Literature DB >> 18410525

Development of a novel antimicrobial peptide, AG-30, with angiogenic properties.

Tomoyuki Nishikawa1, Hironori Nakagami, Akito Maeda, Ryuichi Morishita, Nobuhiko Miyazaki, Toshihiro Ogawa, Yasuhiko Tabata, Yasushi Kikuchi, Hiroki Hayashi, Yoshiro Tatsu, Noboru Yumoto, Katsuto Tamai, Kazunori Tomono, Yasufumi Kaneda.   

Abstract

The utility of various synthetic peptides has been investigated in clinical trials of the treatment of pan class="Disease">cancers, infectious diseases and endocrine diseases. In the process of functional gene screening with in silico analysis for molecules with angiogenic properties, we generated a small peptide, angiogenic peptide (AG)-30, that possesses both antimicrobial and pro-inflammatory activities. AG-30 has an alpha-helix structure with a number of hydrophobic or net positively charged amino acids and a propensity to fold into amphipathic structures. Indeed, AG-30 exhibited antimicrobial activity against various bacteria, induced vascular endothelial cell growth and tube formation in a dose-dependent manner and increased neovascularization in a Matrigel plug assay. As a result, AG-30 up-regulated expression of angiogenesis-related cytokines and growth factors for up to 72 hrs in human aortic endothelial cells. To further evaluate the angiogenic effect of AG-30 in vivo, we developed a slow-release AG-30 system utilizing biodegradable gelatin microspheres. In the ischaemic mouse hind limb, slow-release AG-30 treatment results in an increase in angiogenic score, an increase in blood flow (as demonstrated by laser Doppler imaging) and an increase in capillary density (as demonstrated by immunostaining with anti-CD31 antibody). These data suggest that the novel peptide, AG-30, may have therapeutic potential for ischaemic diseases.

Entities:  

Mesh:

Substances:

Year:  2008        PMID: 18410525      PMCID: PMC3822513          DOI: 10.1111/j.1582-4934.2008.00341.x

Source DB:  PubMed          Journal:  J Cell Mol Med        ISSN: 1582-1838            Impact factor:   5.310


Introduction

Advances in analytic techniques have allowed for the characterization of synthetic peptides, and the utility of various synthetic pan class="Chemical">peptides has been investigated in clinical trials of the treatment of cancers, infectious diseases and endocrine diseases. Synthetic peptides have been widely used for clinical trials to treat intractable human diseases such as cancers, infectious diseases and endocrine diseases [1-3]. Unlike retrovirus vectors, synthetic peptides have little chance to integrate or recombinate to host genome, and can be analysed for purity and fidelity of sequencing using well-established analytical techniques [2]. One class of antimicrobial peptides possesses both antimicrobial and proinflammatory activities and can modulate pan class="Species">human immune system activity [4-6]. These peptides exhibit potent killing of a broad range of micro-organisms and serve as a first-line defence system as well as interact with host repair and adaptive immune responses [7], and levels of these peptides are increased in the context of inflammation and injury [8, 9]. Major antimicrobial peptides in mammals include the family of defensins and cathelicidin peptides. Antimicrobial peptides of the cathelicidin family consist of an amphipathic a-helix with positive charged residues separate from hydrophobic residues. These structures appear to be critical for the ability of these peptides to interact with the negatively charged microbial membrane in the initiation of antimicrobial effects and may also induce growth and migration of endothelial cells to achieve angiogenesis. Studies have demonstrated that molecules, PR-39 and LL-37, have potential for the treatment of pan class="Disease">ischaemic cardiovascular diseases [10, 11]. PR-39 is an anti-microbial peptide of the porcine cathelicidin family and induces angiogenesis by inhibiting the ubiquitin-proteasome-dependent degradation of HIF-1α[10]. The human cathelicidin family molecule, LL-37/hCAP18, is a 37-amino acid peptide beginning with two leucine residues that forms a linear amphipathic α-helix and that possesses a broad spectrum of antimicrobial activity [11]. Further, LL-37/hCAP18 acts as a chemoattractant of neutrophils, monocytes and T cells and promotes angiogenesis by binding to a G-protein-coupled receptor upstream of the PLC-γ/PKC/NFkB, ERK-1 and 2 MAPK, and the PI3K/Akt pathways [12]. Thus, some antimicrobial peptides can also stimulate angiogenesis. We recently screened a human cDNA library in an attempt to isolate angiogenic factors and successfully identified a powerful and potent angiogenic cDNA clone (p3743) [13]. Further analysis of the angiogenic clone facilitated the identification of a core sequence of EC growth activity. Interestingly, in silico analysis showed that the peptide from the core sequence (MLSLIFLHRLKSMRKRLDRKLRLWHRKNYP) was predicted to form an a-helical structure with a high percentage hydrophobic residues, a structure that is characteristic of various antimicrobial peptides [4-6]. Of note, some antimicrobial peptides (i.e. LL37 or PR39) may possess pleiotropically hormonal properties (e.g. induction of angiogenesis) as well as antibacterial action. Thus, the goal of the present study was to evaluate the potential angiogenic effect of an antimicrobial-like peptide.

Materials and methods

Peptide synthesis and circular dichroism (CD) spectroscopy analysis

Synthetic AG-30 (NH2 -MLSLIFLHRLKSMRKRLDRKLRLWHRKNYP-pan class="Chemical">COOH) and control peptide (NH2 - RSLEGTDRFPFVRLKNSRKLEFKDIKGIKR-COOH) were purchased from Peptide Institute, Inc. (Osaka, Japan). Control peptide and LL-37 were synthesized as per a previous report [12] and purchased from SIGMA Genosys (Hokkaido, Japan). CD data were acquired with Jasco J-820 Spectropho-tometer using a 1-mm path length cuvette [14]. Spectra were collected for samples of 50 μM AG-30 and control (Ctrl) peptide in 20 mM phosphate buffer at pH 7.5 and 37°C, with and without 1-mM 2-oleoyl-1-palmitoyl-sn-glycero-3-phosphocholine (POPC) or 1 mM 1-palmitoyl-2-oleoyl-sn-glycero-3-[phosphor-rac-(1-glycerol)] (sodium salt) (POPG) liposome. POPC and POPG were purchased from SIGMA-ALDRICH (St. Louis, MO, USA) and Avanti Polar Lipids (Alabaster, AL, USA), respectively.

Minimal inhibitory concentration (MIC) assays

MIC assays were conducted as previously described [15]. P. aeruginosa (PA) (ATCC27853), S. aureus (SA) (ATCC29213) and E. coli (EC) (ATCC25922) were grown in Mueller-Hinton broth (MHB) (Becton Dickison and Co., Sparks, MD, USA). Serial twofold dilutions of peptide were added to 1 ml of medium containing each type of bacteria (PA, SA and EC) at 1 × 105 CFU/ml. The tubes were incubated at 37°C with vigorous shaking for 16 hrs. The MIC was determined as the lowest peptide concentration that prevented visible growth of bacteria.

Cell cultures

HAECs (human aortic endothelial cells) and HASMCs (human aortic smooth muscle cells) (passage 3) were purchased from Clonetics Corp. (Palo Alto, CA, USA) and were maintained in endothelial basal medium (EBM-2 medium) supplemented with 5% fetal bovine serum (FBS) and endothelial growth supplement, as described previously [16] or smooth muscle medium supplemented with 5% FBS and smooth muscle growth supplement.

Cell viability and migration assay

HAECs and HASMCs (103 cells/well) were seeded on 96-well collagen I-coated plates the day before transfection. Cell viability of HAECs and pan class="Chemical">HASMCs were measured using the MTS [3-(4,5-dimethylthiazol-2-yl)-5-(3-carboxymethoxyphenyl)-2-(4-sulfophenyl)-2H-tetrazolium] Assay. On the first, second and fourth day (fifth day for HASMCs) after transfection, 10 μl of CellTiter 96 One Solution Reagent (Promega, Madison, WI, USA) was added to each well, and absorbance at 490 nm was measured. HAEC chemokinetic migration was assayed using a modified Boyden chamber, as previously described [17]. 106 cells/ml of HAEC suspended in 50-μl EBM2 medium containing either AG-30, pan class="Gene">LL-37 or control peptide (10 μg/ml) were added to the upper chamber. After 24-hr incubation, the membrane was removed. The cells on the lower side of the membrane were stained with Diff-Quick (Sysmex, Hyogo, Japan). The number of cells was counted in eight randomly chosen fields under ×100 magnification. Chemotactic migration of HAEC in response to AG-30 was also assessed using a modified Boyden chamber as previously described [18]. In brief, pan class="Chemical">AG-30 was added in different concentrations (0.1, 1.0 and 10 μg/ml) in the lower chambers, and HAEC (106 cells/ml in 50 μl) suspended in EBM2 medium (1% BSA and no growth factor added) were added to the upper chambers. After 4-hr incubation, the membrane was removed and the migrated cells were counted as described above.

Tube formation assay

HAEC tube formation assay was conducted in triplicate in a 24-well plate using an Angiogenesis Kit (Kurabo, Osaka, Japan), as per the manufacturer's instructions. Human endothelial and fibroblast cells in the kit were cultured in Optimized Medium supplemented with 1% FBS, followed by daily treatment with AG-30 peptide (0.1, 1, 10 μg/ml), LL-37 peptide (1 and 10 μg/ml) or control peptide (1, 10 μg/ml). Seven days later, cells were stained with anti-human CD31 monoclonal antibody. Stained cells were photographed, and tubule-like structures in the images were analysed by an Angiogenesis Image Analyzer (Kurabo, Osaka, Japan).

In vivo Matrigel plug assay

Two different types of Matrigel plug assays were performed as previously described [17]. First, growth factor-depleted Matrigel (0.5 ml, BD Biosciences, Franklin Lakes, NJ, USA) was mixed with 40 U/ml of heparin (Aventis Pharma, Tokyo, Japan) and either pan class="Chemical">AG-30 peptide (10 μg/ml), control peptide (10 μg/ml) or no peptide. The mixture was then injected subcutaneously into C57BL/6 male mice obtained from Oriental Bio Science Co., Ltd. (Kyoto Japan). After 7 days, the mice were humanely killed, and the plugs were recovered and fixed in methanol. For immunostaining, sections were incubated with monoclonal anti-CD31 (PECAM-1) antibody (1:100 dilution, BD Pharmigen, San Diego, CA, USA) and anti-α-smooth muscle actin antibody (1:400 dilution, SIGMA, Saint Louis, MO, USA) overnight at 4°C, and then incubated in Alexa Flour 488 and 546 secondary antibodies (1:500, Molecular Probes, Eugene, OR, USA) for 2 hrs before photography. Next, the directed in vitro angiogenesis assay (DIVAA) (Trevigen, Inc., Gaithersburg, MD, USA) was performed essentially as per the manufacture's instructions. In brief, sterilized DIVAA angioreactors were filled with 18 μl of Basement Membrane Extract (BME) with AG-30 peptide (10 μg/ml) or control peptide (10 μg/ml). The angioreactors were implanted subcutaneously into the dorsal area of C57BL/6 male mice (6 weeks of age) and maintained for 15 days. All experimental protocols were approved by the Osaka University Graduate School of Medicine Standing Committee on Animals.

Microarray analysis

HAEC RNA samples that had been stimulated with or without AG-30 peptide (10 μg/ml) after 24 and 72 hrs were extracted, and the quality of these samples was examined using the Agilient 2100 Bioanalyzer (Agilient Technologies, Palo Alto, CA, USA). RNA amplification and labelling was performed following the LRIFLA protocol (Agilent Low RNA Input Fluorescent Linear Amplification Kit Protocol, version 2.0. Agilient Technologies, Palo Alto, CA, USA). pan class="Chemical">AG-30 stimulated and non-stimulated cDNA samples were labelled by Cyanine 3- and 5-labelled CTP (cystidine 5-triphosphate) respectively. Hybridization was performed according to instructions provided by the Agilent oligonucleotide microarray hybridization user manual (Agilient Technologies, Palo Alto, CA, USA). Finally, 0.75 μg of labelled cDNA was applied to a Whole Human Genome Oligonucleotide Microarray and then hybridized. The arrays were scanned by the Agilent dual-laser DNA microarray scanner and analysed by Feature Extraction software.

Real-time quantitative reverse transcription polymerase chain reaction (qRT-PCR)

After treatment with AG-30 peptide (10 μg/ml), HAEC RNA was extracted at 72-hr time points using the RNeasy Mini kit (QIAGEN, Valencia, CA, USA). Complementary DNA was synthesized using the Thermo Script RT-PCR System (Invitrogen, Carlsbad, CA, USA). Relative gene copy numbers of pan class="Gene">interleukin-8 (IL-8: Hs00174103), angiopoietin-2 (Ang-2: Hs00169867) Jagged 1 (Jag-1:Hs00164982), insulin-like growth factor-1 (IGF-1: Hs00153126), vascular endothelial growth factor (VEGF: Hs00173626) and GAPDH (Hs99999905) were quantified by real-time qRT-PCR using TaqMan Gene Expression Assays (Applied Biosystems, Foster City, CA, USA). The absolute number of gene copies was normalized using GAPDH and standardized by a sample standard curve. Results are expressed as fold-increase relative to the non-stimulants for copy numbers of each mRNA.

Preparation of gelatin microspheres incorporating AG-30

The carboxyl groups of gelatin with an isoelectric point of 5.0 (MW 100,000) were prepared from pig skin by an acid process (Nitta gelatin Inc., Osaka, Japan) and were chemically converted by introducing amino groups for cationization of gelatin as previously described [19]. To impregnate AG-30 into gelatin microspheres, 20 μl of PBS containing 100 or 500 μg of AG-30 or control peptide was placed onto 2 mg of freeze-dried gelatin microspheres, followed by incubation for 24 hrs at 4°C. Before injection into the ischaemic hindlimb, 80 μl of PBS was added to this solution.

Evaluation of in vivo degradation of gelatin microspheres

Gelatin microspheres were radioiodinated using [125I] Bolton-Hunter reagent [20]. The pan class="Chemical">125I-labelled gelatin microspheres (2 mg/200 1 PBS/mouse) were subcutaneously injected into the back of 6- to 8-week-old C57BL/6 mice (Japan SLC, Inc., Hamamatsu, Japan). At 3, 7, 14 and 21 days after injection, the mouse skin and muscle containing the gelatin microspheres were excised in order to measure their radioactivity on a gamma counter. The radioactivity ratio of the sample to the gelatin microspheres injected initially was measured to express the percentage of remaining radioactivity in the gelatin microspheres. AG-30 was also radioiodinated and gelatin microspheres incorporating 100 μg of 125I-labelled AG-30 were prepared similarly and subcutaneously injected to mice at the injection volume of 200 μl. The percentage of remaining radioactivity in AG-30 was similarly calculated. All animal experiments were performed in accordance with the Institutional Guidelines of Kyoto University on Animal Experimentation.

Mouse hind limb ischaemic model and evaluation of angiogenesis

Wild-type C57Bl/6J mice (8-week old, male) were anaesthetized with keta-mine chloride (80 mg/kg) and xyladine sulfate (8 mg/kg) subcutaneously and unilateral hind limb ischaemia was induced as described previously [21]. The solution containing AG-30 or control peptide was carefully injected into the mouse ischaemic limb with a 26-gauge needle. Three separate injections of cells (intramuscularly into the ischaemic limb, near both the proximal and distal arterial stumps) were performed. All experimental protocols were approved by the Medicine Standing Committee on Animals of the Osaka University Graduate School. Blood flow was assessed by laser Doppler imaging (LDI: Moor Instruments, Devon, United Kingdom) before and on post-treatment days 7, 14, 21 and 28 as described previously [21]. Mice were assigned to one of four groups: injection of AG-30 (500 μg) with gelatin, AG-30 (100 μg) with gelatin, control peptide (500 μg) with gelatin and only AG-30 (500 μg). Capillary density within the ischaemic thigh adductor skeletal muscles was analysed to obtain specific evidence of vascularity at the level of the microcirculation. After fixation in cold acetone (−20°C for 15 min.) capillary endothelial cells (EC) were identified by immunohistochemical staining with anti-mouse PECAM mAb (Pharmingen, San Diego, CA, USA).

Statistical analysis

All values are expressed as mean ± S.E.M. Analysis of variance with subsequent Fisher's PLSD test was employed to determine the significance of differences in multiple comparisons.

Results

Novel angiogenic peptide, AG-30

Review of the protein databases (Blast in the NCBI database) failed to identify any known proteins with homology to this antimicrobial-like peptide, which we subsequently designated as AG (angiogenic peptide)-30. Structural analysis by the AGADIR program suggested that AG-30 forms an a-helix structure (predicted value: 21.17%) and an amphipathic structure in which most positively charged amino acids are localized to one side of the molecule with most hydrophobic amino acids localized to the other side of the molecule (see hydrophobic cluster analysis [HCA] plot [22] in Fig. 1A). To follow and give a better impression of the environment of each amino acid widely seecies">parated by the unfolding of the cylinder, hydrophobic residues were encircled, demonstrating sets of adjacent hydrophobic residues in hydrophobic clusters (Fig. 1B). Of note, there were very few pan class="Chemical">proline or glycine residues that would otherwise interrupt the α-helical structure. The structure of this peptide is reminiscent of that of some antimicrobial peptides that directly interact with bacterial membranes.
1

Conformation analysis of AG-30. (A) Schematic wheel plot of amino acid distribution of AG-30 in alpha-helical structure (http://www.nmr.cabm.rutgers.edu/bioinformatics/Proteomic_tools/Helical_wheel/). The hydrophobic amino acids are represented in gold, positive charged amino acids in green, negative charged amino acids in red-purple, proline in red and the other amino acids in blue-purple. (B) Protein sequence analysis on an alpha-helical 2D pattern using an HCA plot (http://bioserv.rpbs.jussieu.fr/RPBS/cgi-bin/Ressource.cgi?chznlg=fr&chzn_rsrc=HCA). The hydrophobic residues are represented in yellow-green and encircled, and different symbols used for P (*), and S (???). The positively charged amino acids are represented in purple, and the negatively charged amino acid (D) or other amino acids (N) are represented in red. (C) Secondary structure analysis of AG-30 and control peptide (Ctrl) by circular dichroism spectroscopy. CD spectra of AG-30 (50 μmol/L) and control peptide (50 μmol/L) without liposome (black line), with POPC (blue line) and with POPG (red line). Molar ellipticities, which indicates dimensions degrees decilitres mol–1 decimeter−1, were plotted against wavelength from 195 to 255 nm.

Conformation analysis of AG-30. (A) Schematic wheel plot of amino acid distribution of pan class="Chemical">AG-30 in alpha-helical structure (http://www.nmr.cabm.rutgers.edu/bioinformatics/Proteomic_tools/Helical_wheel/). The hydrophobic amino acids are represented in gold, positive charged amino acids in green, negative charged amino acids in red-purple, proline in red and the other amino acids in blue-purple. (B) Protein sequence analysis on an alpha-helical 2D pattern using an HCA plot (http://bioserv.rpbs.jussieu.fr/RPBS/cgi-bin/Ressource.cgi?chznlg=fr&chzn_rsrc=HCA). The hydrophobic residues are represented in yellow-green and encircled, and different symbols used for P (*), and S (???). The positively charged amino acids are represented in purple, and the negatively charged amino acid (D) or other amino acids (N) are represented in red. (C) Secondary structure analysis of AG-30 and control peptide (Ctrl) by circular dichroism spectroscopy. CD spectra of AG-30 (50 μmol/L) and control peptide (50 μmol/L) without liposome (black line), with POPC (blue line) and with POPG (red line). Molar ellipticities, which indicates dimensions degrees decilitres mol–1 decimeter−1, were plotted against wavelength from 195 to 255 nm.

Antimicrobial effect of AG-30

To examine whether AG-30 may form a helix structure, CD analysis was performed. pan class="Chemical">AG-30 and the control peptide were subjected to structural analysis in phosphate buffer (PB), and no helical structure was observed for either AG-30 or the control peptide. Importantly, after the addition of POPC liposomes (mimicking a zwitterionic eucaryotic membrane) or POPG liposomes (mimicking a bacterial membrane) in PBS, AG-30 showed a helical propensity in membrane mimetic solvent, especially in POPG. Upon combining AG-30 and liposomes, the negative molar ellip-ticy, suggestive of a coiled shape, changed to a recognizable positive value, indicative of a helical structure in the region of 185–195 nm (Fig. 1C). The region from 195 to 225 nm also retained a characteristic shape for a coil without liposomes and a helical structure in POPG. AG-30 showed antimicrobial activity against pan class="Species">P. aeruginosa (MIC: 5 μg/ml), E. coli (MIC: 40 μg/ml), and S. aureus (MIC: 20 μg/ml) (Table 1) through a lytic’ action by attaching to cationic peptides. Addition of exogenous CaCl2 or MgCl2 (3 mmol/L or 6 mmol/L) completely attenuated the antimicrobial effect of AG-30 against P. aeruginosa (data not shown). These results suggest that AG-30 transforms its structure to α-helix when it encounters bacterial membrane, thereby acting as antimicrobial peptide by disrupting the bacterial membrane.
1

Minimal inhibitory concentrations (MIC*: μg/ml) of AG-30 and LL-37

AG30LL37Control
E. coli (ATCC 25922)40.05.00>80
P. aeruginosa (ATCC 27853)5.002.50>10
S. aureus (ATCC 29213)20.0>80>80

MIC was defined as the lowest concentration of peptide that inhibited the bacterial visible growth after incubation for 16 hrs at 37°C with vigorous shaking.

Minimal inhibitory concentrations (MIC*: μg/ml) of AG-30 and pan class="Gene">LL-37 MIC was defined as the lowest concentration of peptide that inhibited the bacterial visible growth after incubation for 16 hrs at 37°C with vigorous shaking.

Angiogenic property of AG-30

Some antibacterial peptides also possess angiogenic properties. In a pan class="Species">human endothelial cell viability assay, AG-30 increased MTS activity in a dose-dependent (from 0.1 to 1.0 μg/ml) manner, and was more potent than LL-37 (Fig. 2A). Treatment with AG-30 also increased vascular smooth muscle cell viability in a dose-dependent manner (from 0.1 to 1.0 μg/ ml), as assessed by MTS assay (Fig. 2B). Human cell lines, such as HEK293, SAS (tongue cancer), HuH7 (hepatoma) and HeLa (cervical cancer) did not show significant response in viability in response to AG-30 stimulation (data not shown). In addition, chemokinetic cell migration significantly increased in response to AG-30 (which was more potent than LL-37) but not in response to control peptide (Fig. 2C). We have also addressed the chamotactic action of AG-30 by the addition of AG-30 in the lower chambers and HAEC in the upper chambers. As a result, the treatment of AG-30 with HAEC showed not only chemokinetic migration but also chemotactic action (Fig. 2D), although the chemokinetic action of AG-30 was stronger than chemotactic action. Further, tube formation was greater in response to AG-30 treatment when compared with LL-37 or control peptide treatment (Fig. 2E). These data demonstrate that AG-30 was superior to LL-37 in terms of inducing endothelial cell growth, migration and tube formation.
2

Effect of AG-30 peptide on human aortic endothelial cells (HAEC) and human aortic smooth muscle cells (HASMC). (A) MTS assay with HAEC on days 1, 2 and 4. (B) MTS assay with HASMC on days 1, 3, and 5. (C) Chemokinetic migration assay with HAEC. Lower panel shows representative pictures of each group. (D) Chemotactic migration assay by the addition of AG-30 in the lower chambers (0.1, 1.0 and 10 μg/ml). *P < 0.01 versus NC, ‡P < 0.05 versus NC. n= 8 per group. (E) Tube formation, quantified as area and length. Lower panel shows representative pictures of each group. ‘Ctrl’ indicates treatment with control peptide. ‘AG-30’ indicates treatment with AG-30 peptide (10 μg/ml). ‘LL-37’ indicates treatment with LL-37 peptide (10 μg/ml). Results are expressed as fold-increase relative to the effect of NC (no treatment) for MTS assay and percentage increase to the effect of NC for migration and tube formation, respectively. *P < 0.05 versus NC, †P < 0.05 versus Ctrl, ‡P < 0.05 versus LL-37. n= 8 per group.

Effect of AG-30 peptide on pan class="Species">human aortic endothelial cells (HAEC) and human aortic smooth muscle cells (HASMC). (A) MTS assay with HAEC on days 1, 2 and 4. (B) MTS assay with HASMC on days 1, 3, and 5. (C) Chemokinetic migration assay with HAEC. Lower panel shows representative pictures of each group. (D) Chemotactic migration assay by the addition of AG-30 in the lower chambers (0.1, 1.0 and 10 μg/ml). *P < 0.01 versus NC, ‡P < 0.05 versus NC. n= 8 per group. (E) Tube formation, quantified as area and length. Lower panel shows representative pictures of each group. ‘Ctrl’ indicates treatment with control peptide. ‘AG-30’ indicates treatment with AG-30 peptide (10 μg/ml). ‘LL-37’ indicates treatment with LL-37 peptide (10 μg/ml). Results are expressed as fold-increase relative to the effect of NC (no treatment) for MTS assay and percentage increase to the effect of NC for migration and tube formation, respectively. *P < 0.05 versus NC, †P < 0.05 versus Ctrl, ‡P < 0.05 versus LL-37. n= 8 per group. The in vivo angiogenic activity of AG-30 has been evaluated by an established pan class="Species">mouse Matrigel plug assay [23]. Matrigel, containing either control peptide or AG-30, was subcutaneously injected into male C57BL/6 mice. Seven days later, neovessels containing intact red blood cells were more numerous in mice that received Matrigel plug containing AG-30 than in mice receiving Matrigel plug containing control peptide. The increased presence of neovessels in the AG-30-treated group relative to the other groups was confirmed by immunostaining with anti-CD31 and anti-a-smooth muscle actin antibody (Fig. 3A). Further, these results were reproduced using another type of matrigel assay (DIVAA), and quantification by FITC-lectin staining showed that treatment with AG-30 significantly increased neovessels with a potency that was superior to that of LL-37 (Fig. 3B). In combination with the results demonstrated above, these data suggest that AG-30 induces angiogenesis via increased endothelial cell and smooth muscle cell migration and invasion.
3

Effect of AG-30 peptide on in vivo angiogenesis evaluated by Matrigel plug assay and directed in vivo angiogenesis assay (DIVAA). (A) Representative pictures of the Matrigel with AG-30 peptide or control peptide (10 μg/ml). Matrigel plugs were stained with anti-CD31 antibody (green) or anti-α-smooth muscle antibody (red), and capillary like structures were photographed ×100 magnification) under a fluorescent microscope. (B) Left panel shows that representative pictures of angioreactors implanted in mice, and the right panel shows the quantification of FITC-lectin positive cells that were treated with control peptide (10 μg/ml), LL-37 (10 μg/ml), AG-30 (10 μg/ml) or no treatment (NC). *P < 0.05 versus NC, †P < 0.05 versus Ctrl, ‡P < 0.05 versus LL-37. n= 3–4 per group.

Effect of AG-30 peptide on in vivo angiogenesis evaluated by Matrigel plug assay and directed in vivo angiogenesis assay (DIVAA). (A) Representative pictures of the Matrigel with pan class="Chemical">AG-30 peptide or control peptide (10 μg/ml). Matrigel plugs were stained with anti-CD31 antibody (green) or anti-α-smooth muscle antibody (red), and capillary like structures were photographed ×100 magnification) under a fluorescent microscope. (B) Left panel shows that representative pictures of angioreactors implanted in mice, and the right panel shows the quantification of FITC-lectin positive cells that were treated with control peptide (10 μg/ml), LL-37 (10 μg/ml), AG-30 (10 μg/ml) or no treatment (NC). *P < 0.05 versus NC, †P < 0.05 versus Ctrl, ‡P < 0.05 versus LL-37. n= 3–4 per group.

Microarray and real-time PCR Analysis in AG-30-treated endothelial cells

To confirm the mechanism of AG-30-induced angiogenesis, differences in gene expression were assessed by microarray analysis (total 43,941 genes). At 6, 24 and 72 hrs after the start of treatment, 47 genes (0.001%), 61 genes (0.13%) and 287 genes (0.65%) were up-regulated and 2 genes (0.00005%), 297 genes (0.67%) and 288 genes (0.66%), were down-regulated, respectively. Subsequent cluster analysis with GeneSpring software revealed at least a twofold increase in pan class="Gene">angiopoietin 2 (Ang-2), IL8, JAG1, IGF-1, ETS variant gene 7, and chemokine ligand 2 (CCL2) and chemokine receptor 4 (CXCR4) (data not shown). Further, up-regulation of these angiogenesis-related genes occurred in a time-dependent manner for most genes and was maintained for at least 72 hrs (Table 2). We further carried out quantitative RT-PCR of these angiogenesis-related molecules in triplicates to confirm if they would be up-regulated or not. Indeed, we confirmed the increased expression of Ang-2 by 6.24-fold increases in average, IL-8 by 8.45-fold, Jag-1 by 2.82-fold, VEGF by 3.28-fold and IGF-1 by 2.82-fold, respectively, at 72 hrs after AG-30 stimulation (Fig. 4). These results suggest that these angiogenesis-related genes are actually up-regulated and may synergistically induce angiogenesis after the treatment with AG-30.
2

Cluster analysis using GeneSpring software to detect a twofold increased or decreased in gene expression at 72 hrs after AG-30 treatment

6 hrs24 hrs72 hrs
Angiopoietin 21.032.188.52NM_001147
Angiopoietin-like 4, transcript variant0.801.645.46NM_139314
Interleukin 81.001.453.92NM_000584
Jagged 11.731.313.90NM_000214
Epiregulin1.271.722.45NM_001432
Vascular endothelial growth factor1.360.872.07NM_003376
Insulin-like growth factor0.851.172.07NM_00061
Neuropilin-1 soluble isoform 110.150.210.20AF280547
4

Real-time quantitative reverse transcriptase polymerase chain reaction of angiopoietin-2 (Ang-2), Interleukin-8 (IL-8), Jagged 1 (Jag-1), vascular endothelial growth factor (VEGF) and insulin-like growth factor-1 (IGF-1) transcripts in HAEC at 72 hrs after treatment with AG-30. Results are expressed as fold-increase relative to the non-stimulants for copy numbers of each mRNA. *P < 0.05 versus Ctrl. n= 3 per group.

Cluster analysis using GeneSpring software to detect a twofold increased or decreased in gene expression at 72 hrs after AG-30 treatment Real-time quantitative reverse transcriptase polymerase chain reaction of angiopoietin-2 (pan class="Gene">Ang-2), Interleukin-8 (IL-8), Jagged 1 (Jag-1), vascular endothelial growth factor (VEGF) and insulin-like growth factor-1 (IGF-1) transcripts in HAEC at 72 hrs after treatment with AG-30. Results are expressed as fold-increase relative to the non-stimulants for copy numbers of each mRNA. *P < 0.05 versus Ctrl. n= 3 per group.

Effect of slow-release AG-30 in a mouse ischaemic hind limb model

Finally, we evaluated the angiogenic effect of AG-30 in a pan class="Species">mouse ischaemic hind limb model. To achieve sustained administration of AG-30 over a local area, a slow-release system was developed using cationic microspheres. As AG-30 includes a number of cationic amino acids, an anionic gelatin might be suitable for slow release of AG-30. However, a part of the gelatin might bind to AG-30 and interfere with its angiogenic effect. Thus, we used PI (iso-electric point) = 5 gelatin, which has been used for the delivery of recombinant FGF-2 in clinical trials of therapeutic angiogenesis. Characterization of the slow release profile of AG-30 (Fig. 5A) revealed that the PI = 5 gelatin slowly dissolved and disappeared in mice within approximately 14 days and that AG-30 was rapidly released within the first 3 days.
5

Angiogenic effect of AG-30 in mouse ischaemic hind limb model. (A) Slow release profile of 125I-labelled AG-30 with/without gelatin microspheres or 125I-labelled gelatin at 3, 7, 14 and 21 day. (B) Evaluation of angiogenic effect by measuring mouse hind limb blood flow at pre-treatment (pre), 1, 2, 3 and 4 week. Ischaemic hind limb mouse were treated with gelatin/AG-30 (500 μg or 100 μg), gelatin/control peptide (500 μg), only AG-30 (500 μg) or PBS. Upper panel shows representative pictures of LDI images of hind limb blood flow at pre-, 2 and 4 weeks after treatment. *P < 0.05 versus control peptide gelatin. (C) Evaluation of capillary density of the AG-30-treated ischaemic hind limb. Upper panel shows representative photomicrographs (×400) of tissue immunostained with anti-CD31 antibody. Lower panel shows number of capillary per field. *P < 0.05 versus control peptide gelatin. n= 5–8 per group.

Angiogenic effect of AG-30 in pan class="Species">mouse ischaemic hind limb model. (A) Slow release profile of 125I-labelled AG-30 with/without gelatin microspheres or 125I-labelled gelatin at 3, 7, 14 and 21 day. (B) Evaluation of angiogenic effect by measuring mouse hind limb blood flow at pre-treatment (pre), 1, 2, 3 and 4 week. Ischaemic hind limb mouse were treated with gelatin/AG-30 (500 μg or 100 μg), gelatin/control peptide (500 μg), only AG-30 (500 μg) or PBS. Upper panel shows representative pictures of LDI images of hind limb blood flow at pre-, 2 and 4 weeks after treatment. *P < 0.05 versus control peptide gelatin. (C) Evaluation of capillary density of the AG-30-treated ischaemic hind limb. Upper panel shows representative photomicrographs (×400) of tissue immunostained with anti-CD31 antibody. Lower panel shows number of capillary per field. *P < 0.05 versus control peptide gelatin. n= 5–8 per group. At 10 days after unilateral ligation of the femoral artery of the mouse hind limb, blood flow was measured by LDI. Figure 5B shows representative LDI images of hind limb blood flow at 0, 14 and 28 days after injection. Although serial LDI examination revealed natural recovery of hind limb blood flow in the control peptide group, injection of AG-30 (500 μg) with gelatin resulted in more rapid recovery of the ratio of ischaemic(normal blood flow and a significantly sustained increase, but injection of AG-30 (100 μg) with gelatin or only AG-30 did not. Figure 5C shows representative photomicrographs of tissue immunostained with anti-CD31 antibody. Quantitative analysis revealed that the capillary density was significantly increased in the pan class="Chemical">AG-30 (500 μg) with gelatin group when compared with other groups.

Discussion

The present study demonstrated that a novel small peptide, AG-30, induced angiogenesis by promoting the expression of diverse angiogenic molecules. pan class="Chemical">AG-30 was predicted to belong to a family of antimicrobial peptides that function to protect the host organisms against a large variety of invading pathogens [4-6]. These peptides are usually highly amphipathic molecules with hydrophobic and hydrophilic moieties segregating into distinct domains on the molecule surface. In response to a bacterial membrane, AG-30 transforms to an α-helix structure and disrupts the membrane via a lytic effect. By contrast, the eucaryotic membrane does not induce a change in pan class="Chemical">AG-30 structure change into an α-helix. Cholesterol, which is an essential component in the eucaryotic cell membrane, prevents self-damage of endogenous antimicrobial peptides [24]. This differential phenomenon underlies the ability of AG-30 to kill bacteria while simultaneously promoting endothelial cell growth. Defensins and cathelicidin families are well known as antimicrobial peptides, which are related to angiogenesis. Defensin contains 6–8 cysteine residues that form characteristic disulfide bridge, and shows β-sheet structure [25], which may be different from that of AG-30. In antimicrobial properties, both peptides can cover the similar broad spectrum, however AG-30, but not defensin, can directly induce angiogenesis. Moreover, defensin may induce apoptosis of human umbilical vein endothelial cell (HUVEC) and inhibits new capillary formation [26]. Human cathelicidin LL-37, on the other hand, is a peptide which has both antimicrobial and angiogenic effects [25]. In the present study, AG-30-stimulated EC growth, cell migration, tube formation and in vivo arteriogenesis was more potent than LL-37. LL-37-mediated angiogenesis is dependent on stimulation of a G-protein-coupled receptor that is upstream of the PLC-γ/PKC/NFkB, ERK-1 and 2 MAPK, and the PI3K/Akt pathways. Another porcine cathelicidin peptide, PR-39, appears to affect angiogenesis by inhibiting the ubiquitin-proteasome-dependent degradation of HIF-1α[10]. In our study, microarray analysis demonstrated that AG-30 induced increases in IGF-1, IL-8, JAG1, CCL2, CXCR2 or Ang-2 expression, all of which may independently induce angiogenesis [27-29]. For example, IL-8 is a potent chemotactic cytokine that induces migration during angiogenesis [30] and its expression is regulated by NF-κB. Jagged-1 is a ligand of Notch signalling that regulates embryonic patterning and binary cell fate decisions and plays a critical role in mammalian embryogenesis and vascular development [31]. Although the exact mechanism is unclear, AG-30 could potentially act on several key molecules to regulate gene expression via autocrine or paracrine effects, thereby resulting in angiogenesis or vasculogenesis. The effect of AG-30 on up-regulation of angiogenic genes appeared to be much slower than that of typical cell surface receptor-mediated processes. In fact, the pan class="Chemical">AG-30-induced up-regulation of angiogenic genes was time-dependent and was maintained for at least 72 hrs. Of importance, we found that AG-30 was present in the nucleus at 24 or 48 hrs after treatment, which is a unique phenomenon when compared with other microbial peptides. Thus, AG-30 may enter the cytoplasm and nucleus in a sequential fashion to ultimately interact directly with transcription factors to regulate gene expression. We speculate that the ability of AG-30 to enter intracellular compartments may be cell type-dependent. A slow-release system was used to stabilizing AG-30, as naked pan class="Chemical">AG-30 peptide is very unstable and is easily degraded by proteases in vivo. As shown in Figure 4A, gelatin microspheres enabled the slow release of AG-30 in muscle over a period of 2 weeks in response to a single injection. One unique advantage of gelatin is its variable electrical nature (produced by altering the processing method of collagen) [32] that can be used to change its degradation rate or to modulate the physicochemical interactions between the drug and gelatin molecules [33]. The present study developed a suitable slow release system for AG-30 that resulted in therapeutic angiogenesis in a mouse ischaemic hind limb model. The release of AG-30 is driven by enzymatic degradation of carrier gelatin microspheres. Previous studies have reported the absence of inflammation, macrophage accumulation and granuloma formation around the injected site of cationized gelatin microspheres and that the degree of inflammatory reaction was dependent on the type and size of the particle [34]. Moreover, gelatin itself has been used for medical applications, and its biosafety has been proved through its extensive clinical use in surgical biomaterials. Thus, the use of this system may allow the application of AG-30 in various clinical conditions. In summary, the present study identified a unique angiogenic and antimicrobial peptide, AG-30, with potential clinical applications. However, since small pan class="Chemical">peptides are typically not stable in vivo, development of a drug delivery system to establish slow release of this peptide would be required for clinical utility.
  34 in total

1.  Defensins and host defense.

Authors:  T Ganz
Journal:  Science       Date:  1999-10-15       Impact factor: 47.728

2.  Development of high-throughput functional screening of therapeutic genes, using a hemagglutinating virus of Japan envelope vector.

Authors:  Tomoyuki Nishikawa; Hironori Nakagami; Atsushi Matsuki; Akito Maeda; Chiah Yian Yo; Taku Harada; Ryuichi Morishita; Katsuto Tamai; Yasufumi Kaneda
Journal:  Hum Gene Ther       Date:  2006-04       Impact factor: 5.695

3.  Hydrophobic cluster analysis: an efficient new way to compare and analyse amino acid sequences.

Authors:  C Gaboriaud; V Bissery; T Benchetrit; J P Mornon
Journal:  FEBS Lett       Date:  1987-11-16       Impact factor: 4.124

4.  Involvement of endothelial nitric oxide in sphingosine-1-phosphate-induced angiogenesis.

Authors:  Yoshiyuki Rikitake; Ken-ichi Hirata; Seinosuke Kawashima; Masanori Ozaki; Tomosaburo Takahashi; Wataru Ogawa; Nobutaka Inoue; Mitsuhiro Yokoyama
Journal:  Arterioscler Thromb Vasc Biol       Date:  2002-01       Impact factor: 8.311

Review 5.  Defensins and cathelicidins: neutrophil peptides with roles in inflammation, hyperlipidemia and atherosclerosis.

Authors:  Panagiotis Kougias; Hong Chai; Peter H Lin; Qizhi Yao; Alan B Lumsden; Changyi Chen
Journal:  J Cell Mol Med       Date:  2005 Jan-Mar       Impact factor: 5.310

6.  Lysophosphatidylcholine inhibits endothelial cell migration and proliferation via inhibition of the extracellular signal-regulated kinase pathway.

Authors:  Y Rikitake; S Kawashima; T Yamashita; T Ueyama; S Ishido; H Hotta; K i Hirata; M Yokoyama
Journal:  Arterioscler Thromb Vasc Biol       Date:  2000-04       Impact factor: 8.311

7.  Suppression of tumor metastasis by NK4 plasmid DNA released from cationized gelatin.

Authors:  T Kushibiki; K Matsumoto; T Nakamura; Y Tabata
Journal:  Gene Ther       Date:  2004-08       Impact factor: 5.250

8.  Method of reliable determination of minimal lethal antibiotic concentrations.

Authors:  R D Pearson; R T Steigbigel; H T Davis; S W Chapman
Journal:  Antimicrob Agents Chemother       Date:  1980-11       Impact factor: 5.191

9.  An angiogenic role for the human peptide antibiotic LL-37/hCAP-18.

Authors:  Rembert Koczulla; Georges von Degenfeld; Christian Kupatt; Florian Krötz; Stefan Zahler; Torsten Gloe; Katja Issbrücker; Pia Unterberger; Mohamed Zaiou; Corinna Lebherz; Alexander Karl; Philip Raake; Achim Pfosser; Peter Boekstegers; Ulrich Welsch; Pieter S Hiemstra; Claus Vogelmeier; Richard L Gallo; Matthias Clauss; Robert Bals
Journal:  J Clin Invest       Date:  2003-06       Impact factor: 14.808

10.  Interleukin-8 as a macrophage-derived mediator of angiogenesis.

Authors:  A E Koch; P J Polverini; S L Kunkel; L A Harlow; L A DiPietro; V M Elner; S G Elner; R M Strieter
Journal:  Science       Date:  1992-12-11       Impact factor: 47.728

View more
  10 in total

1.  An antimicrobial peptide with angiogenic properties, AG-30/5C, activates human mast cells through the MAPK and NF-κB pathways.

Authors:  Kazo Kanazawa; Ko Okumura; Hideoki Ogawa; François Niyonsaba
Journal:  Immunol Res       Date:  2016-04       Impact factor: 2.829

2.  Cinnamtannin B-1 Promotes Migration of Mesenchymal Stem Cells and Accelerates Wound Healing in Mice.

Authors:  Kosuke Fujita; Katsunori Kuge; Noriyasu Ozawa; Shunya Sahara; Kaori Zaiki; Koichi Nakaoji; Kazuhiko Hamada; Yukiko Takenaka; Takao Tanahashi; Katsuto Tamai; Yasufumi Kaneda; Akito Maeda
Journal:  PLoS One       Date:  2015-12-11       Impact factor: 3.240

3.  Modification of a novel angiogenic peptide, AG30, for the development of novel therapeutic agents.

Authors:  Hironori Nakagami; Tomoyuki Nishikawa; Nao Tamura; Akito Maeda; Hajime Hibino; Masayoshi Mochizuki; Takashi Shimosato; Toshinori Moriya; Ryuichi Morishita; Katsuto Tamai; Kazunori Tomono; Yasufumi Kaneda
Journal:  J Cell Mol Med       Date:  2012-07       Impact factor: 5.310

4.  Novel anti-microbial peptide SR-0379 accelerates wound healing via the PI3 kinase/Akt/mTOR pathway.

Authors:  Hideki Tomioka; Hironori Nakagami; Akiko Tenma; Yoshimi Saito; Toshihiro Kaga; Toshihide Kanamori; Nao Tamura; Kazunori Tomono; Yasufumi Kaneda; Ryuichi Morishita
Journal:  PLoS One       Date:  2014-03-27       Impact factor: 3.240

5.  Anti-Microbial Dendrimers against Multidrug-Resistant P. aeruginosa Enhance the Angiogenic Effect of Biological Burn-wound Bandages.

Authors:  Philippe Abdel-Sayed; Ariane Kaeppeli; Ariane Kaeppli; Thissa Siriwardena; Tamis Darbre; Karl Perron; Paris Jafari; Jean-Louis Reymond; Dominique P Pioletti; Lee Ann Applegate
Journal:  Sci Rep       Date:  2016-02-25       Impact factor: 4.379

6.  Physician-initiated clinical study of limb ulcers treated with a functional peptide, SR-0379: from discovery to a randomized, double-blind, placebo-controlled trial.

Authors:  Hironori Nakagami; Ken Sugimoto; Takahiro Ishikawa; Taku Fujimoto; Toshifumi Yamaoka; Misa Hayashi; Eiji Kiyohara; Hiroshi Ando; Yuta Terabe; Yoichi Takami; Koichi Yamamoto; Yasushi Takeya; Minoru Takemoto; Masaya Koshizaka; Tamotsu Ebihara; Ayumi Nakamura; Mitsunori Nishikawa; Xiang Jing Yao; Hideki Hanaoka; Ichiro Katayama; Koutaro Yokote; Hiromi Rakugi
Journal:  NPJ Aging Mech Dis       Date:  2018-02-13

7.  The anti-microbial peptide SR-0379 stimulates human endothelial progenitor cell-mediated repair of peripheral artery diseases.

Authors:  Tae Wook Lee; Soon Chul Heo; Yang Woo Kwon; Gyu Tae Park; Jung Won Yoon; Seung-Chul Kim; Il Ho Jang; Jae Ho Kim
Journal:  BMB Rep       Date:  2017-10       Impact factor: 4.778

Review 8.  Novel formulations for antimicrobial peptides.

Authors:  Ana Maria Carmona-Ribeiro; Letícia Dias de Melo Carrasco
Journal:  Int J Mol Sci       Date:  2014-10-09       Impact factor: 5.923

Review 9.  Antimicrobial Peptides and Nanotechnology, Recent Advances and Challenges.

Authors:  Lubhandwa S Biswaro; Mauricio G da Costa Sousa; Taia M B Rezende; Simoni C Dias; Octavio L Franco
Journal:  Front Microbiol       Date:  2018-05-08       Impact factor: 5.640

Review 10.  Wound-Healing Peptides for Treatment of Chronic Diabetic Foot Ulcers and Other Infected Skin Injuries.

Authors:  Ana Gomes; Cátia Teixeira; Ricardo Ferraz; Cristina Prudêncio; Paula Gomes
Journal:  Molecules       Date:  2017-10-18       Impact factor: 4.411

  10 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.