Literature DB >> 16981179

Structural requirements for initiation of cross-reactivity and CNS autoimmunity with a PLP139-151 mimic peptide derived from murine hepatitis virus.

J Ludovic Croxford1, Anne M Ercolini, Mathew Degutes, Stephen D Miller.   

Abstract

MS is an autoimmune CNS demyelinating disease in which infection appears to be an important pathogenic factor. Molecular mimicry, the cross-activation of autoreactive T cells by mimic peptides from infectious agents, is a possible explanation for infection-induced autoimmunity. Infection of mice with a non-pathogenic strain of Theiler's murine encephalomyelitis virus (TMEV) engineered to express an epitope from Haemophilus influenzae (HI) sharing 6/13 amino acids with the dominant proteolipid protein (PLP) epitope, PLP139-151, can induce CNS autoimmune disease. Here we demonstrate that another PLP139-151 mimic sequence derived from murine hepatitis virus (MHV) which shares only 3/13 amino acids with PLP139-151 can also induce CNS autoimmune disease, but only when delivered by genetically engineered TMEV, not by immunization with the MHV peptide. Further, we demonstrate the importance of proline at the secondary MHC class II contact residue for effective cross-reactivity, as addition of this amino acid to the native MHV sequence increases its ability to cross-activate PLP139-151-specific autoreactive T cells, while substitution of proline in the HI mimic peptide has the opposite effect. This study describes a structural requirement for potential PLP139-151 mimic peptides, and provides further evidence for infection-induced molecular mimicry in the pathogenesis of autoimmune disease.

Entities:  

Mesh:

Substances:

Year:  2006        PMID: 16981179      PMCID: PMC7163677          DOI: 10.1002/eji.200635876

Source DB:  PubMed          Journal:  Eur J Immunol        ISSN: 0014-2980            Impact factor:   5.532


delayed‐type hypersensitivity Haemophilus influenzae mouse hepatitis virus position 9 proteolipid protein Theiler's murine encephalomyelitis virus

Introduction

The mechanism(s) of initiation and perpetuation of multiple sclerosis (MS), a human immune‐mediated demyelinating disease of the central nervous system (CNS) are unknown. Clinical and epidemiological studies suggest that both genetic and environmental factors are important in the initiation and pathogenesis of MS 1. Viral infections have been associated with other demyelinating CNS diseases, both in humans and animals 2–5, and various environmental factors have been associated with the initiation and exacerbation of MS, including viral infections 6, 7. MS is believed to be mediated by myelin‐specific CD4+ T cells. Although myelin‐specific autoreactive T cells can be isolated from the blood of normal healthy individuals, they do not have an activated phenotype. Therefore, a critical question is how do these cells become activated in MS patients? One potential mechanism is molecular mimicry, whereby autoreactive T cells may be cross‐activated by epitopes from infectious agents that share structural or sequence homology to self antigens 8, 9. Direct evidence for molecular mimicry in human autoimmune disease is difficult to obtain and support is limited to demonstration of in vitro reactivation of myelin‐specific T cell clones from MS patients by panels of antigens from infectious agents 10. In this regard, molecular mimicry between the U24 protein of human herpesvirus‐6 (HHV‐6), a virus that may be associated with MS, and a candidate autoantigenic epitope for MS, MBP96–102, has recently been demonstrated 11. Therefore, better understanding of the potential mechanisms of molecular mimicry‐induced autoreactive T cell activation is important in elucidating the pathogenesis of MS. Previously, we demonstrated that infection of SJL mice with a non‐pathogenic strain of Theiler's murine encephalomyelitis virus (TMEV) encoding a myelin mimic peptide from Haemophilus influenzae (HI) can cross‐activate myelin proteolipid protein (PLP)139–151‐specific CD4+ Th1 cells and induce an atypical CNS autoimmune disease 12, 13. The HI mimic peptide shares 6 of 13 amino acids with the major encephalitogenic peptide in SJL mice, PLP139–151. Although the sequence identity between the peptides is only 46%, structural identity of amino acids at the primary MHC class II (I‐As) and TCR contact residues is vital to the mechanism of molecular mimicry 14. Another potential PLP139–151 mimic peptide has been identified from murine hepatitis virus (MHV), a single‐stranded RNA coronavirus 15. The MHV3821–3832 mimic peptide only shares 3 of 13 amino acids with PLP139–151 (23% homology), including the primary TCR and MHC class II contact residues, but neither the secondary MHC class II proline residue nor the secondary TCR contact residue. The MHV peptide binds I‐As and induces limited activation of T cell clones derived from PLP139–151‐primed SJL mice 15 and a proline residue at position 9 (p9) of the MHC binding motif is important for binding to I‐As 16. Here, we demonstrate the importance of this MHC class II structural motif in an infection‐induced model of molecular mimicry which may be important for recognition of potential pathogen‐derived mimic sequences. In addition, we demonstrate that the MHV mimic sequence is a natural immunogenic T cell epitope in SJL mice as it can be processed from a MHV 30‐mer peptide by APC. Finally, we demonstrate that autoimmune disease can be initiated in mice infected with replicating virus engineered to express the natural MHV mimic sequence, but not by immunization with the MHV peptide in CFA. Therefore, this paper highlights the structural requirements of pathogen‐derived myelin mimic peptides and the critical importance of studying a “live” infection concomitant to presentation of mimic peptides.

Results

MHV mimic peptide immunization does not induce demyelinating clinical disease

A previous investigation had identified a potential PLP139–151 molecular mimic peptide expressed by MHV 15. We thus asked if this mimic peptide could cross‐prime/activate PLP139–151‐specific T cells. Following the immunization of mice with PLP139–151 or a PLP 30‐mer peptide (PLP130–159) encompassing the core PLP139–151 encephalitogenic epitope, in CFA, 100% of SJL mice exhibited a typical acute‐phase disease course of EAE (Table 1). In contrast, mice immunized with the PLP139–151 mimic peptide, MHV3821–3832 (MHV), or an MHV 30‐mer peptide (MHV3813–3842) containing the MHV3821–3832 minimal epitope did not exhibit clinical disease (Table 1). The ability of MHV immunization to induce the cross‐activation of PLP139–151‐specific T cells was measured by in vivo delayed‐type hypersensitivity (DTH) and in vitro T cell proliferation assays. DTH rechallenge with PLP139–151 in MHV‐immunized mice on day 16 post immunization did not cross‐activate PLP139–151‐specific T cells; however, PLP139–151 DTH responses were significantly higher in PLP139–151‐immunized mice compared to MHV‐ or OVA‐immunized mice, or naive micep <0.05) (Fig. 1A). MHV‐immunized mice had significantly greater DTH responses following rechallenge with MHV compared to control groups (*p <0.05) and, interestingly, PLP139–151‐immunized mice responded to both PLP139–151 and MHV rechallenge, suggesting unidirectional molecular mimicry (Fig. 1A). We also tested whether the putative MHV‐encoded PLP‐mimic sequence was a natural epitope for SJL mice in the context of I‐As. Mice immunized to the 30‐mer MHV3813–3842 peptide, encompassing the candidate PLP139–151 mimic epitope, demonstrated DTH responses in vivo (Fig. 1A) and in vitro proliferative responses (Fig. 1B) upon rechallenge with the MHV short peptide, indicating that the short‐length mimic MHV epitope may be processed by APC and induce MHV‐specific T cell responses. However, in contrast to the in vivo DTH data, in vitro MHV rechallenge in both PLP‐immunized groups of mice did not induce T cell proliferation (Fig. 1B). This result may reflect the differences between in vitro and in vivo antigen processing and the sensitivity of the microenvironment in vivo to peptide rechallenge. In contrast, MHV‐immunized mice responded to in vitro rechallenge with the PLP139–151 peptide, albeit at a significantly lower level than rechallenge of PLP‐immunized mice (Fig. 1C). Anti‐CD3 antibody stimulation of T cells from peptide‐immunized mice was equivalent between all groups (Fig. 1B, C).
Table 1

MHV mimic peptides fail to induce EAE

Immunizing Aga)

No. EAE

Mean group score ± SEM

Mean day of onset ± SEM

OVA323–339

0/5

0.0 ± 0.0

0.0 ± 0.0

PLP139–151

5/5

4.0 ± 0.0

12.2 ± 0.8

PLP130–159

5/5

3.6 ± 0.5

13.4 ± 1.5

MHV3821–3832

0/5

0.0 ± 0.0

0.0 ± 0.0

MHV3813–3842

0/5

0.0 ± 0.0

0.0 ± 0.0

a) Separate groups of mice were immunized s.c. on day 0 with 100 µg of either “self” myelin peptide PLP (PLP139–151), PLP 30‐mer (PLP130–159), MHV mimic peptide (MHV3821–3832), MHV 30‐mer (MHV3813–3842) or a control non‐self, non‐mimic peptide OVA323–339 and observed for signs of clinical EAE. Results represent the number of mice that developed EAE, the mean group clinical score ± SEM, and the mean day of onset ± SEM.

Figure 1

Cross‐reactivity between PLP and MHV peptides in vivo. (A) Separate groups of mice were immunized s.c. on day 0 with 100 µg of either “self” myelin peptide PLP139–151, PLP130–159, mimic foreign peptide MHV3821–3832, MHV3813–3842 or a control non‐self, non‐mimic peptide OVA323–339. In vivo differentiation of CD4+ Th1 cells was assessed by DTH ear swelling assays on day 16 post priming upon challenge with 10 µg of either PLP139–151 or MHV3821–3832. Results are expressed as mean 24 h ear swelling ± SEM in groups of four to five mice. *Values significantly above control levels in naive or OVA323–339‐immunized mice, p <0.05. §Values significantly above levels in OVA323–339‐, MHV3821–3832‐ or MHV3813–3842‐immunized or naive mice, p <0.05. CD4+ T cell proliferative responses were assessed on day 18 in response to restimulation with 50 µM MHV3821–3832 (B) or PLP139–151 (C). T cell proliferation was determined at 96 h and results are expressed as cpm × 103 from triplicate cultures. *Values significantly above control levels in naive or OVA323–339‐immunized mice, p <0.05.

WILEY‐VCH

MHV mimic peptides fail to induce EAE Immunizing Aga) No. EAE Mean group score ± SEM Mean day of onset ± SEM OVA323–339 0/5 0.0 ± 0.0 0.0 ± 0.0 PLP139–151 5/5 4.0 ± 0.0 12.2 ± 0.8 PLP130–159 5/5 3.6 ± 0.5 13.4 ± 1.5 MHV3821–3832 0/5 0.0 ± 0.0 0.0 ± 0.0 MHV3813–3842 0/5 0.0 ± 0.0 0.0 ± 0.0 a) Separate groups of mice were immunized s.c. on day 0 with 100 µg of either “self” myelin peptide PLP (PLP139–151), PLP 30‐mer (PLP130–159), MHV mimic peptide (MHV3821–3832), MHV 30‐mer (MHV3813–3842) or a control non‐self, non‐mimic peptide OVA323–339 and observed for signs of clinical EAE. Results represent the number of mice that developed EAE, the mean group clinical score ± SEM, and the mean day of onset ± SEM. Cross‐reactivity between PLP and MHV peptides in vivo. (A) Separate groups of mice were immunized s.c. on day 0 with 100 µg of either “self” myelin peptide PLP139–151, PLP130–159, mimic foreign peptide MHV3821–3832, MHV3813–3842 or a control non‐self, non‐mimic peptide OVA323–339. In vivo differentiation of CD4+ Th1 cells was assessed by DTH ear swelling assays on day 16 post priming upon challenge with 10 µg of either PLP139–151 or MHV3821–3832. Results are expressed as mean 24 h ear swelling ± SEM in groups of four to five mice. *Values significantly above control levels in naive or OVA323–339‐immunized mice, p <0.05. §Values significantly above levels in OVA323–339‐, MHV3821–3832‐ or MHV3813–3842‐immunized or naive mice, p <0.05. CD4+ T cell proliferative responses were assessed on day 18 in response to restimulation with 50 µM MHV3821–3832 (B) or PLP139–151 (C). T cell proliferation was determined at 96 h and results are expressed as cpm × 103 from triplicate cultures. *Values significantly above control levels in naive or OVA323–339‐immunized mice, p <0.05. WILEY‐VCH

Asparagine for proline substitution at p9 effects Th1 responses and clinical disease

To determine whether the amino acid identity at p9 is important in conferring molecular mimicry to mimic peptides, we produced “altered mimic peptide ligands” by the substitution of asparagine (N) with proline (P) at p9 (P→N) in the MHV peptide (MHV+P; Fig. 2) and immunized mice with either MHV or MHV+P peptides in CFA. Clinical disease was not induced in either group compared with the positive control mice immunized with PLP139–151 (Table 2). To determine whether MHV+P immunization induced cross‐reactive PLP139–151 proliferative responses, mice were rechallenged in vitro with either the immunizing peptide or PLP139–151 on day 14 following peptide immunization. Rechallenge with PLP139–151 in PLP139–151‐immunized mice induced significant T cell proliferation compared to control groups (Fig. 3A). Interestingly, PLP139–151 rechallenge in MHV+P‐immunized mice also induced a modest T cell proliferative response compared with MHV‐ or OVA323–339‐immunized mice (Fig. 3A). In MHV‐immunized mice, in vitro rechallenge with MHV induced the greatest proliferative response, as expected, and a lesser response in MHV+P‐immunized mice (Fig. 3B). Responses in PLP139–151‐ and OVA323–339‐immunized mice were similar to those of naive mice (Fig. 3B). Rechallenge with MHV+P induced strong responses in both MHV‐ and MHV+P‐immunized mice (Fig. 3C). In addition, MHV+P rechallenge induced T cell proliferative responses in PLP139–151‐immunized mice (Fig. 3C) in contrast to MHV rechallenge (Fig. 3B).
Figure 2

Peptide sequences of myelin and myelin mimic peptides. The mimic MHV3821–3832 and HI574–586 epitopes share 3 and 6 of 13 amino acids, respectively, with the native PLP139–151 epitope (in bold type), including the primary I‐As binding residue (L145, p6) and the primary TCR contact residue (W144, p4). However, only the HI mimic peptide shares the (P148) I‐As binding residue. To determine the role of proline in PLP molecular mimicry we substituted proline at p9 for asparagine (HI574–586–P). In addition, we substituted asparagine at p9 in MHV3821–3832 with proline (MHV3821–3832+P). The I‐As‐restricted OVA323–339 peptide used as a negative control does not share sequences with PLP, HI or MHV peptides.

WILEY‐VCH

Table 2

Altered mimic peptides fail to induce EAE

Immunizing Aga)

No. EAE

Mean group score ± SEM

Mean day of onset ± SEM

OVA

0/5

0.0 ± 0.0

0.0 ± 0.0

PLP

5/5

3.4 ± 0.5

13.8 ± 1.3

HI

0/5

0.0 ± 0.0

0.0 ± 0.0

HI–P

0/5

0.0 ± 0.0

0.0 ± 0.0

MHV

0/5

0.0 ± 0.0

0.0 ± 0.0

MHV+P

0/5

0.0 ± 0.0

0.0 ± 0.0

a) Separate groups of mice were immunized s.c. on day 0 with 100 µg of either “self” myelin peptide PLP139–151 (PLP), viral mimic peptides MHV3821–3832 (MHV) or MHV3821–3832+P (MHV+P), bacterial mimic peptides HI574–586 (HI) or HI574–586–P (HI–P), or a control non‐self, non‐mimic peptide OVA323–339 (OVA) and observed for signs of clinical EAE. Results represent the number of mice that developed EAE, the mean group clinical score ± SEM, and the mean day of onset ± SEM.

Figure 3

The altered mimic peptide MHV3821–3832+P induces PLP‐specific T cell responses, but fails to induce EAE. (A–E) Mice were immunized on day 0 with PLP139–151 (P), MHV3821‐3832 (M), MHV3821–3832+P (M+), HI574–586 (H), HI574–586–P (H–) or OVA323–339 (O) and observed for signs of clinical EAE. CD4+ T cell proliferative responses were measured in response to PLP139–151 (A), MHV3821–3832 (B), MHV3821–3832+P (C), HI574–586 (D) and HI574–586–P (E) rechallenge. (F–J) CD4+ T cell IFN‐γ responses were measured in response to PLP139–151 (F), MHV3821–3832 (G), MHV3821–3832+P (H), HI574–586 (I) and HI574–586–P (J) rechallenge. Naive (N) mice demonstrated no responses to rechallenge with any peptide. *1 p <0.05 compared to naive mice and mice immunized with OVA, MHV, MHV+, HI and HI–, rechallenged with PLP. *2 p <0.05 compared to MHV‐ and OVA‐immunized mice rechallenged with PLP. *3 p <0.05 compared to MHV+‐immunized mice rechallenged with MHV. *4 p <0.05 compared to PLP‐immunized mice rechallenged with MHV. *a p <0.05 compared to naive or OVA‐immunized mice rechallenged with PLP. *b p <0.05 compared to MHV‐immunized mice rechallenged with PLP. *c p <0.05 compared to MHV‐immunized mice rechallenged with MHV. *d p <0.05 compared to PLP‐immunized mice rechallenged with MHV. *e p <0.05 compared to mice immunized with HI– and rechallenged with HI, MHV, MHV+ and PLP. *f p <0.05 compared to mice immunized with HI– and rechallenged with PLP. *g p <0.05 compared to MHV‐immunized mice rechallenged with HI.

WILEY‐VCH

Peptide sequences of myelin and myelin mimic peptides. The mimic MHV3821–3832 and HI574–586 epitopes share 3 and 6 of 13 amino acids, respectively, with the native PLP139–151 epitope (in bold type), including the primary I‐As binding residue (L145, p6) and the primary TCR contact residue (W144, p4). However, only the HI mimic peptide shares the (P148) I‐As binding residue. To determine the role of proline in PLP molecular mimicry we substituted proline at p9 for asparagine (HI574–586–P). In addition, we substituted asparagine at p9 in MHV3821–3832 with proline (MHV3821–3832+P). The I‐As‐restricted OVA323–339 peptide used as a negative control does not share sequences with PLP, HI or MHV peptides. WILEY‐VCH Altered mimic peptides fail to induce EAE Immunizing Aga) No. EAE Mean group score ± SEM Mean day of onset ± SEM OVA 0/5 0.0 ± 0.0 0.0 ± 0.0 PLP 5/5 3.4 ± 0.5 13.8 ± 1.3 HI 0/5 0.0 ± 0.0 0.0 ± 0.0 HIP 0/5 0.0 ± 0.0 0.0 ± 0.0 MHV 0/5 0.0 ± 0.0 0.0 ± 0.0 MHV+P 0/5 0.0 ± 0.0 0.0 ± 0.0 a) Separate groups of mice were immunized s.c. on day 0 with 100 µg of either “self” myelin peptide PLP139–151 (PLP), viral mimic peptides MHV3821–3832 (MHV) or MHV3821–3832+P (MHV+P), bacterial mimic peptides HI574–586 (HI) or HI574–586–P (HIP), or a control non‐self, non‐mimic peptide OVA323–339 (OVA) and observed for signs of clinical EAE. Results represent the number of mice that developed EAE, the mean group clinical score ± SEM, and the mean day of onset ± SEM. The altered mimic peptide MHV3821–3832+P induces PLP‐specific T cell responses, but fails to induce EAE. (A–E) Mice were immunized on day 0 with PLP139–151 (P), MHV3821‐3832 (M), MHV3821–3832+P (M+), HI574–586 (H), HI574–586–P (H–) or OVA323–339 (O) and observed for signs of clinical EAE. CD4+ T cell proliferative responses were measured in response to PLP139–151 (A), MHV3821–3832 (B), MHV3821–3832+P (C), HI574–586 (D) and HI574–586–P (E) rechallenge. (F–J) CD4+ T cell IFN‐γ responses were measured in response to PLP139–151 (F), MHV3821–3832 (G), MHV3821–3832+P (H), HI574–586 (I) and HI574–586–P (J) rechallenge. Naive (N) mice demonstrated no responses to rechallenge with any peptide. *1 p <0.05 compared to naive mice and mice immunized with OVA, MHV, MHV+, HI and HI–, rechallenged with PLP. *2 p <0.05 compared to MHV‐ and OVA‐immunized mice rechallenged with PLP. *3 p <0.05 compared to MHV+‐immunized mice rechallenged with MHV. *4 p <0.05 compared to PLP‐immunized mice rechallenged with MHV. *a p <0.05 compared to naive or OVA‐immunized mice rechallenged with PLP. *b p <0.05 compared to MHV‐immunized mice rechallenged with PLP. *c p <0.05 compared to MHV‐immunized mice rechallenged with MHV. *d p <0.05 compared to PLP‐immunized mice rechallenged with MHV. *e p <0.05 compared to mice immunized with HI– and rechallenged with HI, MHV, MHV+ and PLP. *f p <0.05 compared to mice immunized with HI– and rechallenged with PLP. *g p <0.05 compared to MHV‐immunized mice rechallenged with HI. WILEY‐VCH IFN‐γ secretion was measured to determine whether MHV+P‐induced cross‐activation of PLP139–151 T cells could induce Th1 differentiation (Fig. 3F–H). As expected, PLP139–151 rechallenge in PLP139–151‐immunized mice induced significant quantities of IFN‐γ compared to naive or OVA‐immunized mice (Fig. 3F). Interestingly, PLP139–151 rechallenge in MHV+P‐immunized mice induced significant IFN‐γ production (Fig. 3F) in contrast to MHV‐immunized mice. Surprisingly, MHV rechallenge induced a significantly greater IFN‐γ response (Fig. 3G) in MHV+P‐immunized mice compared to MHV‐immunized mice. The populations of cells that respond to MHV or PLP can be thought of as separate populations in which some cells can be cross‐activated by mimic peptides. Fig. 3A, B shows that restimulation of MHV‐immunized splenocytes with MHV induces greater proliferation than PLP rechallenge of PLP‐immunized mice. However, PLP rechallenge of PLP‐immunized splenocytes can induce significantly larger IFN‐γ secretion than MHV rechallenge of MHV‐immunized mice (Fig. 3F, G). Therefore, the MHV+P peptide may “target” more “PLP‐specific” cells (high IFN‐γ, moderate proliferation), rather than the MHV‐specific cells (high proliferation, low IFN‐γ secretion). Differences between the populations may be due to relative binding affinities of the respective peptides for I‐As 15. Although rechallenge with the MHV+P peptide induced similar quantities of IFN‐γ in MHV‐ and MHV+P‐immunized mice, rechallenge with MHV+P, but not MHV, induced IFN‐γ responses in PLP139–151‐immunized mice (Fig. 3H). Anti‐CD3 antibody responses in all groups were equal (data not shown).

Proline at p9 is required for induction of myelin‐specific Th1 responses

As substitution of asparagine by proline at p9 of the MHV peptide increased its potential to cross‐activate PLP‐specific T cells, we investigated the consequences of substitution of proline by asparagine (P→N) at p9 in the HI574–586 peptide, a known PLP139–151 mimic peptide 12, 13, 15. No clinical disease was induced in SJL mice immunized with either HI or the HI peptide with the proline at p9 substituted with asparagine (HIP) (Table 2). Mice immunized to HI demonstrated significant proliferative responses to rechallenge with HI, and modest responses to PLP139–151, HIP, MHV+P and MHV peptide rechallenge compared to OVA‐immunized or naive mice (Fig. 3D). In contrast, HIP‐immunized mice responded significantly to rechallenge with HIP, and modestly to HI but not to other peptides, including PLP139–151 (Fig. 3E). IFN‐γ secretion was analyzed to determine whether the HIP peptide was less active than HI in inducing Th1 PLP139–151 cross‐reactive responses. Significant Th1 responses were observed in HI‐immunized mice rechallenged in descending order with HI > PLP > HIP >> MHV+P compared to control groups (Fig. 3F–J). However, HIP‐immunized mice responded to HIP > HI >> MHV > MHV+P but not to PLP (Fig. 3F–J). Interestingly, MHV+P‐immunized mice also demonstrated significant Th1 cross‐reactivity following HI rechallenge, compared to MHV peptide‐immunized mice (Fig. 3I).

Proline residue at p9 is critical for tolerogenic inhibition of PLP139–151‐induced EAE

To further determine the mimic potential of “altered mimic peptide ligands”, SJL mice (n = 8) were pre‐tolerized to MHV+P on day –7/+3 and immunized to PLP139–151, to determine whether the altered MHV+P peptide could deliver a cross‐reactive tolerogenic signal to PLP139–151‐specific T cells and inhibit the onset of EAE. Mice tolerized with PLP139–151, HI574–586 or MHV+P all exhibited a significant amelioration of clinical disease (*p <0.05) compared with untolerized mice and OVA peptide‐tolerized controls (Table 3). As anticipated, tolerance with the native MHV peptide did not inhibit EAE. Furthermore, unlike HI574–586‐tolerized mice, HIP tolerance failed to protect against PLP139–151‐induced EAE.
Table 3

Altered mimic peptide tolerance of PLP139–151‐induced EAE

Tol Aga)

No. EAE

Mean group score ± SEM

Mean EAE score ± SEM

Mean day of onset ± SEM

No tol

5/5

3.8 ± 0.2

3.8 ± 0.2

12.0 ± 0.9

OVA

5/5

3.6 ± 0.2

3.6 ± 0.2

11.6 ± 0.8

PLP

2/5

0.4 ± 0.2b)

1.0 ± 0.1b)

14.5 ± 1.5

HI

3/5

0.8 ± 0.4b)

1.3 ± 0.3b)

13.7 ± 1.9

HI–P

5/5

3.0 ± 0.5

3.0 ± 0.5

11.8 ± 0.6

MHV

5/5

3.4 ± 0.2

3.4 ± 0.2

11.8 ± 0.9

MHV+P

5/5

2.0 ± 0.4b)

2.0 ± 0.4b)

11.4 ± 0.4

a) Separate groups of mice were immunized s.c. on day 0 with 100 µg of PLP139–151 and were tolerized to OVA323–339 (OVA), PLP139–151 (PLP), HI574–586 (H), HI574–586–P (H–P), MHV3821–3832 (MHV), or MHV3821–3832+P (MHV+P) at 7 days pre and 3 days post immunization with PLP139–151. Results represent the number of mice that developed EAE, the mean group clinical score ± SEM, the mean EAE score ± SEM (excluding mice not exhibiting disease), and the mean day of onset ± SEM.

b) p <0.05 compared to control OVA‐tolerized or non‐tolerized mice.

Altered mimic peptide tolerance of PLP139–151‐induced EAE Tol Aga) No. EAE Mean group score ± SEM Mean EAE score ± SEM Mean day of onset ± SEM No tol 5/5 3.8 ± 0.2 3.8 ± 0.2 12.0 ± 0.9 OVA 5/5 3.6 ± 0.2 3.6 ± 0.2 11.6 ± 0.8 PLP 2/5 0.4 ± 0.2b) 1.0 ± 0.1b) 14.5 ± 1.5 HI 3/5 0.8 ± 0.4b) 1.3 ± 0.3b) 13.7 ± 1.9 HIP 5/5 3.0 ± 0.5 3.0 ± 0.5 11.8 ± 0.6 MHV 5/5 3.4 ± 0.2 3.4 ± 0.2 11.8 ± 0.9 MHV+P 5/5 2.0 ± 0.4b) 2.0 ± 0.4b) 11.4 ± 0.4 a) Separate groups of mice were immunized s.c. on day 0 with 100 µg of PLP139–151 and were tolerized to OVA323–339 (OVA), PLP139–151 (PLP), HI574–586 (H), HI574–586–P (H–P), MHV3821–3832 (MHV), or MHV3821–3832+P (MHV+P) at 7 days pre and 3 days post immunization with PLP139–151. Results represent the number of mice that developed EAE, the mean group clinical score ± SEM, the mean EAE score ± SEM (excluding mice not exhibiting disease), and the mean day of onset ± SEM. b) p <0.05 compared to control OVA‐tolerized or non‐tolerized mice. In vivo DTH and in vitro T cell proliferative responses were measured to determine the effect of the altered mimic peptide tolerogenic signal on the activation of PLP139–151‐specific T cells. Mice tolerized to either PLP139–151, HI574–586 or MHV+P all showed significantly reduced DTH and proliferative responses following rechallenge with PLP139–151 compared to control groups or groups tolerized to MHV (*p <0.05; Fig. 4A, B). The groups tolerized with the altered peptide mimics, MHV+P and HIP, demonstrated significantly lower or higher DTH and proliferative responses, respectively, compared to groups tolerized with the native peptide sequences, following rechallenge with PLP139–151.
Figure 4

Proline at p9 of the mimic MHV3821–3832 or HI574–586 peptides is critical for induction of cross‐reactivity to PLP139–151 as assessed by peripheral tolerance. (A) Separate groups of SJL mice were tolerized to OVA323–339 (OVA), PLP139–151 (PLP), HI574–586 (HI), HI574–586–P (HI–P), MHV3821–3832 (MHV), or MHV3821–3832+P (MHV+P) coupled to syngeneic, ECDI‐fixed splenocytes at 7 days pre and 3 days post immunization with PLP139–151. CD4+ T cell proliferative responses were measured in response to PLP139–151 rechallenge. *Values significantly reduced compared to control levels in OVA323–339‐tolerized or non‐tolerized mice, p <0.05. (B) In vivo DTH ear swelling assays on day 14 post priming to PLP139–151. Mice tolerized to PLP, HI or MHV+P exhibited reduced DTH responses in contrast to OVA323–339‐ or MHV3821–3832‐tolerized mice or non‐tolerized mice, *p <0.05.

WILEY‐VCH

Proline at p9 of the mimic MHV3821–3832 or HI574–586 peptides is critical for induction of cross‐reactivity to PLP139–151 as assessed by peripheral tolerance. (A) Separate groups of SJL mice were tolerized to OVA323–339 (OVA), PLP139–151 (PLP), HI574–586 (HI), HI574–586–P (HIP), MHV3821–3832 (MHV), or MHV3821–3832+P (MHV+P) coupled to syngeneic, ECDI‐fixed splenocytes at 7 days pre and 3 days post immunization with PLP139–151. CD4+ T cell proliferative responses were measured in response to PLP139–151 rechallenge. *Values significantly reduced compared to control levels in OVA323–339‐tolerized or non‐tolerized mice, p <0.05. (B) In vivo DTH ear swelling assays on day 14 post priming to PLP139–151. Mice tolerized to PLP, HI or MHV+P exhibited reduced DTH responses in contrast to OVA323–339‐ or MHV3821–3832‐tolerized mice or non‐tolerized mice, *p <0.05. WILEY‐VCH

Infection of mice with MHV30‐BeAn induces a flaccid paralytic disease

Although P at p9 of the MHV peptide is critical for the effective cross‐activation of PLP‐specific T cells, we previously demonstrated that a weak stimulation of PLP‐specific T cells by immunization with the mimic peptide in CFA could be enhanced by delivery of the mimic peptide encoded in an infectious virus 12, 13. Therefore, we tested whether intracerebral infection of mice with recombinant TMEV engineered to express the MHV 30‐mer peptide containing the putative PLP139–151 mimic peptide (MHV30‐BeAn) could induce activation of PLP139–151‐specific T cell responses and ultimately clinical disease. SJL mice infected with MHV30‐BeAn exhibited a mild disease with pronounced gait abnormality, similar in severity and early onset to mice infected with TMEV expressing the self PLP139–151 epitope (PLPBeAn) (Fig. 5A). This was in contrast to mice infected with TMEV expressing a non‐PLP mimic OVA peptide. In vitro rechallenge with PLP139–151 peptide demonstrated PLP139–151 reactive CD4+ T cells present at day 20 post infection in PLPBeAn‐ and MHV30‐BeAninfected mice as measured by IFN‐γ secretion (Fig. 5B), in contrast to mice infected with OVA‐BeAn. Furthermore, significant responses to MHV3821–3832 peptide rechallenge in vitro (IFN‐γ secretion; Fig. 5C) demonstrated that the MHV 30‐mer peptide is a likely natural epitope in SJL mice. Immunohistological analysis of the brain at day 40 post infection demonstrated modest numbers of CD4+ T cells around the hippocampus region of MHV30‐BeAninfected mice (Fig. 5D). In contrast, CD4+ T cells were rarely observed in the same region from OVA‐BeAninfected mice (Fig. 5E).
Figure 5

Infection of SJL mice with TMEV engineered to express MHV3813–3842 induces CNS autoimmune disease. (A) Separate groups of SJL mice were infected intracerebrally with 9 × 106 PFU PLP139‐BeAn (n = 5), OVA‐BeAn (n = 5) or MHV30‐BeAn (n = 8) and observed for 96 days. MHV30‐BeAn‐infected mice developed a mild form of flaccid paralytic disease similar in severity and early onset to mice infected with PLP‐BeAn. In contrast mice infected with OVA‐BeAn exhibited very mild disease with a much delayed onset. Splenic T cells from PLP‐BeAn‐ or MHV30‐BeAn‐infected mice demonstrated cross‐reactive PLP139–151 or MHV3821–3832 responses at days 20–22 post infection to in vitro rechallenge with 50 µM PLP139–151 or MHV3821–3832 peptide, as measured by IFN‐γ secretion (B, C), in contrast to OVA‐BeAn‐infected mice. Immunohistochemistry of the brain (hippocampus region) at day 40 post infection demonstrated the presence of CD4+ T cells in MHV30‐BeAn‐infected mice (arrows) compared to very few cells in OVA‐BeAn‐infected mice (D, E).

WILEY‐VCH

Infection of SJL mice with TMEV engineered to express MHV3813–3842 induces CNS autoimmune disease. (A) Separate groups of SJL mice were infected intracerebrally with 9 × 106 PFU PLP139‐BeAn (n = 5), OVA‐BeAn (n = 5) or MHV30‐BeAn (n = 8) and observed for 96 days. MHV30‐BeAninfected mice developed a mild form of flaccid paralytic disease similar in severity and early onset to mice infected with PLPBeAn. In contrast mice infected with OVA‐BeAn exhibited very mild disease with a much delayed onset. Splenic T cells from PLPBeAn‐ or MHV30‐BeAninfected mice demonstrated cross‐reactive PLP139–151 or MHV3821–3832 responses at days 20–22 post infection to in vitro rechallenge with 50 µM PLP139–151 or MHV3821–3832 peptide, as measured by IFN‐γ secretion (B, C), in contrast to OVA‐BeAninfected mice. Immunohistochemistry of the brain (hippocampus region) at day 40 post infection demonstrated the presence of CD4+ T cells in MHV30‐BeAninfected mice (arrows) compared to very few cells in OVA‐BeAninfected mice (D, E). WILEY‐VCH

Discussion

MHV is a single‐stranded RNA coronavirus. Multiple strains exist that can induce a variety of diseases including hepatitis and enteritis. Interestingly, infection of mice with the JHM strain can induce acute encephalitis and chronic demyelination of the CNS with some similarities to MS pathology 17. Although coronavirus infection of humans is usually associated with upper respiratory tract infections, coronavirus antigens have been identified in demyelinating plaques from the CNS of MS patients; however, it is not clear if these viruses have a role in MS pathology 18, 19. Recently, we demonstrated that infection of mice with a recombinant TMEV virus encoding a myelin mimic peptide from HI, HI574–586, but not priming with the core HI574–586 epitope in CFA, could induce a non‐classical form of CNS inflammatory autoimmune disease, by the cross‐activation of PLP139–151‐specific Th1 cells 12, 13. MHV3821–3832 is another potential PLP139–151 mimic peptide with 23% homology to the major encephalitogenic peptide in SJL mice, PLP139–151 15. Although the majority of the amino acid sequence is different between the natural PLP and viral MHV peptides, they share similar primary TCR (W at p5) and MHC class II (K at p4) contact residues. MHV3821–3832 is located in the ORF1a gene which codes for the replicative polyprotein PL1‐PRO (Papain‐like proteinases), a multifunctional protein involved in the transcription of negative‐stranded RNA, leader RNA, subgenomic mRNA and progeny virion RNA, as well as cleaving the polyprotein into functional products located at the N terminus of the replicase polyprotein. We and others have demonstrated that immunization of SJL mice with HI574–586 can induce expansion of PLP139–151‐specific T cells, although Th1 differentiation is minimal and mice do not exhibit clinical signs of CNS autoimmune disease even after multiple immunizations in CFA ± pertussis toxin and/or LPS as additional innate immune stimuli 12, 13, 15. It has been proposed that the sequence of mimic peptides need not be homologous to self peptides; rather, homology at the key structural TCR and MHC residues is important for mimicry. Our study of the properties of the MHV mimic peptide confirms that of Carrizosa et al. 15, as although immunization of SJL mice with the MHV mimic epitope induced a robust recall T cell response to MHV peptide, we observed only minor PLP139–151‐induced recall responses, particularly IFN‐γ production. Nevertheless, these data demonstrated the potential for cross‐activation of PLP139–151 T cells by the MHV peptide. In PLP139–151‐immunized mice, we also observed a trend towards cross‐reactivity following recall with the MHV mimic peptide. To further confirm these initial observations, we demonstrated that despite limited cross‐reactivity between the MHV and PLP peptides, MHV3821–3832 peptide‐coupled splenocyte tolerance of PLP139–151‐induced EAE was ineffective at inhibiting disease and T cell recall responses, in contrast to PLP139–151‐ or HI574–586‐induced tolerance. Previously, it was shown that the critical anchor residues in the I‐As ligand binding motif were p4, p7, and especially p9 16. It was postulated that the residue at p9 may be a critical susceptibility factor in I‐As‐associated autoimmune disease with regard to presentation of self peptides 16. To take this observation further and to attempt to understand the differences in PLP139–151‐specific T cell cross‐activating potential between the HI574–586 and MHV3821–3832 mimic peptides, we sought to determine the influence of the p9 MHC class II proline anchor residue in molecular mimicry between the “self” PLP139–151 epitope and foreign viral antigens. Secondly, we wanted to establish whether viral delivery of the MHV mimic peptide could overcome the threshold necessary for cross‐reactive activation of pathogenic, autoreactive PLP‐specific Th1 cells similar to what we had previously reported for disease induction by the HI574–586 mimic peptide. Both PLP139–151 and HI574–586 have a proline residue (P, aliphatic) at p9 in the MHC class II ligand motif, whereas MHV3821–3832 contains asparagine (N, amidic). Interestingly, substitution of the secondary MHC class II contact residue at p9 (N→P) conferred an ability on the MHV peptide to induce stronger cross‐reactive PLP139–151‐specific T cell responses, as measured by T cell proliferation or IFN‐γ ELISA assays. In contrast, substitution of P→N at p9 of the HI mimic peptide (HIP) abrogated the ability of that peptide to induce cross‐activation of PLP139–151‐specific T cells. In each case, mice made the most robust response to the immunizing peptide, as expected, but the gain or loss of proline at p9 either induced or negated the “mimic potential” of the peptide, respectively. Interestingly, mice immunized to MHV responded more strongly to recall with HIP than HI, probably as neither peptide contained P at p9. Conversely, only MHV+P and not MHV peptide recall challenge induced IFN‐γ production by T cells from HI574–586‐immunized mice, likely due to the presence of P at p9 in both peptides. Although mice responded with robust IFN‐γ responses to their initial immunizing peptide, only mice with a strong PLP139–151 response (i.e., PLP139–151‐immunized mice) exhibited clinical EAE. As the mimic peptide‐specific T cells were shown to be competent IFN‐γ producers this suggests that they do not recognize or are not sufficiently reactivated in vivo in the CNS by endogenously presented PLP peptides and therefore do not induce clinical EAE 20. Although immunization with the MHV+P peptide did not induce clinical disease, we further demonstrated its increased cross‐reactivity to PLP compared to MHV, by peptide‐coupled splenocyte tolerance studies. In contrast to MHV or HIP peptide‐coupled splenocytes which were not protective, MHV+P induced inhibition of PLP‐induced clinical disease and tolerance of PLP‐specific T cells similar to tolerance induced with HI or PLP. The cross‐reactive effect of MHV+P could also be measured by suppressed DTH and T cell proliferative responses to PLP rechallenge in MHV+P‐tolerized, PLP‐induced EAE mice. Although the presence of proline at the secondary MHC class II contact residue is a critical factor in MHV‐induced cross‐reactivity, it is insufficient to induce EAE upon priming of SJL mice with the peptide. Previously, we demonstrated the importance of studying PLP‐mimic peptides in the context of a concomitant infection 12, 13. Here, we corroborate this hypothesis as infection of mice with TMEV engineered to express the 30‐mer MHV peptide induces a chronic autoimmune disease characterized by atypical clinical symptoms, similar in severity and time course to disease initiated with PLP‐ or HI‐expressing TMEV 12, 13, 21. In contrast MHV/CFA‐immunized mice do not develop disease. This is likely due to the fact that MHV30‐BeAninfected mice develop a robust IFN‐γ‐secreting PLP139–151‐specific T cell population, unlike MHV/CFA‐immunized mice. It is likely that activation of peripheral and central immune cells by TMEV infection provides innate immune stimuli that can overcome the threshold for activation of PLP139–151‐specific T cells by the MHV peptide. Interestingly, Th1 recall responses, particularly IFN‐γ, to the self PLP139–151 epitope were significantly higher in MHV30‐BeAninfected mice than were responses to the MHV mimic peptide itself. This likely reflects prolonged restimulation of high‐avidity PLP139–151‐specific CD4+ T cells by self peptide endogenously released as a consequence of chronic myelin damage presented locally in the CNS by infiltrating dendritic cells 22, and the increased affinity of PLP139–151 (IC50 87 nM) for I‐As compared to MHV3821–3832 (IC50 727 nM) 15. We also observed modest numbers of CD4+ T cells in the brain of MHV30‐BeAn mice on day 40 post infection, in contrast to OVA‐BeAninfected mice, suggesting that the presence of MHV‐specific T cells correlates with the early onset of disease observed in MHV30‐BeAn mice. Furthermore, we demonstrate that the MHV mimic peptide is a natural epitope for the SJL mouse as infection with MHV30‐BeAn encoding the MHV 30‐mer mimic sequence could be processed and presented by APC as measured by in vivo DTH responses. In conclusion, this study demonstrates that the secondary MHC class II (I‐As) anchor residue at p9 plays a critical role in the ability of PLP139–151 mimic peptides to induce molecular mimicry leading to induction of CNS autoimmune disease and may be an important consideration when identifying candidate mimic peptides encoded by infectious pathogens. Our model of mimic peptide‐expressing TMEV allows us to test other potential infectious agent‐encoded PLP‐mimic peptides with reproducible immunological readouts. This study also highlights an important structural feature of candidate mimic peptides which may be relevant to the pathogenesis of MS and also the necessity of studying mimicry in an infectious setting.

Materials and methods

Mice

Female SJL mice at 5–6 wk of age were obtained from Harlan Sprague‐Dawley (Indianapolis, IN). Mice were housed under barrier conditions at the Northwestern University Medical School Center for Comparative Medicine. All protocols were approved by the Northwestern University Animal Care and Use Committee. Paralyzed mice were afforded easier access to food and water.

Production of MHV30‐BeAn

MHV30‐BeAn virus was produced as follows. Two 110‐bp oligonucleotides (Sigma‐Genosys, The Woodlands, TX) were annealed together to form double‐stranded DNA encoding a 30‐amino acid piece of MHV (TTMLSLATAKVIAKWLAVNVLYFTDVPQIK – encompassing the core 12‐amino acid CD4+ T cell epitope) with a Cla I restriction site on each end. To anneal, the oligonucleotides were resuspended in buffer (50 mM Tris‐HCl, 10 mM MgCl2,1 mM ATP, 10 mM dithiothreitol, 25 µg/mL BSA pH 7.5), heated to 95°C for 2 min, then ramp‐cooled to 25°C over a period of 45 min. Annealed DNA was then digested with Cla I and inserted into the ▵ClaI‐BeAn TMEV genome 21. Viral RNA was transfected into BHK‐21 cells in serum‐free DMEM medium to produce an infecting virus stock. Mice were infected by intracerebral injection with 9 × 106 PFU of virus and scored at weekly intervals on a clinical scale of 0–5: 0, no signs of disease; 1, mild gait abnormalities; 2, severe gait abnormalities; 3, paralysis in one limb; 4, more than one paralyzed limb; 5, moribund. The data are plotted as the mean clinical score for each group of animals.

Induction of active EAE

For actively induced R‐EAE, mice (n = 8–10) were immunized s.c. with 100 µL of an emulsion of CFA containing 400 µg Mycobacterium tuberculosis H37Ra (Difco, Detroit, MI) and 50 µg PLP139–151 distributed over three sites on the lateral and dorsal hind flanks. For HI574–586 or OVA323–339 peptide priming, the same protocol was used with 50 µg peptide per animal. Clinical scores were assessed on a 0–5 scale as follows: 1, lack of tail tone; 2, impaired righting reflex; 3, partial hind limb paralysis; 4, total hind limb paralysis; and 5, moribund.

Peptides

The following peptides were purchased from Peptides International (Louisville, KY): PLP130–159 30‐mer (QAHSLERVCHCLGKWLGHPDKFVGITYALT), PLP139–151 (HSLGKWLGHPDKF), HI574–586 (EQLVKWLGLPAPI), HIP (EQLVKWLGLNAPI), MHV3821–3832 (KVIAKWLAVNVL), MHV3813–3842 30‐mer (TMLSLATAKVIAKWLAVNVLYFTDVPQIKL), MHV+P (KVIAKWLAVPVL), and OVA323–339 (ISQAVHAAHAEINEAGR). The amino acid composition was verified by mass spectrometry, and purity was assessed by HPLC.

Delayed‐type hypersensitivity

DTH responses were elicited by injecting mice s.c. with 5–10 µg of the challenge peptides, PLP139–151 or MHV, into alternate ears following measurement of ear thickness using a Mitutoyo model 7326 engineer's micrometer (Schlesinger's Tools, Brooklyn, NY). At 24 h following peptide challenge, the ears were re‐measured and differences in ear swelling over pre‐challenge thickness were expressed in units of 10–4 inches ± SEM.

T cell proliferation and cytokine analysis

Spleens were removed from infected mice (n = 2) at various times following infection. T cell proliferation and cytokine analysis were performed as described 23. Proliferation was determined from triplicate wells for each peptide concentration and then expressed as counts per minute (CPM) or as CPM, background subtracted. For IFN‐γ cytokine analysis, a duplicate set of proliferation wells were used to collect supernatants at 48 and 72 h, and cytokine concentrations were determined by ELISA (Endogen Minikits, Woburn, MA) or by Luminex® 100 System (Upstate, VA, USA).

Induction of peripheral tolerance

Tolerance was induced by i.v. injection of 5 × 107 ethylene carbodiimide‐treated peptide‐pulsed syngeneic splenocytes, as described 23–25.

Immunohistochemistry

Immunohistochemistry was performed as described 13. Briefly, two mice per experimental group were anesthetized and perfused with 1 × PBS on day 40 post infection. Brains were immediately frozen in OCT (Miles Laboratories; Elkhart, IN) in liquid nitrogen. Cross‐sections (10 µm thick) from longitudinal sections of brain were sectioned. Nonspecific staining was blocked using anti‐CD16/CD32 antibody (FcγIII/IIR, 2.4G2; BD PharMingen) and an avidin/biotin blocking kit (Vector Laboratories). Tissues were stained with biotin‐conjugated antibody to mouse CD4 (BD PharMingen, San Diego, CA) and positive staining visualized by a Tyramide Signal Amplification (TSA) Direct kit (NEN, Boston, MA) according to the manufacturer's instructions. Sections were counterstained with 4′,6′‐diamidino‐2‐phenylindole (DAPI; Sigma‐Aldrich) and then coverslipped with Vectashield mounting medium (Vector Laboratories). Slides were examined and images were acquired via epifluorescence using the SPOT RT camera (Diagnostic Instruments, Sterling Heights, MI). Sections from each group were analyzed at 160 × magnification.

Statistics

Analysis of clinical severity was presented as the mean group clinical score, and the statistical difference was calculated by the Mann‐Whitney non‐parametric ranking test. Analysis of cytokine secretion, DTH and proliferation responses from multiple groups was performed by one‐way ANOVA.
  24 in total

1.  Ligand motif of the autoimmune disease-associated mouse MHC class II molecule H2-A(s).

Authors:  M Kalbus; B T Fleckenstein; M Offenhäusser; M Blüggel; A Melms; H E Meyer; H G Rammensee; R Martin; G Jung; N Sommer
Journal:  Eur J Immunol       Date:  2001-02       Impact factor: 5.532

2.  Epitope spreading initiates in the CNS in two mouse models of multiple sclerosis.

Authors:  Eileen J McMahon; Samantha L Bailey; Carol Vanderlugt Castenada; Hanspeter Waldner; Stephen D Miller
Journal:  Nat Med       Date:  2005-02-27       Impact factor: 53.440

3.  A virus-induced molecular mimicry model of multiple sclerosis.

Authors:  J K Olson; J L Croxford; M A Calenoff; M C Dal Canto; S D Miller
Journal:  J Clin Invest       Date:  2001-07       Impact factor: 14.808

Review 4.  T cell recognition of self and altered self antigens.

Authors:  L B Nicholson; V K Kuchroo
Journal:  Crit Rev Immunol       Date:  1997       Impact factor: 2.214

5.  De novo central nervous system processing of myelin antigen is required for the initiation of experimental autoimmune encephalomyelitis.

Authors:  Stephen Mark Tompkins; Josette Padilla; Mauro C Dal Canto; Jenny P-Y Ting; Luc Van Kaer; Stephen D Miller
Journal:  J Immunol       Date:  2002-04-15       Impact factor: 5.422

6.  Clinical viral infections and multiple sclerosis.

Authors:  W A Sibley; C R Bamford; K Clark
Journal:  Lancet       Date:  1985-06-08       Impact factor: 79.321

Review 7.  Epitope spreading and molecular mimicry as triggers of autoimmunity in the Theiler's virus-induced demyelinating disease model of multiple sclerosis.

Authors:  J Ludovic Croxford; Julie K Olson; Stephen D Miller
Journal:  Autoimmun Rev       Date:  2002-10       Impact factor: 9.754

8.  Cross-reactivity with myelin basic protein and human herpesvirus-6 in multiple sclerosis.

Authors:  Maria V Tejada-Simon; Ying C Q Zang; Jian Hong; Victor M Rivera; Jingwu Z Zhang
Journal:  Ann Neurol       Date:  2003-02       Impact factor: 10.422

9.  Expansion by self antigen is necessary for the induction of experimental autoimmune encephalomyelitis by T cells primed with a cross-reactive environmental antigen.

Authors:  A M Carrizosa; L B Nicholson; M Farzan; S Southwood; A Sette; R A Sobel; V K Kuchroo
Journal:  J Immunol       Date:  1998-10-01       Impact factor: 5.422

Review 10.  Mouse hepatitis virus.

Authors:  J Haring; S Perlman
Journal:  Curr Opin Microbiol       Date:  2001-08       Impact factor: 7.934

View more
  8 in total

1.  Viral infection triggers central nervous system autoimmunity via activation of CD8+ T cells expressing dual TCRs.

Authors:  Qingyong Ji; Antoine Perchellet; Joan M Goverman
Journal:  Nat Immunol       Date:  2010-06-06       Impact factor: 25.606

2.  Immunotherapeutic potential of the immunodominant T-cell epitope of lipocalin allergen Bos d 2 and its analogues.

Authors:  Soili A Saarelainen; Tuure T Kinnunen; Cécile Buhot; Ale T O Närvänen; Anu K Kauppinen; Marja A Rytkönen-Nissinen; Bernard Maillere; Tuomas I Virtanen
Journal:  Immunology       Date:  2007-10-16       Impact factor: 7.397

Review 3.  Antiviral immune responses: triggers of or triggered by autoimmunity?

Authors:  Christian Münz; Jan D Lünemann; Meghann Teague Getts; Stephen D Miller
Journal:  Nat Rev Immunol       Date:  2009-04       Impact factor: 53.106

Review 4.  Modeling multiple sclerosis in laboratory animals.

Authors:  Bettina Schreiner; Frank L Heppner; Burkhard Becher
Journal:  Semin Immunopathol       Date:  2009-10-03       Impact factor: 9.623

Review 5.  Virus infection, antiviral immunity, and autoimmunity.

Authors:  Daniel R Getts; Emily M L Chastain; Rachael L Terry; Stephen D Miller
Journal:  Immunol Rev       Date:  2013-09       Impact factor: 12.988

Review 6.  Molecular mimicry as an inducing trigger for CNS autoimmune demyelinating disease.

Authors:  Emily M L Chastain; Stephen D Miller
Journal:  Immunol Rev       Date:  2012-01       Impact factor: 12.988

Review 7.  Multiple sclerosis: experimental models and reality.

Authors:  Hans Lassmann; Monika Bradl
Journal:  Acta Neuropathol       Date:  2016-10-20       Impact factor: 17.088

8.  Development of a T Cell-Based COVID-19 Vaccine Using a Live Attenuated Influenza Vaccine Viral Vector.

Authors:  Irina Isakova-Sivak; Ekaterina Stepanova; Victoria Matyushenko; Sergei Niskanen; Daria Mezhenskaya; Ekaterina Bazhenova; Elena Krutikova; Tatiana Kotomina; Polina Prokopenko; Bogdan Neterebskii; Aleksandr Doronin; Elena Vinogradova; Kirill Yakovlev; Konstantin Sivak; Larisa Rudenko
Journal:  Vaccines (Basel)       Date:  2022-07-18
  8 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.