18 mer peptide (K15-V32) of human cathelicidin LL-37 (L1-S37) as a template, and evaluated the activities of its peptide derivatives [1, 2]. By replacement of E16 and K25 with two L residues, hydrophobicity of the peptide was increased, and hydrophobic sector in the helix was extended (Figures 1 and 2; 18-mer K15-V32 versus 18-mer LL). Concomitantly, pI value was increased from 11.50 to 12.22. Furthermore, by replacement of Q22, D26,and N30 with three K residues, hydrophilicity of the peptide was enhanced, and positively charged hydrophilic sector in the helix was expanded (18-mer LL versus 18-mer LLKKK), accompanied with the further increase of pI value from 12.22 to 12.82.

ANTIBACTERIAL ACTIVITIES 18-MER PEPTIDES

Antibacterial activities of the peptides were assessed by alamarBlue assay using Staphylococcus aureus (MSSA, meth- icillin-sensitive Staphylococcus aureus; MRSA methicillin-resistant Staphylococcus aureus), Escherichia coli, Streptococcus pneumoniae, Streptococcus pyogenes, and Pseudomonas aeruginosa as target organisms [1]. The 18-mer peptides as well as LL-37 inhibited the growth of these bacteria, and 18-mer LLKKK was the most potent among the peptide derivatives (Figure 5).
Figure 5

Hydrophilicity/hydrophobicity plots of LL-37 and its 18-mer peptide derivatives.

To further elucidate the mechanism for the antibacterial actions of LL-37-derived peptides, we assessed their membrane-permeabilization activities using E. coli ML-35p as a target organism. The peptide derivatives induced the outer and inner membrane permeabilization. The 18-mer LLKKK was the most potent among the LL-37-derived peptides at inducing the outer- and inner-membrane permeabilizations [1].

LPS-NEUTRALIZING ACTIVITIES OF 18-MER PEPTIDES

Further, we evaluated the LPS-neutralizing activities of LL-37-derived peptides by examining their effects on the binding of FITC-conjugated LPS to CD14-positive cells using a murine macrophage cell line RAW 264.7 [2]. The18-mer peptides as well as LL-37 suppressed the binding of FITC-conjugated LPS to RAW 264.7 cells, and 18-mer LLKKK was the most potent among the peptides tested at inhibiting the binding of FITC-conjugated LPS to RAW 264.7 cells (Figure 5). We also revealed that the 18-mer K15-V32, 18-mer LL, and 18-mer LLKKK peptides have a potential to bind to LPS, and 18-mer LLKKK was the most potent at binding to LPS and inhibiting LPS-LBP interaction [2]. Using D-galactosamine-sensitized mice, we assessed the effects of 18-mer peptides on lethal LPS activity in vivo [2]. The administration of 18-mer K15-V32, 18-mer LL, 18-mer LLKKK, or LL-37 increased the survival rate, and 18-mer LLKKK administration was the most protective. In agreement with this, administration of an 18-mer peptide or LL-37 markedly lowered the LPS-induced increase in serum TNF-α levels, and 18-mer LLKKK had the largest effect.

PERSPECTIVE

For prevention of bacterial infections, much attention has focused on the low-molecular-weight cationic antimicrobial peptides. Bacterial membrane contains large amounts of negatively charged phospholipids such as phosphatidylglycerol and cardiolipin. Thus, the cationic amphipathic antimicrobial peptides show high affinities for bacterial membrane components and kill bacteria by permeabilizing and/or disrupting bacterial membranes. Moreover, the positively charged amphipathic structures of antimicrobial peptides are assumed to be important for interaction with a negatively charged amphipathic LPS. We have revealed that by modifying the hydrophobicity and cationicity of the amphipathic α-helical antimicrobial peptide (LL-37-derived 18-mer peptide), the in vitro and in vivo biological (antibacterial and LPS-neutralizing) activities of the peptide could be enhanced [1, 2]. On the other hand, it has been demonstrated that high concentrations of cationic antimicrobial peptides are occasionally toxic to host cells [3] and that cytotoxicity is correlated with the extent of the hydrophobic regions in the peptides [4]. Although many problems still need to be solved, antimicrobial peptides could become one of the new classes of antibiotics that can be used for treatment of bacterial infections and their related symptoms in the future. The knowledge on 1,3-β-glucan has increased tremendously since the first glucan workshop in 1990 [1] and a textbook is now available on the toxicity of different forms of 1,3-β-glucan after different modes of administration [2]. The understanding of the effects of 1,3-β-glucan is complicated by the many steric forms present and also by the simultaneous presence of other agents in environments where 1,3-β-glucans are present. Regarding the neutrophil-based acute inflammatory response it seems as if nonwater soluble 1,3-β-glucan cannot elicit this response whereas water soluble forms and high doses may do so. A major advance in the knowledge has been the identification of a specific receptor and the development of specific antibodies which will facilitate the estimates of exposure both in clinical cases and in the general population. Determinations of 1,3-β-glucan in serum have become established as a clinical tool in deep mycosis and work is underway to further evaluate the role of 1,3-β-glucan in pulmonary diseases. A major enigma is still the effect of 1,3-β-glucan on the immune system after chronic exposure and how this could relate to the risk for allergic sensitization and the suppressive effects on tumor growth seen in some early animal models. Hopefully the proceedings from this glucan workshop will not only point to the importance of 1,3-β-glucan in the clinical and general environment but also stimulate further research.
  55 in total

Review 1.  Amphipathic, alpha-helical antimicrobial peptides.

Authors:  A Tossi; L Sandri; A Giangaspero
Journal:  Biopolymers       Date:  2000       Impact factor: 2.505

2.  Organic dust exposure and work-related effects among recycling workers.

Authors:  Toni Gladding; Jörgen Thorn; David Stott
Journal:  Am J Ind Med       Date:  2003-06       Impact factor: 2.214

3.  Airways inflammation among workers in poultry houses.

Authors:  Ragnar Rylander; Maria Fernanda Carvalheiro
Journal:  Int Arch Occup Environ Health       Date:  2006-01-04       Impact factor: 3.015

4.  Airways inflammation, atopy, and (1--> 3)-beta-D-glucan exposures in two schools.

Authors:  R Rylander; M Norrhall; U Engdahl; A Tunsäter; P G Holt
Journal:  Am J Respir Crit Care Med       Date:  1998-11       Impact factor: 21.405

5.  Airways inflammation and glucan exposure among household waste collectors.

Authors:  J Thorn; L Beijer; R Rylander
Journal:  Am J Ind Med       Date:  1998-05       Impact factor: 2.214

6.  Evidence for macrophage-mediated protection against lethal Candida albicans infection.

Authors:  F Bistoni; A Vecchiarelli; E Cenci; P Puccetti; P Marconi; A Cassone
Journal:  Infect Immun       Date:  1986-02       Impact factor: 3.441

7.  Evaluation of the diagnostic value of the measurement of (1-->3)-beta-D-glucan in patients with pulmonary aspergillosis.

Authors:  K Yuasa; H Goto; M Iguchi; T Okamura; R Ieki
Journal:  Respiration       Date:  1996       Impact factor: 3.580

8.  Pulmonary inflammation induced by repeated inhalations of beta(1,3)-D-glucan and endotoxin.

Authors:  B Fogelmark; M Sjöstrand; R Rylander
Journal:  Int J Exp Pathol       Date:  1994-04       Impact factor: 1.925

9.  Airway inflammation in waste handlers exposed to bioaerosols assessed by induced sputum.

Authors:  K K Heldal; A S Halstensen; J Thorn; W Eduard; T S Halstensen
Journal:  Eur Respir J       Date:  2003-04       Impact factor: 16.671

10.  Antitumor activity of a beta-1,3-glucan obtained from liquid cultured mycelium of Grifola frondosa.

Authors:  N Ohno; Y Adachi; I Suzuki; S Oikawa; K Sato; M Ohsawa; T Yadomae
Journal:  J Pharmacobiodyn       Date:  1986-10
View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.