Literature DB >> 18230162

Identification of protein secretion systems and novel secreted proteins in Rhizobium leguminosarum bv. viciae.

Martin Krehenbrink1, J Allan Downie.   

Abstract

BACKGROUND: Proteins secreted by bacteria play an important role in infection of eukaryotic hosts. Rhizobia infect the roots of leguminous plants and establish a mutually beneficial symbiosis. Proteins secreted during the infection process by some rhizobial strains can influence infection and modify the plant defence signalling pathways. The aim of this study was to systematically analyse protein secretion in the recently sequenced strain Rhizobium leguminosarum bv. viciae 3841.
RESULTS: Similarity searches using defined protein secretion systems from other Gram-negative bacteria as query sequences revealed that R. l. bv. viciae 3841 has ten putative protein secretion systems. These are the general export pathway (GEP), a twin-arginine translocase (TAT) secretion system, four separate Type I systems, one putative Type IV system and three Type V autotransporters. Mutations in genes encoding each of these (except the GEP) were generated, but only mutations affecting the PrsDE (Type I) and TAT systems were observed to affect the growth phenotype and the profile of proteins in the culture supernatant. Bioinformatic analysis and mass fingerprinting of tryptic fragments of culture supernatant proteins identified 14 putative Type I substrates, 12 of which are secreted via the PrsDE, secretion system. The TAT mutant was defective for the symbiosis, forming nodules incapable of nitrogen fixation.
CONCLUSION: None of the R. l. bv. viciae 3841 protein secretion systems putatively involved in the secretion of proteins to the extracellular space (Type I, Type IV, Type V) is required for establishing the symbiosis with legumes. The PrsDE (Type I) system was shown to be the major route of protein secretion in non-symbiotic cells and to secrete proteins of widely varied size and predicted function. This is in contrast to many Type I systems from other bacteria, which typically secrete specific substrates encoded by genes often localised in close proximity to the genes encoding the secretion system itself.

Entities:  

Mesh:

Substances:

Year:  2008        PMID: 18230162      PMCID: PMC2275737          DOI: 10.1186/1471-2164-9-55

Source DB:  PubMed          Journal:  BMC Genomics        ISSN: 1471-2164            Impact factor:   3.969


Background

Rhizobium leguminosarum bv. viciae is a Gram-negative soil bacterium which forms a mutualistic symbiosis with legumes, resulting in nitrogen-fixing root nodules. This symbiotic relationship is initiated by an exchange of signals between the two partners. While the general features of this signal exchange are common to all rhizobia-plant symbioses, differences in the signalling molecules allow only certain bacterium-plant combinations to lead to a successful symbiosis. Plant-made flavonoids released into the rhizosphere [1,2] induce rhizobia to make specific signalling molecules known as Nod factors, which are four or five β-1,4 linked N-acetyl-glucosamine residues with a fatty acid residue replacing the N-acetyl group at the non-reducing end. This basic structure can carry various substituents (such as acetyl, methyl, carbamoyl, sulfuryl and various glycosyl groups) depending on the rhizobial strain, and many strains synthesise a limited variety of Nod factors [3,4]. In addition to Nod factors, secreted proteins can contribute to nodulation ability. NodO is a protein secreted via a Type I secretion system (PrsDE) by some rhizobia and heterologous expression of nodO could extend the host range of some rhizobial strains [5,6]. Type I secretion systems transport proteins from the cytoplasm across both membranes to the extracellular space and are usually composed of three gene products: an ATPase of the ATP-binding cassette (ABC) protein family; a membrane fusion protein which spans the periplasm and links the inner and outer membranes [7]; and an outer membrane protein [8]. Their substrate proteins usually carry tandem nonapeptide glycine-rich repeats known as RTX (repeat in toxin) motifs which form a β-roll structure stabilised by coordinated Ca2+ ions [9,10]. In R. leguminosarum and some other rhizobia, both glycanases involved in bacterial exopolysaccharide (EPS) processing and rhizobial adhesion proteins are secreted via a Type I secretion system (PrsDE) in addition to NodO [6,11-16]. Secreted cell-wall degrading enzymes may help to erode plant cell walls enhancing infection and in Rhizobium leguminosarum biovars trifolii and viciae, cell-associated pectinolytic and cellulolytic enzymes have been found [12,13,17]. Sinorhizobium meliloti has been reported to induce the production of polygalacturonase in alfalfa roots [18]. Other rhizobia make use of Type III and Type IV protein secretion systems to inject effector proteins directly into the host plant cells where they modify plant signalling pathways [19-22]. Type III secretion systems translocate proteins across both membranes using ATP. They are assembled from over 20 proteins, many of which closely resemble proteins involved in flagellar biogenesis [23,24]. In some cases, the flagellar apparatus has been shown to export proteins not related to the flagellum [25]. The proteins are normally delivered into the eukaryotic cytoplasm, where they then alter the host metabolism to suit the bacterial needs [26]. In Rhizobium sp. NGR234 several proteins including NopX, NopA, NopB, NopP and NopL, were shown to be secreted via a Type III system upon flavonoid induction [21,27-29]. The Vir system of Agrobacterium tumefaciens is a well-known Type IV secretion system involved in the transfer of DNA and protein to the plant cell. The Type IV secretory machinery is encoded by the virB1–11 genes [30]. A related system in Mesorhizobium loti delivers effector proteins into plants during nodule initiation [20]. The twin arginine translocase pathway (TAT) pathway exports folded proteins [31,32] often with posttranslational modifications [31,33-35] and does not recognise unfolded proteins [36]. TAT substrates carry an N-terminal tripartite signal sequence similar to that of GEP substrates, except that the signal peptide is usually longer and carries two consecutive arginine residues near the N-terminus [33,37]. Inactivation of this protein secretion system in R. l. bv viciae UPM791 led to the inability of the rhizobia to progress beyond the infection zone and the formation of nodules that were unable to fix nitrogen [38]. Several types of protein secretion system function in Gram-negative bacteria, but have not been studied in rhizobia with regard to nodulation. The general export pathway (GEP) is the main pathway for the secretion of proteins to the periplasm in most bacteria. An N-terminal signal peptide which is cleaved from the exported protein by a specific signal peptidase [39]. In E. coli, the GEP is composed of a complex of SecD, SecE, SecF, SecG and SecY in the cytoplasmic membrane. In the cytoplasm SecB keeps proteins destined for secretion in an unfolded state [40] and SecA binds to the signal peptide and uses ATP to drive protein export through the SecYEG channel [41-43]. Type II secretion systems translocate proteins from the periplasm and are thus dependent on the GEP or TAT pathways [44,45]. Their substrates consist of folded proteins, and between 12 and 15 different proteins are involved in Type II secretion, many of them sharing features with the Type IV pilus biogenesis system [46]. In Type V secretion systems (also termed autotransporters), the secreted protein transports itself across the outer membrane after being transported to the periplasm by the GEP. Autotransporters have a GEP signal peptide, a variable passenger domain and a C-terminal β-domain, which forms a pore in the outer membrane through which the passenger domain passes. The passenger domain is then released by a peptolytic activity or remains covalently bound to the β-domain [47]. Many autotransporter proteins have an unusually long N-terminal signal peptide of more than 42 amino acid residues [47,48]. The so-called unlinked autotransporters or two-partner secretion (TPS) systems [49,50] have separate passenger and β-domain proteins, each carrying a GEP signal peptide. Export of the passenger domain from the periplasm proceeds via an outer membrane pore formed by the β-domain. Fimbriae and Pili are not commonly regarded as protein secretion systems, but do transport the pilus or fimbrial subunit proteins across the outer membrane. The subunit proteins are usually exported to the periplasm by the GEP, and some proteins involved in pilus biosynthesis display similarity to components of the Type II protein secretion machinery. In Pap fimbriae, the fimbrial usher proteins mediate the assembly of the fimbrial subunits and also form a pore through which the fimbriae pass through the outer membrane. MscL and holin both form channels within the inner membrane through which proteins can pass under certain conditions. Holins are often phage-derived and facilitate the export of autolysin proteins leading to the degradation of the cell wall and death. The pores formed by MscL only open during severe hypoosmotic shock and are though to be primarily involved in rapidly relieving excessive turgor by allowing low- to medium-molecular weight osmolytes to diffuse out of the cell. The channels do however also open wide enough to allow the escape of small proteins such as thioredoxin into the periplasm [51,52]. In this study, the genome of R. l. bv. viciae 3841 was analysed for the presence of known protein secretion systems to assess their role in the nodulation process.

Results

Identification of genes encoding different protein transport systems

a) Identification of general export pathway (GEP) genes

The components of the GEP from Escherichia coli were used as query sequences to search the R. l. bv. viciae 3841 genome database using the BLASTP algorithm [53]. R. l. bv. viciae 3841 was found to carry single genes coding for SecA (RL4298), SecB (RL0006), SecD (RL0680), SecE (RL1759), SecF (RL2055), SecG (RL2512) and SecY (RL1794), which suffice to constitute a functioning GEP machinery (Table 1). These chromosomal genes were not located in operons or even close to one another. Only one copy of each of the genes encoding type I (RL1510) and type II (RL0410) signal peptidases were found in the R. l. bv. viciae 3841 genome.
Table 1

Homologs of known protein secretion systems identified in the genome of R. l. bv. viciae 3841.

SystemHomolog IHomolog IIHomolog IIIHomolog IV
a) General export pathway
SecBRL0006
SPase IIRL0410
YidCRL0453
SecDRL0680
SPase IRL1510
SecERL1759
SecYRL1794
SecFRL2055
SecGRL2512
SecARL4298
FtsYRL4543
FfhRL4547
b) Twin arginine pathway
TatARL2046
TatBRL2047
TatCRL2048
c) Type I pathway
AprERL3657RL0071RL0622pRL90165
AprDRL3658RL0072RL0623pRL90164
TolCnone
d) Type II pathway
Any componentnone
e) Type III/flagellar pathway
FliFRL0695
FlhBRL0699
FliGRL0700
FliNRL0701
FliMRL0702
FliIRL0705
FlgIRL0712
FlgHRL0714
FliLRL0715
FliPRL0716
FliQRL0734
FlhARL0735
FliRRL0736
f) Type IV pathway
VirB1pRL70149
VirB2pRL70150
VirB3pRL70151
VirB4pRL70152
VirB5pRL70153
VirB6pRL70154
VirB8pRL70155
VirB9pRL70156
VirB10pRL70157
VirB11pRL70158
g) Type V pathway
ATRL1927RL1196RL1069
TPSNone
h) Holins
HolinNone
i) Large conductance mechanosensitive channel
MscLRL0602
j) Pilus
PilQRL0210
PilARL0211
CpaARL0212
CpaBRL0213
CpaCRL0214
CpaDRL0215
CpaERL0216
CpaFRL0217
TadBRL0218
TadCRL0219
k) Fimbrial usher protein
PapCnone
Homologs of known protein secretion systems identified in the genome of R. l. bv. viciae 3841.

b) The tatABC genes of the twin-arginine translocation pathway (TAT)

To search for components of the TAT machinery, the sequences of TatA, TatB, TatC and TatE from E. coli were used as queries. No copy of tatE was found, but tatA (RL2046), tatB (RL2047) and tatC (RL2048) appeared to be located within one operon. The same organisation is found A. tumefaciens [54] and R. l. bv. viciae UPM 791 [38] and in the published genome sequences of other rhizobia such as R. etli CFN 42 [55] and S. meliloti 1021 [56].

c) Identification of genes encoding four predicted Type I protein secretion systems

The prsDE genes encode a typical Type I secretion system in rhizobia [12]. Using PrsD and PrsE as queries, three novel putative Type I systems were identified in addition to PrsDE. As the search was expected to return many putative ABC transporters not related to protein secretion [57], the 11 closest hits to the PrsD sequence were queried against the R. l. bv. viciae 3841 genome and pooled with the 11 closest hits for each query to give a subset of 16 unique putative protein sequences (most of the 11 × 11 = 121 sequences were repeat hits within the sets of 11). These 16 sequences were then queried against the NCBI database using BLASTP [53]. This revealed that (a) three sequences (including PrsD) were most similar to protein transporters of the AprD-type (alkaline protease) from Pseudomonas sp., (b) one was most similar to bacteriocin/lantibiotic transporters (SunT-type), and (c) the rest were most similar to ABC drug/metabolite transporters and polysaccharide exporters. A radial tree (Fig. 1) shows the relationships of the 16 identified ABC proteins. The four ABC proteins predicted to be involved in protein secretion all contained a conserved ATP-binding Walker A region (GXXGXGKT/S) [58] and are the PrsDE system, two predicted PrsDE-like systems encoded by genes we have named the toaDE (RL0072 and RL0071) and tobDE (RL0623 and RL0622) genes and the bltDE genes (pRL90164 and pRL90165) encoding putative proteins with similarity to bacteriocin/lantibiotic exporters. The other proteins with the highest similarity to ABC drug/metabolite transporters and polysaccharide exporters are thought to be involved in the transport of small molecules or polysaccharides rather than proteins.
Figure 1

Unrooted dendrogram of . The bar represents 0.1 amino acid changes; predicted functions for proteins are given.

Unrooted dendrogram of . The bar represents 0.1 amino acid changes; predicted functions for proteins are given.

d) Identification of predicted Type I substrates

Genes encoding Type I substrates are often close to the genes encoding Type I secretion systems. The prsDE genes are preceded by plyA encoding the cell-bound glycanase PlyA, a known substrate of the PrsDE system [13,59]. None of the genes within 10 kb of the toaDE (RL0072/RL0071) or tobDE (RL0623/RL0624) encodes proteins which are known Type I substrates. Proteins secreted by Type I secretion systems often contain repeated acidic RTX (repeat in toxin) motifs probably involved in protein folding in the extracellular space [10,60]. The known Type I proteins with RTX domains, NodO from R. l. bv. viciae 8401/pRL1 [GenPept:P15728], HlyA from E. coli O157:H7 [GenPept:AAA20544], and LipA from Serratia marcescens [GenPept: BAA02519], were used as to search the R. l. bv. viciae 3841 database using BLASTP. The resulting 15 highest-scoring proteins were each used to search the non-redundant NCBI database for similar proteins (the 15 highest-scoring proteins were chosen as a cut-off instead of a defined expect-value to accommodate for proteins of varying lengths). If the highest similarity was to a known non-substrate, the protein was added to a list of false positives. Proteins with high similarity to known secreted proteins were listed as possible true positives. Any new proteins from R l. bv. viciae 3841 identified as possible Type I substrates were re-tested as query sequences for the R l. bv. viciae 3841 genome and the whole process reiterated until it converged on a defined set of sequences. Every protein sequence within the set could be used as an initial query to return all members of the set. These sequences were additionally analysed for the presence of repeat sequences using the DOTTER software [61]. Using this approach, 14 different proteins predicted to be secreted by a Type I secretion system were identified. Seven were already known to be secreted via the PrsDE system in R. leguminosarum or were very similar to known substrates [12,13,62]. Of these seven, three were rhizobial adhering proteins (RapA2, RapB and RapC), two were predicted glycanases (PlyA and PlyB), one was the nodulation protein NodO, and one (RL3023) was 63% identical to PlyB and so was named PlyC. The sequence motif structures of the other seven predicted Type I secretion substrates are summarised in Fig. 2, including NodO for comparison. Of these RL0790 was by far the most strongly predicted new Type I substrate. While the N-terminal 250 amino acid residues had similarity (32% identity) to the Zn-dependent metalloprotease PrtA from Pseudomonas fluorescens SIK W1 [GenPept:AAD09851], most of the protein was made up of an extensive RTX motif region carrying a total of 80 nonapeptide motifs occuring in 14 clusters of 2–5 units repeated roughly every 40 amino acids (Fig. 2A). These 40 amino acids constitute a repeated domain that occurs 13 times. The ~50 C-terminal residues are not part of a repeat.
Figure 2

Domains found in proteins prediced to be secreted via a Type I system. Coloured elements represent repeated sequences. Red denotes clusters of repeated RTX nonapeptides; the numbers of repeats are indicated. A: Zn, Zn-metalloprotease domain. B: Blue boxes represent single repeated domains; gly, glycosyl hydrolase domain; dark grey, TPT repeat; hatched area marks sequence similarity. C: Blue boxes represent single cadherin domains. D:. Blue, repeated sequence 1; magenta, repeated sequence 2. E: NodO protein shown for comparison. Bar represents 100 amino acid residues.

Domains found in proteins prediced to be secreted via a Type I system. Coloured elements represent repeated sequences. Red denotes clusters of repeated RTX nonapeptides; the numbers of repeats are indicated. A: Zn, Zn-metalloprotease domain. B: Blue boxes represent single repeated domains; gly, glycosyl hydrolase domain; dark grey, TPT repeat; hatched area marks sequence similarity. C: Blue boxes represent single cadherin domains. D:. Blue, repeated sequence 1; magenta, repeated sequence 2. E: NodO protein shown for comparison. Bar represents 100 amino acid residues. RL2412 and pRL90140 were very similar (76% identity) in their last 150 amino acid residues, but completely different in the rest of their sequences (Fig. 2B). RL2412 carries one region of four consecutive RTX motifs towards the C-terminus and has limited similarity to glycosyl hydrolases in the N-terminal region (CD-score 31 bits (70) in conserved domain database RPSBLAST search). In pRL90140, there are three RTX motif regions containing 2, 4 and 4 RTX motifs respectively. It contains the sequence Thr-Pro-Thr repeated in tandem six times (TPT TPT TPT TPT TPT TPT) just in front of the first RTX region. The N-terminus contains two copies of a 32 amino acid sequence (41% identity to each other) that resembles repeats in cyanobacterial parallel beta-helix repeat proteins of unknown function (56% and 53% identity to a protein from Anabaena variabilis ATCC 29413 [GenPept:YP_322399] for the first and second repeat, respectively). RL2961 and pRL100309 (Fig. 2C) are similar, but differ in the number of RTX motifs towards the N-terminus (four in RL2961, two in pRL100309). Both contain putative calmodulin-like calcium-binding motifs repeated two times towards the C-terminus. Similar motifs are found in hypothetical proteins from other bacteria (e.g. amb3275 from Magnetospirillum magneticum AMB-1 [GenPept:YP_422638] and bll3714 from Bradyrhizobium japonicum USDA 110 [GenPept:BAC48979], 39% identity in both) and also resemble cadherins, calcium-binding cell-cell adhesion proteins from animal cells (35% identity to mouse cadherin-10, [GenPept: AAH62962]). Cadherins are involved in mediating the formation of the adherens junction in animals in a calcium-dependent manner [63]. The genes encoding pRL90159 and pRL90161 are both located just upstream of the putative bacteriocin/lantibiotic transporter system bltDE. Both encode similar, very large proteins with predicted sizes of 179 kDa and 184 kDa, respectively. They lack a classical RTX domain, but do contain a repeated ~140 amino acid motif of unknown function. These motifs are repeated four times in the C-terminal half of pRL90161, two times in pRL90159 (Fig. 2D) and display 55–65% identity to four similar repeats in a hypothetical protein from Nitrobacter hamburgensis X14 [GenPept:YP_578257]. In pRL90159, the second and third repeats are replaced by two copies of a 220 amino acid sequence (96% identity to each other) of unknown function (Fig. 2E).

e) Type II and Type III protein secretion systems are absent, but a Type IV system may be present

Although Type II secretion systems are common and widespread in many Gram-negative bacteria such as Pseudomonas spp. [64], no components of this pathway were found in R. l. bv. viciae 3841 using PulC-O from Klebsiella oxytoca as query sequences. The only proteins with similarity to components of Type III secretion systems were components of the flagellar apparatus. Using the VirB1–11 proteins of A. tumefaciens as a query, two separate clusters of genes were found. The first is on the transmissible plasmid pRL8 and is very similar to other plasmid transfer systems (trb) implying that these genes are most likely to be involved in plasmid transfer, rather than protein secretion. The second cluster is on the transmissible plasmid pRL7 and contains putative virB1, virB2, virB3, virB4, virB5, virB6, virB8, virB9, virB10 and virB11 genes (pRL70149–pRL70158), thus possessing essential genes for DNA and/or protein transport via a Type IV secretion system [65]. The presence of this cluster does however not necessarily identify this cluster as a protein secretion system. As the process of type IV protein export is not yet well understood, it is not possible to tell from sequence data alone whether these components are involved in protein export or conjugal DNA transport.

f) Identification of genes encoding Type V systems

Three putative proteins with sequence similarity to the autotransporter BrkA [GenPept:AAA51646] from Bordetella pertussis were identified from the R. l. bv. viciae 3841 genome (Table 1). The amino acid sequences of all three putative autotransporters included predicted N-terminal signal peptides of 35 (AutA, RL1927), 41 (AutB, RL1196) and 29 (AutC, RL1069) amino acid residues as predicted by SignalP 3.0, Hidden Markov model [66]. While the β-domain was well conserved in all three cases, no significant similarity to any known or putative protein was found for the N-proximal passenger domain. No members of a two-partner secretion system were detected using the β-domains of BrkA and the identified putative autotransporters as query sequences. The three predicted autotransporter proteins encoded by autA, autB and autC in different regions of the chromosome are large (1290, 875 and 1204 amino acid residues, respectively). The 300–450 C-terminal amino acid residues of each could be assigned to the autotransporter β-domain by similarity to the β-domains of known autotransporters including BrkA. As the β-domain of autotransporters is well conserved across species, it was omitted from BLASTP searches to avoid skewing the results towards proteins with unrelated passenger domains. The protein most similar to the passenger domain of AutA was a predicted autotransporter [GenPept:YP_296187] from Ralstonia eutropha JMP134 (36% identity). AutB was most similar to a predicted autotransporter [GenPept:YP_673151] from Mesorhizobium sp. BNC1 (43% identity). The protein most similar to the passenger domain of AutC was a putative autotransporter [GenPept:YP_485594] from Rhodopseudomonas palustris HaA2 (33% identity). There was no significant similarity to the passenger domains of autotransporters from other rhizobia. The genetic neighbourhood of the genes also did not yield any direct indication to possible functions.

g) Identification of genes encoding fimbriae, pili, MscL channels and holins

Although no fibrial usher proteins were found, the R. l. bv. viciae 3841 genome contains a cluster of genes predicted to be involved in Cpa pilus biogenesis (Table 1). The R. l. bv. viciae 3841 genome was found to encode no holins and one putative MscL protein (RL0602).

Phenotypes of mutants affected in predicted secretion systems

To determine the functions of the identified putative protein secretion systems, we generated derivatives of strain 3841 carrying insertion mutations in prsD (A895), toaD (A913), tobD (A896), virB6 (A897), autA (A1010), autB (A1011), autC (A1012) and tatC (A1052). The mutants were tested for polygalacturonase (PGase) activity, glycanase activity, motility, biofilm formation and growth on different carbon sources (mannitol and succinate). All mutants were able to grow on TY, Y-succinate and Y-mannitol plates. None of the mutants was affected in cell-associated PGase activity, suggesting that this activity is independent of the identified secretion systems. The prsD (A898) mutant lacked extracellular glycanase activity, failed to form biofilm rings in shaking culture, and produced very mucoid colonies and viscous culture supernatants (not shown). Such phenotypes were observed previously with a prsD mutant of R. l. bv. viciae strain A34 [12,59]. No such effects were observed with any of the other mutants including A913 (toaD), or A896 (tobD). To rule out the possibility of additive phenotypes or redundancy between the different Type I systems, we constructed a toaD/tobD/prsD triple mutant (A912) and toaD/prsD (A911) and tobD/prsD (A903) double mutants, but all had the same phenotypes as A898 (prsD). Whereas the wild type (and all the other mutants tested) swarmed outward from the point of inoculation on 0.2% agar TY plates, the tatC mutant (A1052) formed a tight colony and showed no sign of swarming behaviour. Growth of the tatC mutant in liquid TY medium was slightly impaired (it had a doubling time of 4.5 h compared with 3 h for WT and the other mutants). Microscopy revealed that the tatC mutant was much more rounded in shape than the wild type.

All mutants except A1052 (tatC) are capable of effective nodulation

To examine the role of the identified secretion systems in nodulation, pea seedlings (cv. Frisson) were inoculated with wild type R. l. bv. viciae 3841, A895 (prsD), A913 (toaD), A896 (tobD), A897 (virB7), A1010 (autA), A1011 (autB), A1012 (autC) and A1052 (tatC). After three weeks growth on nitrogen-limited medium, the plants inoculated with the tatC mutant (A1052) looked nitrogen starved, and the nodules formed were unable to fix nitrogen based on measurements of acetylene reduction; staining of these nodules with SYTO 13 [67] revealed bacteria near the tip of the nodule, but they did not extend as far into the nodule as wild type bacteria (Fig. 3). All of the other mutants formed normal numbers of nitrogen-fixing nodules (data not shown). Nodulation experiments carried out with the alternative host plants broad bean (Vicia faba cv. The Sutton) and hairy vetch (Vicia hirsuta) mirrored the results obtained on pea plants.
Figure 3

The . Nodules formed on pea plant roots (cv. Frisson) three weeks after inoculation with wild type R. l. bv. viciae 3841 (A, C) and the tatC mutant A1052 (B, D). A and B are images of fresh nodules, C and D were nodules preserved in 70% ethanol before staining with SYTO 13 dye. Structures of high DNA content (bacteria and plant cell nuclei) are stained yellow. The nodule tip is at the bottom.

The . Nodules formed on pea plant roots (cv. Frisson) three weeks after inoculation with wild type R. l. bv. viciae 3841 (A, C) and the tatC mutant A1052 (B, D). A and B are images of fresh nodules, C and D were nodules preserved in 70% ethanol before staining with SYTO 13 dye. Structures of high DNA content (bacteria and plant cell nuclei) are stained yellow. The nodule tip is at the bottom.

The tatC mutant has enhanced levels of proteins in the culture supernatant but lacks flagellin

A comparison by SDS-PAGE of the proteins in the culture supernatant of the tatC mutant (A1052) and the wild type grown in Y-mannitol liquid medium showed clear differences in the protein pattern (Fig. 4). Although there were many bands in common, A1052 consistently contained more total protein in the culture supernatant as estimated by loading proteins precipitated from equal amounts of culture supernatant. The abundant proteins of around 36 kDa produced by the wild type but missing from the supernatant of A1052 (tatC) were identified by MALDI-ToF as flagellins (RL0718 and RL0720). Although the TAT pathway secretes proteins to the periplasm and not directly to the extracellular space, the absence of flagellar proteins from the culture supernatant of a tatC mutant was previously shown for A. tumefaciens [54].
Figure 4

The . R. l. bv. viciae 3841 and the tatC mutant (A1052) were grown for three days in 100 ml TY (periplasm) or for four days in 100 ml Y-mannitol medium (culture supernatant). Periplasmic proteins were prepared by cold hypo-osmotic shock, ~30 μg were loaded per lane. Culture supernatant proteins were precipitated with TCA and protein representing 20 ml of culture were loaded in each lane.

The . R. l. bv. viciae 3841 and the tatC mutant (A1052) were grown for three days in 100 ml TY (periplasm) or for four days in 100 ml Y-mannitol medium (culture supernatant). Periplasmic proteins were prepared by cold hypo-osmotic shock, ~30 μg were loaded per lane. Culture supernatant proteins were precipitated with TCA and protein representing 20 ml of culture were loaded in each lane. Periplasmic proteins from R. l. bv. viciae 3841 and A1052 (tatC) were isolated by cold hypo-osmotic shock and analysed by gel electrophoresis. The absence of cytoplasmic contamination of the periplasmic protein preparation was checked by measuring glucose-6-phosphate dehydrogenase (G6PDH) activity [68]. Specific G6PDH activity in the periplasmic preparations was less than 4% of the specific G6PDH activity in whole cell extract. Although the TAT machinery exports proteins to the periplasm, there were no major differences in the periplasmic protein profile of R. l. bv. viciae 3841 and the tatC mutant A1052 (Fig. 4.).

Identification of proteins present in the culture supernatant of mutants in predicted protein secretion systems and the wild type

Culture supernatant proteins of R. l. bv. viciae 3841and the prsD (A895), toaD (A913), tobD (A896), virB6 (A897), autA (A1010), autB (A1011) and autC (A1012) mutants grown in Y-mannitol medium were analysed by SDS-PAGE. Only the supernatant protein profile from the prsD mutant (A895) differed from that of the wild type and was missing seven protein bands (Fig. 5). The seven proteins corresponding to the indicated bands in Fig. 5 were identified by MALDI-ToF MS fingerprinting (Table 2). Six of these were either known Type I substrates (PlyB and RapA2) [62] or were predicted above (RL2961, pRL100309, pRL90140 and RL2412) to be secreted using bioinformatic analyses.
Figure 5

Culture supernatant proteins from extracellular protein secretion system mutants. Cells were grown in Y-mannitol medium for 4 days. Proteins were precipitated with trichloroacetic acid. A, R. l. bv. viciae 3841 wild type; B, toaD mutant; C, tobD mutant; D, prsD mutant; E, virB6 mutant; F, autA mutant; G, autB mutant; H, autC mutant. Protein bands missing in the lane representing the prsD mutant are marked (*).

Table 2

Culture supernatant proteins from R. l. bv. viciae 3841 were identified by MALDI-ToF MS.

BandApparent weight [kDa]Top MOWSE scoreNumber of matched fragmentsPredicted proteinTheoretical weight [kDa]Predicted function
*189.120518RL296195.0.cadherin-like protein
*259.216515pRL9014079.0.parallel beta-helix repeat protein
*357.711315pRL10030960.7cadherin-like protein
*452.2788RL241264.6glycosyl hydrolase
550.224320RL465163.7dipeptide-binding protein
6a46.5557RL077858.8dipeptide-binding protein
*6b46.519516RL302451.6PlyB
741.510110RL072844.4flagellar hook
838.517414RL421847.6sorbitol-binding protein
937.5768RL332943.4membrane bound lytic tranglycosylase
1035.6777RL374538.9Leu/Ile/Val-binding protein (BraC)
11a34.1606RL072033.6flagellin
11b34.1969RL237538.9basic membrane lipoprotein
*12a29.8585pRL10045124.9RapA2
12b29.8606RL019635.0.basic membrane lipoprotein
12c29.844 (53)5RL048935.4sugar-binding protein
12d29.836 (51)4RL071831.0.flagellin
1327.712910RL051839.4ribose-binding protein
1425.0.1139RL275327.9arginine/ornithine-binding protein
1520.4575RL136924.5pentapeptide repeat protein
1617.1856RL240420.5peptidyl prolyl cis-trans isomerase
*1716.3836RL158015.3nucleoside diphosphate kinase
1816.0705RL269719.5COG3184

The protein bands labelled in Fig. 6. were cut out from the gel and digested with trypsin. The masses of the tryptic digest were identified by MALDI-ToF MS and searched against a R. l. bv. viciae 3841 genome database. Band #, protein band as labelled in Fig. 6., Band from which more than one protein was identified are indicated (e.g. 6a, 6b). Apparent weight, molecular weight of the proteins in the given band as estimated from the electrophoretic mobility. Top MOWSE score, statistical score calculated by the MASCOT program for the R. l. bv. viciae 3841 indicated in column 'predicted protein', scores above 50 indicate >95% confidence. Number of matched fragments, number of fragment masses which could be assigned to the predicted protein. Predicted protein, proteins scoring more than 50 as MOWSE score. Theoretical weight, calculated molecular weight of the indicated proteins. Scores obtained after refining search parameters are shown in brackets. An asterisk indicates PrsDE-dependence.

Culture supernatant proteins from extracellular protein secretion system mutants. Cells were grown in Y-mannitol medium for 4 days. Proteins were precipitated with trichloroacetic acid. A, R. l. bv. viciae 3841 wild type; B, toaD mutant; C, tobD mutant; D, prsD mutant; E, virB6 mutant; F, autA mutant; G, autB mutant; H, autC mutant. Protein bands missing in the lane representing the prsD mutant are marked (*). Culture supernatant proteins from R. l. bv. viciae 3841 were identified by MALDI-ToF MS. The protein bands labelled in Fig. 6. were cut out from the gel and digested with trypsin. The masses of the tryptic digest were identified by MALDI-ToF MS and searched against a R. l. bv. viciae 3841 genome database. Band #, protein band as labelled in Fig. 6., Band from which more than one protein was identified are indicated (e.g. 6a, 6b). Apparent weight, molecular weight of the proteins in the given band as estimated from the electrophoretic mobility. Top MOWSE score, statistical score calculated by the MASCOT program for the R. l. bv. viciae 3841 indicated in column 'predicted protein', scores above 50 indicate >95% confidence. Number of matched fragments, number of fragment masses which could be assigned to the predicted protein. Predicted protein, proteins scoring more than 50 as MOWSE score. Theoretical weight, calculated molecular weight of the indicated proteins. Scores obtained after refining search parameters are shown in brackets. An asterisk indicates PrsDE-dependence. One of the proteins missing from the culture supernatant of the prsD mutant (A895) was a predicted nucleoside diphosphate kinase (NDK, RL1580). NDK is generally a cytoplasmic enzyme involved in nucleotide metabolism [69] and catalyses the general reaction NxTP + NyDP ↔ NxDP + NyTP, where Nx or y can be any base. Therefore, its presence in the supernatant of the wild type was unusual, although NDK has been shown to be secreted via a Type I system in P. aeruginosa [70]. The absence of NDK from the culture supernatant of A898 (prsD) indicates specific export by the PrsDE Type I system. To rule out cytoplasmic contamination of the culture supernatant, the small (~22 kDa) and highly expressed cytoplasmic protein RhiA was used as a marker. RhiA is a protein of unknown function [71,72], and its high abundance and the availability of a specific antiserum [73] made it a good choice as a marker protein, because cell lysis would release large amounts of RhiA into the culture medium. RhiA could not be detected in the culture supernatant of bacteria grown for 4 days to mid-stationary phase (data not shown). Double and triple mutants in toaD, tobD and prsD were made but no effects on supernatant proteins were seen unless the strain also carried a mutation in prsD, in which cased the same changes as in a prsD single mutant were observed. A mutation in bltD similarly had no observed effect on the profile of proteins isolated from the culture supernatant (data not shown). Although the prsD mutant differed from the wild type in culture supernatant protein profile (Fig. 5), this only accounted for seven of the many culture supernatant protein bands observed by SDS-PAGE. Most of these bands were also observed in periplasmic fractions of wild type R. l. bv. viciae 3841, and many were indeed very abundant in this fraction, suggesting that these proteins might have reached the culture supernatant through unspecific leakage. Nevertheless, three protein bands remained which were exclusive to the culture supernatant. To identify these other proteins, bands 7, 11 and 12 were excised from the gel for MALDI-ToF MS analysis. Select bands present in both the culture supernatant and the periplasmic fraction were also excised from the gel to confirm their periplasmic origin. Table 2 and Figure 6 list 23 different proteins (including all seven bands missing from the supernatant of the prsD mutant) that were identified from the culture supernatant. Of these, proteins RL0718, RL0720 and RL0728 (Table 2) are predicted to be extracellular components of the flagellum and expected to be present in the culture supernatant [74-76]. Out of the 23 identified supernatant proteins (Table 2), 13 were predicted to be periplasmic by the SignalP 3.0 software [66] (Table 3). The distinction between signal peptide proteins and leaderless proteins is very clear, with proteins either having a signal peptide probability of 0.999 or better or less than 0.033. The signal peptides are predicted to be between 20 and 32 amino acid residues in length with probabilities between 0.803 and 1.000. One of the predicted signal peptide proteins (RL0518) is also predicted to be a TAT substrate by the TATP 1.0 [77], but not by the TATFIND [78] algorithm. The predicted signal peptide of RL0518 carries a twin-arginine motif, and the surrounding residues also suggest a TAT leader peptide. The absence of this protein could not be confirmed in the culture supernatant of the tatC mutant A1052 (Fig. 4) this could either be due to the abundance of other proteins in the culture supernatant masking its absence or the possibility that it is not a TAT substrate. Five of the supernatant proteins were predicted to be periplasmic substrate-binding components of ABC uptake transporters, two each were basic membrane proteins or conserved proteins of unknown function and one was predicted to be peptidyl-prolyl cis-trans isomerase. None had similarity to any known extracellular proteins from other bacteria. Table 3 lists all proteins identified in the culture supernatant and gives their predicted function and likely secretion system.
Figure 6

Protein bands submitted to MALDI-ToF MS analysis. Supernatant proteins were separated by SDS-PAGE and stained with colloidal Coomassie G. The indicated protein bands present in the wild type were excised and analysed by MALDI-ToF MS fingerprinting. Protein band missing in the culture supernatant of the prsD mutant (A898) are indicated by red arrows.

Table 3

Prediction of signal peptides of proteins identified in the culture supernatant

ProteinSignal peptide probabilityMaximum cleavage site probabilityPredicted signal length (aa)Predicted signal peptidePredicted secretion systemPredicted function
RL01961.0000.99920MKKSLLTLFAVAAMSTTALAGEPbasic membrane lipoprotein
RL04891.0001.00023MKKSVLAFGALALGVTFSAPVMAGEPsugar-binding protein
RL05181.0001.00032MSIVKSLLSRRAFTALAGAAVIATAMPAPSFATATribose-binding protein
RL07781.0000.95623MKKISVLLAATALISVMATSAWSGEPdipeptide-binding protein
RL13690.9990.80325MAMHGSSLGLLALVLLAFPPVAARAGEPpentapeptide repeat protein
RL23751.0000.94424MKKLALALAATAALVLSIGSAAEAGEPbasic membrane lipoprotein
RL24041.0000.98323MKLFYLAFAGVLYLASFAGDAFAGEPpeptidyl prolyl cis-trans isomerase
RL26970.9990.93328MMNIAGLGRLAAATVVLSGLAFGSAVKAGEPCOG3184
RL27531.0001.00025MLNSTRIFAAASIAAMSLFAGSAMAGEParginine/ornithine-binding protein
RL33291.0000.97525MHRSLASCSALALLFALALAGGAAAGEPmembrane bound lytic tranglycosylase
RL37451.0000.99923MKKSLLSAVALTAMVAFSGNAWAGEPLeu/Ile/Val-binding protein (BraC)
RL42181.0000.99822MTLRTFLLGACSALAFAGMASAGEPsorbitol-binding protein
RL46511.0001.00029MTKLNRNFRMLSAGAALSLLMMAAPSAFAGEPdipeptide-binding protein

pRL901400.0000.000--PrsDEparallel beta-helix repeat protein
pRL1003090.0000.000--PrsDEcadherin-like protein
pRL1004510.0000.000--PrsDERapA2
RL15800.0000.000--PrsDEnucleoside diphosphate kinase
RL24120.0000.000--PrsDEglycosyl hydrolase
RL29610.0000.000--PrsDEcadherin-like protein
RL30240.0000.000--PrsDEPlyB

RL07180.0020.001--Flagellumflagellin
RL07200.0120.005--Flagellumflagellin
RL07280.0320.029--Flagellumflagellar hook

Signal peptide prediction was done using the hidden Markov model of the SignalP 3.0 software [66]. Probabilities for the presence of a signal peptide and for the correct identification of the cleavage site are given. The TAT signal prediction software TATP 1.0 predicts the same signal peptide length for the predicted TAT substrate RL0518. The twin-arginine motif of the RL0518 protein is in bold. The prediction of the secretion system involved in the export of the identified proteins was based on signal peptide prediction (GEP and TAT), observed absence from the culture supernatant of the prsD mutant (PrsDE) and similarity to known proteins (Flagellum).

Protein bands submitted to MALDI-ToF MS analysis. Supernatant proteins were separated by SDS-PAGE and stained with colloidal Coomassie G. The indicated protein bands present in the wild type were excised and analysed by MALDI-ToF MS fingerprinting. Protein band missing in the culture supernatant of the prsD mutant (A898) are indicated by red arrows. Prediction of signal peptides of proteins identified in the culture supernatant Signal peptide prediction was done using the hidden Markov model of the SignalP 3.0 software [66]. Probabilities for the presence of a signal peptide and for the correct identification of the cleavage site are given. The TAT signal prediction software TATP 1.0 predicts the same signal peptide length for the predicted TAT substrate RL0518. The twin-arginine motif of the RL0518 protein is in bold. The prediction of the secretion system involved in the export of the identified proteins was based on signal peptide prediction (GEP and TAT), observed absence from the culture supernatant of the prsD mutant (PrsDE) and similarity to known proteins (Flagellum).

Discussion

Type I protein secretion in R.l. bv. viciae 3841

The only Type I secretion systems studied in rhizobia so far have been the PrsDE system [12,13,62]and systems dedicated to the export of bacteriocin [79,80]. This study reports the presence of a total of four predicted Type I secretion systems in R.l. bv. viciae 3841, encoded by the prsDE, toaDE, tobDE and bltDE genes. Of these, the prsDE-encoded system has been characterised previously [12,13,62] and is conserved in S. meliloti [15], R.l. bv. trifolii [81], R. etli and A. tumefaciens. Of the fourteen predicted Type I substrates identified in R.l. bv. viciae 3841, seven (NodO, PlyA, PlyB, PlyC, RapA2, RapB and RapC) were already known or predicted to be secreted by the PrsDE system based on previous work [12,13,62,82]. The other seven predicted Type I substrates were previously unknown; we demonstrated that four of these (RL2412, RL2961, pRL90140 and pRL100307) were secreted in a prsD-dependent manner, while another (RL0790) was subsequently shown to be secreted in complex (TY) growth medium in a prsD-dependent manner (A. Edwards and J. A Downie unpublished data). In addition to these predicted Type I substrates, we found that the presence of RL1580 (a predicted nucleoside diphosphate kinase) in the growth medium requires prsD. This suggests that the PrsDE system secretes at least thirteen proteins encoded by genes in diverse regions of the genome. This is a much broader specificity than typically observed with Type I secretion systems in other bacteria, where the secretion system is usually limited to the secretion of only one or a narrow range of closely-related substrates [83,84]. A role for Type I secretion in the symbiosis has been shown previously, since the nodulation signalling protein NodO is secreted via the PrsDE system, [11,12]. In addition, prsD mutants of R.l. bv viciae strain A34 and R.l. bv. trifolii strain TA1 form nodules that are infected but do not fix nitrogen [12,81]. This is not the case with R.l. bv viciae strain 3841 and the reason for the difference is not known, although a prsD mutant of S. meliloti also forms nitrogen-fixing nodules [15]. Although the PrsDE secretion system in R.l. bv. viciae 3841 is not essential for nodulation, the proteins secreted by this system could nevertheless have an auxiliary function in nodulation as has already been demonstrated for NodO [5,6]. Several of the proteins whose secretion is prsD-dependent are predicted to be involved in surface attachment. This includes the adhering proteins RapA2, RapB and RapC identified previously [82], and RL2961 and pRL100309, which show similarity to eukaryotic cadherins. Cadherins promote calcium-dependent cell-cell adhesion in eukaryotic cells [63] indicating that RL2961 and pRL100309 could be involved in cellular aggregation, or attachment to roots an important part of legume infection. An extracellular calcium-binding protein of unknown sequence (rhicadhesin) has been identified as playing a role in rhizobial attachment to root hairs [85,86], but it is much smaller than RL2961 or pRL100309. Two of the PrsDE-dependent secreted proteins are the glycosyl hydrolases PlyA and PlyB, which cleave the extracellular acidic exopolysaccharide [13]. A plyA plyB double mutant retained some glycosyl hydrolase activity, indicating that other extracellular glycosyl hyrolases were present [59]. It is possible that the other two predicted glycosyl hydrolases (PlyC and RL2412) could cleave rhizobial exopolysaccharides or could play a role in plant cell wall degradation similar to that observed previously in R. l. bv. trifolii [17]. RL0790 is predicted to be a secreted protease. The observation that it was present in complex medium (containing peptone), but not in minimal medium, suggests it may be induced if the bacteria are relying on peptides for growth. This is unlikely in the rhizosphere, but infection threads and senescent nodules are environments rich in proteins, and so it might be anticipated that RL0790 could contribute to growth of bacteria in infection threads or in senescing plant cells. Nucleoside diphosphate kinase (NDK) was not predicted to be a Type I substrate by the bioinformatics approach, but was absent from the culture supernatant of the prsD mutant. Exported NDKs are not without precedent in mammalian pathogens; P. aeruginosa, Vibrio cholerae and Mycobacterium tuberculosis secrete NDKs [70,87-89], as do the parasitic nematodes Trichinella spiralis and Haemonchus contortus [90,91]. In P. aeruginosa, secretion of NDK into the culture supernatant has been shown to be dependent on the presence of the sequence DTEV near its C-terminus and it has been suggested that NDK secretion occurs via a Type I secretion system [70]. A very similar sequence (DTEI) is also present near the C-terminus of NDK from R.l. bv. viciae 3841. Extracellular ATP plays a role in macrophage apoptosis as a response to pathogen attack. In Arabidopsis thaliana, auxin and ATP are both transported by the metabolite transporter MDR1. Removal of extracellular ATP leads to FB1-induced cell death in a number of plants including legumes [92]. Extracellular NDK may possibly have an effect on modulating these responses, but as with the other PrsDE-dependent secreted proteins its role is probably minor, since the prsD mutant lacking secretion of NDK does not appear to differ from the wild type in nodulation phenotype. A role for Type I secretion in the symbiosis has been shown previously because the nodulation signalling protein NodO is secreted via the PrsDE system, although this is not essential for nodulation [5,12]. In addition, prsD mutants of R.l. bv viciae strain A34 and R.l. bv. trifolii strain TA1 form nodules that are infected but do not fix nitrogen [12,81]. This is not the case with strain 3841 and the reason for the difference is not known, although a prsD mutant of S. meliloti also forms nitrogen-fixing nodules [15]. The predicted BltDE secretion system seems likely to be a bacteriocin/lantibiotic type exporter that secretes pRL90159 and pRl90161, large proteins encoded by genes upstream of the bltDE genes. Proteins similar to those encoded by bltDE are present in R. etli and a related system (Rzc) is involved in the export of medium bacteriocins in other rhizobia [79,80] implying a possible role for pRL90159 and pRl90161 as bacteriocin-like proteins. However, the sequences of pRL90159 and pRl90161 are more similar to hypothetical proteins from non-rhizobia such as Nitrobacter spp. than to proteins from other rhizobia The other two predicted Type I secretion systems are enigmatic because we did not identify any secreted proteins that require toaD or tobD for their secretion, even though we made double and triple mutants (with toaB, tobD and prsD) to test for redundancy of function. This could mean that we have not identified appropriate growth conditions, the resolution of the protein gels is inadequate to identify the products (too low in amount or too small), or even that these are not protein secretion systems, but possibly secrete some other component. Genes similar to toaD are present in syntenic locations in S. meliloti (80% identity) [56] and A. tumefaciens (86% identity) [93]. A protein from Bradyrhizobium japonicum has similarity to TobD (52% identity). The genes surrounding the genes encoding these proteins also display similarity to those surrounding toaD and tobD in R.l. bv. viciae 3841, respectively, suggesting synteny and likely orthology. It is evident that these genes are not essential for growth or for the symbiosis with the tested host legumes pea, broad bean and vetch.

The TAT secretion system is involved in nodulation

The R. l. bv. viciae 3841 tatABC-encoded secretion system genes are as expected from related bacteria such as A. tumefaciens [54] and R. l. bv. viciae UPM 791 [38]. The tatC mutant exhibited phenotypes expected from previous work in A. tumefaciens and R. l. bv. viciae UPM791 in that the A. tumefaciens tatC mutant was also shown to be largely immotile, lacking flagellar proteins in the culture supernatant and the R. l. bv. viciae UPM791 tatC mutant also formed white nodules on peas and did not fix nitrogen. However, while the R. l. bv. viciae UPM791 tatC mutant only formed small nodules, the nodules formed by a R. l. bv. viciae 3841 tatC mutant were on average larger than those formed by the wild type. As in R. l. bv. viciae UPM791, the R. l. bv. viciae 3841 tatC mutant did not progress beyond the infection zone in the nodule, but unlike in R. l. bv. viciae UPM791 [38], viable bacteria could be isolated from nodules formed by the R. l. bv. viciae 3841 tatC mutant. The lack of growth and symbiotic nitrogen fixation in nodules could result from the inability of the tatC mutant to export to the periplasm electron-transport components required for respiration in the low oxygen environment in the nodule. Periplasmic proteins isolated from the tatC mutant and R. l. bv. viciae 3841 grown in TY medium give very similar patterns when separated by SDS-PAGE, suggesting that most TAT substrate proteins are either not expressed under the observed conditions or are expressed at such a low level that they are not visible on the SDS-PAGE gel. Another major difference between the wild type and the tatC mutant is the increased quantity of periplasmic proteins in the supernatant. A similar increased leakage of periplasmic contents into the extracellular space has been shown in tatC mutants of E. coli [94]. In this strain, outer membrane stability is compromised by the mislocalisation of two cell wall amidases, AmiA and AmiC, which are TAT substrates [95]. The AmiC protein from R. l. bv. viciae 3841 (RL1742) is also predicted to be a TAT substrate, suggesting that the increased leakiness of the outer membrane is due to the mislocalisation of this protein.

Identification of proteins from the culture supernatant

Previous studies on the extracellular proteome of rhizobia such as that by Suss et al. [96] have successfully used a proteomic approach to identify novel substrates of specific secretion systems, but have largely ignored proteins still present in the culture supernatant of the mutant studied. In this study, we show for the first time that many of the culture supernatant proteins identified by MALDI-Tof-MS are predicted to be periplasmic, most of them being similar to well known periplasmic proteins such as substrate binding proteins that are unlikely to function extracellularly. Type II protein secretion system secrete periplasmic proteins across the outer membrane in many Gram-negative bacteria, but such a system is absent from R. l. bv. viciae 3841. Bands corresponding to the predicted periplasmic proteins in the culture supernatant were also observed in periplasmic preparations, arguing against a specific secretion mechanism and for unspecific leakage. Periplasmic proteins have also been identified in the culture supernatant of H. pylori [74], but the mechanism of secretion, if any, was also unknown. The absence of the cytoplasmic protein RhiA suggests leakage from the periplasm rather than cell lysis as the reason for the presence of periplasmic proteins in the culture supernatant. Periplasmic proteins are found in the culture supernatant of R. l. bv. viciae 3841 at all stages of the cell cycle, and indeed are highly abundant during exponential growth. This indicates leakage from the periplasm during active growth, rather than cell death and lysis, as the likely origin of periplasmic proteins in the culture supernatant. Periplasmic proteins in the culture supernatant have previously been reported in R. leguminosarum RBL5523 [97]. The same study identified a mutant in which one of these proteins was absent from the culture supernatant and discussed the possible presence of a specific secretion system for this protein. To our knowledge, this is the only possible example of a periplasmic protein being secreted in rhizobia, and it seems to be limited to a single protein. Preliminary studies in our laboratory with an equivalent mutant in R. l. bv. viciae 3841 did not reveal any difference in extracellular protein profile. Only one Type III-like system was found in the genome sequence of R. l. bv. viciae 3841, namely the flagellar biosynthetic cluster (Table 1). Although not classically regarded as a protein secretion system, the flagellar apparatus in Salmonella has also been shown to actively secrete proteins unrelated to flagellar biosynthesis [25], highlighting the possibility of secretion of non-flagellar proteins by the flagellar apparatus. It is not known whether R. l. bv. viciae 3841 utilises the flagellum for protein secretion as well. Three components of the flagellar apparatus were identified in the culture supernatant. All three are part of the flagellum itself, and so are directly exposed to the extracellular medium. As the flagellum is easily sheared from the bacterial surface, flagellar proteins are common components of the culture supernatant in many bacteria [74-76,96]. Type IV secretion systems are involved in nodulation in M. loti R7A in a host-specific manner [20]. In contrast, the virB6 mutant of R. l. bv. viciae 3841 was not affected in the nodulation process of any of the three host legumes tested in this study, showing that the putative Type IV protein secretion system in this strain is not essential for nodulation in these hosts.

Conclusion

Although secreted proteins play a major role in the infection process of plant and animal pathogens and are also involved in successful nodulation in certain rhizobia-legume interactions, the identified homologs of known secretion systems (with the exception of TAT) do not appear to be essential for nodulation of pea plants by R. l. bv. viciae 3841. The results do not rule out the possibility of a novel protein secretion mechanism operating in this strain, as the presence of a large number of proteins in the culture supernatant remains unexplained. As these proteins are predicted to be periplasmic and indeed also abundant in periplasmic preparations, unspecific leakage from the periplasm could also account for these. Protein secretion in R. l. bv. viciae 3841 is furthermore distinct from that of many other Gram-negative bacteria in that the main pathway of protein secretion appears to be a Type I secretion system, PrsDE. This system is predicted to secrete at least 13 very dissimilar proteins of widely varied molecular weights. This is in direct contrast to the very narrow range of substrates recognised by most other Type I systems. The PrsDE system is conserved in other rhizobia and is required for nodulation in some of these, but not in R. l. bv. viciae 3841. The predicted functions of many of the PrsDE-dependent proteins are nevertheless consistent with auxiliary function in nodulation such as attachment, cell wall degradation, escape from senescent nodules or the modulation of the extracellular ATP pool.

Methods

Media and growth conditions

Strains of Rhizobium were grown at 28°C in Tryptone-Yeast (TY) medium [98] or Y [99] medium supplemented with succinate or mannitol as indicated in the text. Solid media contained 1% agar unless stated otherwise. Antibiotics were used at the following concentrations: ampicillin 400 μg ml-1; gentamicin 20 μg ml-1; kanamycin μg ml-1; spectinomycin 400 μg ml-1; streptomycin 400 μg ml-1. PGase and glycanase activity were assayed on plates as described by Finnie et al. [12]. Motility was assayed by observing the absence or presence of swarming on 0.2% agar TY plates.

Nodulation assay

Nodulation assays on Pisum sativum cv. Frisson and Vicia faba cv. The Sutton were done as described previously for peas by Beynon et al. [100]. Briefly, seeds were rinsed with 70% ethanol, surface-sterilised by treatment with 5% sodium hypochlorite for 10 minutes and germinated on agar medium in the dark. Vicia hirsuta seeds were scarified with sulphuric acid and germinated on agar slants as described by Knight et al. [101].

Protein electrophoresis

Discontinuous sodium dodecyl sulphate polyacrylamide gel electrophoresis (SDS-PAGE) was used to separate denatured proteins according to molecular weight [102]. The discontinuous system consisted of a stacking gel (4% (w/v) acrylamide, pH 6.8) and a separating gel (12% (w/v) acrylamide, pH 8.8). The gels were cast and run in the vertical Biorad MiniProtean II system. Samples were prepared by adding an equal volume of 2 × SDS sample buffer and incubating for 10 min in a boiling water bath. Gels were run at 25 mA per gel using 50 mM Tris/glycine pH 8.6, 0.1% (w/v) SDS as running buffer.

Preparation of culture supernatant proteins

Cells grown in 100 ml of liquid Y mannitol medium for four days until stationary phase were pelleted by centrifugation for 45 min at 15,000 × g at 4°C. 20% (w/v) trichloroacetic acid (TCA) was added to the supernatant to a final concentration of 5% (w/v). After 30 min incubation on ice, the supernatant proteins were pelleted by centrifugation for 1 h at 15,000 × g at 4°C. The pellet was washed twice with 80% (v/v) acetone, 50 mM Tris/HCl pH 8.0 to remove residual TCA and air-dried prior to resuspension in SDS-PAGE sample buffer. Other methods to precipitate culture supernatant such as acetone precipitation, ammonium sulphate precipitation or lyophilisation of the culture supernatant were found to be ineffective for this strain due to the presence of large amounts of exopolysaccharide that were co-precipitated by these methods.

Generation of mutants

Mutants are listed in Table 4 and all except toaD and tatC were identified by PCR from an arrayed random Tn5-insertion library using gene- and Tn5-specific primers. The locations of insertion of Tn5 were confirmed by DNA sequencing. Strains carrying an insertion in two of the genes of interest, tatC and toad, were not present in this random library and were therefore constructed by double homologous recombination. For the construction of a toaD mutant, a 2 kb fragment carrying the toaD gene was cloned into pJQ200SK [103] and a spectinomycin resistance cassette ligated into the unique NcoI site within toaD. This construct was then recombined into the genome by a double homologous recombination. The tatC mutant was generated using a similar approach to that used to inactivate toaD. PCR and DNA sequencing were used to verify that all insertions interrupted the gene of interest.
Table 4

Strains used in this work

StrainDescriptionReference
3841R.l. bv. viciae wild-type StrR[108]
A8953841 carrying prsD::Tn5This study
A8963841 carrying tobD::Tn5This study
A8973841 carrying virB6::Tn5This study
A898prsD::Tn5(gent): A895 containing gentamicin cassette replacing Tn5-neomycin resistanceThis study
A903prsD::Tn5(gent), tobD::Tn5; made by transduction of A896 with phage from A898This study
A911prsD::Tn5(gent), toaD::spec; made by transduction of A898 with phage from A913This study
A912prsD::Tn5(gent), tobD::Tn5, toaD::spec; made by transduction of A903 with phage from A913This study
A9133841 carrying toaD::specThis study
A10103841 carrying autA::Tn5This study
A10113841 carrying autB::Tn5This study
A10123841 carrying autC::Tn5This study
A10523841 carrying tatC::specThis study
Strains used in this work To avoid the problem of possible redundancy between the different members of Type I protein secretion systems, a prsD/toaD/tobD triple mutant and all double combinations were generated. To achieve this, the kanamycin resistance in the prsD mutant A895 was exchanged for gentamicin resistance by homologous recombination within the Tn5 sequence using plasmid pJQ175 [104], resulting in strain A898. Gentamicin resistance from this prsD mutant (A898) and spectinomycin resistance from the toaD mutant (A913) were then transduced consecutively into the kanamycin resistant tobD mutant (A896) to produce the prsD/toaD/tobD triple mutant A912. The double mutants toaD/prsD (A911) and tobD/prsD (A903) were constructed similarly. The mutants were checked by PCR and DNA sequencing. Although also part of a putative Type I secretion system, the BltD protein clearly belonged to a different class of proteins than the other three Type I ABC protein exporters. Therefore double or triple mutants protein exporter mutants carrying the bltD mutation were not made.

Analysis of sequence data

Nucleotide sequence data was curated and annotated using the CloneManager or Artemis software packages. Versions of BLAST [53] were used to carry out similarity searches in various databases. Sequences were aligned using ClustalX 1.8 [105], TreeView [106] was used to visualise dendrograms and phylograms. GEP signal sequences were predicted using the programs PrediSi and SignalP 3.0, TATFIND and TATP 1.0 were used for the prediction of TAT substrates. The RL and pRL numbers refer to gene identifiers used in the genome sequence of R.l. bv. viciae strain 3841 [107].

MALDI-ToF MS

The proteins contained in the gel slices (approx. 2 × 8 mm) were submitted to tryptic digest and MALDI ToF MS fingerprinting. The MS data were queried against a database containing the predicted R. l. bv. viciae 3841 protein sequences using the MASCOT software. Proteins achieving a MOWSE score of more than 51 (representing more than 95% confidence) were regarded as positively identified. Most proteins were identified with more than 99% confidence. All MASCOT searches were carried out on the complete database without molecular weight constraints, but the theoretical molecular weights of the predicted proteins all lay within 15 kDa of the molecular weight observed on the gel. Restricting the upper molecular weight limit adds additional data to the database search parameters and would result in even higher MOWSE scores, especially for relatively small proteins. As the molecular weight of many proteins can be estimated from an SDS-PAGE gel, this would be a legitimate constraint under the assumption that there is no major posttranslational processing. The MOWSE score for any individual proteins in a protein mixture is reduced, as many of the fragments in a mixture would remain unmatched to any single protein. For this reason, proteins identified from band 12 (which comes from a region of the gel with many closely-spaced protein bands) tend to have lower MOWSE scores than proteins matched to clear single bands. Two proteins from band 12 (RL0713 and RL0489) actually achieve MOWSE scores below the statistical cutoff at 51. Considering their molecular weights and the fact that they clearly come from a mixed band, they were nevertheless included. Removing fragments from the positively identified proteins pRL100451 and RL0196 from the band 12 dataset lifts the MOWSE score above the cutoff. This is not the case for low scoring proteins in the other datasets.

Authors' contributions

MK performed the bioinformatic analysis, carried out the experiments and drafted the manuscript jointly with JAD, who coordinated the study. Both authors have read and approved the final manuscript.
  107 in total

1.  Three-dimensional structure of the bacterial protein-translocation complex SecYEG.

Authors:  Cécile Breyton; Winfried Haase; Tom A Rapoport; Werner Kühlbrandt; Ian Collinson
Journal:  Nature       Date:  2002-08-08       Impact factor: 49.962

2.  Adaptation of protein secretion to extremely high-salt conditions by extensive use of the twin-arginine translocation pathway.

Authors:  R Wesley Rose; Thomas Brüser; Jessica C Kissinger; Mechthild Pohlschröder
Journal:  Mol Microbiol       Date:  2002-08       Impact factor: 3.501

Review 3.  Structure and function of TolC: the bacterial exit duct for proteins and drugs.

Authors:  Vassilis Koronakis; Jeyanthy Eswaran; Colin Hughes
Journal:  Annu Rev Biochem       Date:  2004       Impact factor: 23.643

4.  Transcription of rhiA, a gene on a Rhizobium leguminosarum bv. viciae Sym plasmid, requires rhiR and is repressed by flavanoids that induce nod genes.

Authors:  A Economou; F K Hawkins; J A Downie; A W Johnston
Journal:  Mol Microbiol       Date:  1989-01       Impact factor: 3.501

Review 5.  Periplasmic enzymes in gram-negative bacteria.

Authors:  I R Beacham
Journal:  Int J Biochem       Date:  1979

6.  Cleavage of structural proteins during the assembly of the head of bacteriophage T4.

Authors:  U K Laemmli
Journal:  Nature       Date:  1970-08-15       Impact factor: 49.962

7.  Colicin A hybrids: a genetic tool for selection of type II secretion-proficient Pseudomonas strains.

Authors:  R Voulhoux; A Lazdunski; A Filloux
Journal:  EMBO Rep       Date:  2001-01       Impact factor: 8.807

8.  Quality and rate of extracellular polysaccharides produced by Rhizobium meliloti and their inducing effect on polygalacturonase production in legume roots as derived from the presence of extrachromosomal DNA.

Authors:  A Palomares; E Montoya; J Olivares
Journal:  Microbios       Date:  1978

Review 9.  Nucleoside diphosphate kinase: role in bacterial growth, virulence, cell signalling and polysaccharide synthesis.

Authors:  A M Chakrabarty
Journal:  Mol Microbiol       Date:  1998-06       Impact factor: 3.501

Review 10.  The genome of Rhizobium leguminosarum has recognizable core and accessory components.

Authors:  J Peter W Young; Lisa C Crossman; Andrew W B Johnston; Nicholas R Thomson; Zara F Ghazoui; Katherine H Hull; Margaret Wexler; Andrew R J Curson; Jonathan D Todd; Philip S Poole; Tim H Mauchline; Alison K East; Michael A Quail; Carol Churcher; Claire Arrowsmith; Inna Cherevach; Tracey Chillingworth; Kay Clarke; Ann Cronin; Paul Davis; Audrey Fraser; Zahra Hance; Heidi Hauser; Kay Jagels; Sharon Moule; Karen Mungall; Halina Norbertczak; Ester Rabbinowitsch; Mandy Sanders; Mark Simmonds; Sally Whitehead; Julian Parkhill
Journal:  Genome Biol       Date:  2006-04-26       Impact factor: 13.583

View more
  27 in total

1.  Light regulates attachment, exopolysaccharide production, and nodulation in Rhizobium leguminosarum through a LOV-histidine kinase photoreceptor.

Authors:  Hernán R Bonomi; Diana M Posadas; Gastón Paris; Mariela del Carmen Carrica; Marcus Frederickson; Lía Isabel Pietrasanta; Roberto A Bogomolni; Angeles Zorreguieta; Fernando A Goldbaum
Journal:  Proc Natl Acad Sci U S A       Date:  2012-07-05       Impact factor: 11.205

2.  Cloning and functional expression of an MscL ortholog from Rhizobium etli: characterization of a mechanosensitive channel.

Authors:  Daniel Balleza; Froylan Gómez-Lagunas; Carmen Quinto
Journal:  J Membr Biol       Date:  2010-02-23       Impact factor: 1.843

3.  The twin arginine transport system appears to be essential for viability in Sinorhizobium meliloti.

Authors:  Brad S Pickering; Ivan J Oresnik
Journal:  J Bacteriol       Date:  2010-07-30       Impact factor: 3.490

4.  Role of O2 in the Growth of Rhizobium leguminosarum bv. viciae 3841 on Glucose and Succinate.

Authors:  Rachel M Wheatley; Vinoy K Ramachandran; Barney A Geddes; Benjamin J Perry; Chris K Yost; Philip S Poole
Journal:  J Bacteriol       Date:  2016-12-13       Impact factor: 3.490

5.  Transcriptome profiling of a Rhizobium leguminosarum bv. trifolii rosR mutant reveals the role of the transcriptional regulator RosR in motility, synthesis of cell-surface components, and other cellular processes.

Authors:  Kamila Rachwał; Ewa Matczyńska; Monika Janczarek
Journal:  BMC Genomics       Date:  2015-12-29       Impact factor: 3.969

6.  RapA2 is a calcium-binding lectin composed of two highly conserved cadherin-like domains that specifically recognize Rhizobium leguminosarum acidic exopolysaccharides.

Authors:  Patricia L Abdian; Julio J Caramelo; Nora Ausmees; Angeles Zorreguieta
Journal:  J Biol Chem       Date:  2012-12-12       Impact factor: 5.157

7.  Lifestyle adaptations of Rhizobium from rhizosphere to symbiosis.

Authors:  Rachel M Wheatley; Brandon L Ford; Li Li; Samuel T N Aroney; Hayley E Knights; Raphael Ledermann; Alison K East; Vinoy K Ramachandran; Philip S Poole
Journal:  Proc Natl Acad Sci U S A       Date:  2020-09-08       Impact factor: 11.205

8.  Rhizobium sp. strain NGR234 possesses a remarkable number of secretion systems.

Authors:  Christel Schmeisser; Heiko Liesegang; Dagmar Krysciak; Nadia Bakkou; Antoine Le Quéré; Antje Wollherr; Isabelle Heinemeyer; Burkhard Morgenstern; Andreas Pommerening-Röser; Margarita Flores; Rafael Palacios; Sydney Brenner; Gerhard Gottschalk; Ruth A Schmitz; William J Broughton; Xavier Perret; Axel W Strittmatter; Wolfgang R Streit
Journal:  Appl Environ Microbiol       Date:  2009-04-17       Impact factor: 4.792

Review 9.  The twin-arginine translocation (Tat) protein export pathway.

Authors:  Tracy Palmer; Ben C Berks
Journal:  Nat Rev Microbiol       Date:  2012-06-11       Impact factor: 60.633

Review 10.  Rhizobia: from saprophytes to endosymbionts.

Authors:  Philip Poole; Vinoy Ramachandran; Jason Terpolilli
Journal:  Nat Rev Microbiol       Date:  2018-01-30       Impact factor: 60.633

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.