Literature DB >> 36173096

The Candida albicans virulence factor candidalysin polymerizes in solution to form membrane pores and damage epithelial cells.

Charles M Russell1, Katherine G Schaefer2, Andrew Dixson1, Amber L H Gray3, Robert J Pyron1, Daiane S Alves1, Nicholas Moore1, Elizabeth A Conley2, Ryan J Schuck1, Tommi A White4,5, Thanh D Do3, Gavin M King2,4, Francisco N Barrera1.   

Abstract

Candida albicans causes severe invasive candidiasis. C. albicans infection requires the virulence factor candidalysin (CL) which damages target cell membranes. However, the mechanism that CL uses to permeabilize membranes is unclear. We reveal that CL forms membrane pores using a unique mechanism. Unexpectedly, CL readily assembled into polymers in solution. We propose that the basic structural unit in polymer formation is a CL oligomer, which is sequentially added into a string configuration that can close into a loop. CL loops appear to spontaneously insert into the membrane to become pores. A CL mutation (G4W) inhibited the formation of polymers in solution and prevented pore formation in synthetic lipid systems. Epithelial cell studies showed that G4W CL failed to activate the danger response pathway, a hallmark of the pathogenic effect of CL. These results indicate that CL polymerization in solution is a necessary step for the damage of cellular membranes. Analysis of CL pores by atomic force microscopy revealed co-existence of simple depressions and more complex pores, which are likely formed by CL assembled in an alternate oligomer orientation. We propose that this structural rearrangement represents a maturation mechanism that stabilizes pore formation to achieve more robust cellular damage. To summarize, CL uses a previously unknown mechanism to damage membranes, whereby pre-assembly of CL loops in solution leads to formation of membrane pores. Our investigation not only unravels a new paradigm for the formation of membrane pores, but additionally identifies CL polymerization as a novel therapeutic target to treat candidiasis.
© 2022, Russell, Schaefer et al.

Entities:  

Keywords:  atomic force microscopy; mass photometry; molecular biophysics; native mass spectrometry; none; structural biology

Mesh:

Substances:

Year:  2022        PMID: 36173096      PMCID: PMC9522247          DOI: 10.7554/eLife.75490

Source DB:  PubMed          Journal:  Elife        ISSN: 2050-084X            Impact factor:   8.713


Introduction

Fungal infections are responsible for high morbidity burden around the world (Brown et al., 2012). Candida albicans is one of the most serious fungal threats to human health. This pathogen is part of the commensal flora, but can infect the skin, mouth, vagina, and gut, both in healthy and immunocompromised individuals. Additionally, C. albicans causes invasive candidiasis, an infection of the blood, heart, and other organs, which is common in hospitalized patients (Kullberg and Arendrup, 2015). Invasive candidiasis causes high rates of mortality (~50%), even when patients are treated with antifungal therapy (Kullberg and Arendrup, 2015). It has been recently discovered that C. albicans causes toxicity by secreting onto the surface of epithelial cells a peptide toxin named candidalysin (CL) (Moyes et al., 2016). This virulence factor binds to the plasma membrane of target human epithelial cells and compromises the permeability barrier, causing uncontrolled Ca2+ influx and release of cellular proteins on to the extracellular medium (Naglik et al., 2019). The resulting cellular damage activates a signaling cascade that triggers the release of pro-inflammatory mediators (Naglik et al., 2019; Richardson et al., 2018b), which participate in the immune response to C. albicans infection. Furthermore, CL plays a second pathogenic role, as it also attacks the membrane of mononuclear phagocytes which would otherwise fight the fungal infection (Kasper et al., 2018). CL is necessary for infection by C. albicans (Liu et al., 2021). Therefore, pharmacological inhibition of CL activity is a promising avenue to fight infection of this human pathogen. However, the development of drugs to counter the action of CL is hampered by the lack of understanding of how this peptide damages membranes. Here, we describe how the use of biophysical techniques (mass photometry, native mass spectrometry, analytical ultracentrifugation, transmission electron microscopy, atomic force microscopy, oriented circular dichroism, and liposome dye release assay), modeling, and cellular assays allowed us to elucidate that CL damages membranes by forming pores that are assembled through a unique molecular mechanism.

Results

CL assembles into polymers in solution

When we ran CL on an SDS-PAGE, we observed not only the expected monomeric band running at ~4 kDa, but also a band of slower electrophoretic mobility (Figure 1A). This result suggests that CL self-assembles in solution, and we hypothesized that this event might be related to its ability to damage cellular membranes. We therefore investigated CL oligomerization, first using native ion mobility-mass spectrometry (IM-MS), a sensitive analytical technique that can isolate and characterize transient oligomers based on their mass-to-charge ratio (m/z), shape, size, and charge. IM-MS analysis of CL revealed several oligomeric species (Figure 1B). The mass spectral peak at m/z 3311, which corresponds to a nominal oligomer-to-charge ratio (n/z) of 1/1, was notable due to its high intensity when compared to the surrounding oligomers. Analysis of the arrival time distributions (ATD) of this mass spectral peak (Figure 1C) revealed two features that correspond to higher-order CL oligomers. We conservatively assigned the longest arrival time feature (salmon) as an 8-mer with z = +8. This assignment was performed comparing the isotopic spacing and drift time of the features within the ATD with other mass spectral peaks (see Figure 1—figure supplement 1). Since a species with a high charge will travel faster than one with a lower charge, the fastest arrival time species (green) is proposed to be a large oligomer resulting from the self-assembly of the 8-mer. The ATD data therefore suggest that CL forms an 8-mer that self-assembles. Given that CL adopts helical structure in solution (Moyes et al., 2016), we built an atomistic model of the 8-mer by aligning CL’s sequence into the eight-helix coiled coil formed by CC-Type2-II (PDB ID 6G67). After the resulting structure was energy minimized (Figure 1—figure supplement 1), the theoretical collisional cross-section of the model, 2500 Å2, agreed with the experimental value of 2567 Å2.
Figure 1.

CL forms complex assemblies in solution.

(A) SDS-PAGE of CL shows a~4 kDa monomeric band, and a band corresponding to a large oligomer. Molecular weight markers are shown on the left. (B) IM-MS mass spectrum of CL annotated with oligomer-to-charge (n/z) ratios. The inset spectrum reveals oligomers that are not immediately identifiable in the top spectrum. (C) Arrival time distribution of the 8-mer (n/z=1/1) species. This peak was more populated than those corresponding to smaller oligomers, which might result from decomposition of the 8-mer in the gas phase. The experimental collisional cross section for the single 8-mer (highlighted in salmon) is given. (D) Analytical ultracentrifugation data identifies populations of increasingly larger CL oligomers. (E) Mass photometry data of CL oligomeric species. The green area marks the approximate mass range (<50 kDa) below the resolution of the technique. Data distribution was best fit with six Gaussian populations (shown as blue lines, and summary fit is the black line). The mass of the peaks agree with the expected mass for 2, 3, 4, 8, 13, and 22 CL 8-mers (similar to a Fibonacci sequence).

(A) The 2D-ion mobility plot and corresponding arrival time distribution of m/z 3311. It is unambiguous from the isotope spacings that the peaks represent multiple very high charge state species. Our instrument can routinely discern up to z = +6 within the ion mobility plot, but in this case, the spacing of the most abundant species is too small to be resolved. The trimer is largest species with a resolved isotopic spacing as shown in panel A. We conservatively assigned the feature next to the trimer as a tetramer. Note that the difference in arrival time of the features decrease from the dimer to the trimer (4ms), and the trimer to the tetramer (1.61ms). One would expect the arrival time difference between the tetramer and a pentamer to be smaller than 1.61ms, since the contribution of one monomeric unit decreases as the oligomeric assembly grows. However, the difference in arrival time of the tetramer to the most intense feature is 2.92ms, which allows us to deduce that this feature must be a large oligomer (n>5). (B) Mass spectral peak of m/z 3311. Spacing that roughly correlates to z = +8 are highlighted within the spectrum. This leads us to believe that the previously unknown feature (blue arrow) in panel A is that of an octamer with z = +8. (C) Comparison of arrival time distributions of higher-order Candidalysin oligomers. For m/z 3311, the collisional cross section for the feature highlighted in red is calculated under the assumption that this feature is an octamer. We note that the species at n/z=7/8 and 8/9 exhibit faster arrival times compared to the putative n/z=8/8. This follows the expectant logic since n/z=8/9 has a higher charge state than n/z=8/8, and thus traverses the drift cell faster. On the other hand, n/z=7/8 has the same charge state as n/z=8/8, but is a smaller oligomer, which results in a shorter arrival time. (D) Atomistic model of the CL 8-mer, with a molecular weight of 26.5 kDa. Each monomer helix is colored differently, and the C- and N-termini are marked.

(A) Gaussian fitting of the MP data of CL WT. The table shows the fitting parameters and the resulting errors. BIC (Bayesian information criterion) analysis was used to determine the optimal number of Gaussian terms for the fitting. (B) The relative mass of the six Gaussian components shows that the first peaks, corresponding to two, three, five and eight 8-mers, are the most abundant species, and are similarly populated.

Figure 1—figure supplement 1.

IM-MS results.

(A) The 2D-ion mobility plot and corresponding arrival time distribution of m/z 3311. It is unambiguous from the isotope spacings that the peaks represent multiple very high charge state species. Our instrument can routinely discern up to z = +6 within the ion mobility plot, but in this case, the spacing of the most abundant species is too small to be resolved. The trimer is largest species with a resolved isotopic spacing as shown in panel A. We conservatively assigned the feature next to the trimer as a tetramer. Note that the difference in arrival time of the features decrease from the dimer to the trimer (4ms), and the trimer to the tetramer (1.61ms). One would expect the arrival time difference between the tetramer and a pentamer to be smaller than 1.61ms, since the contribution of one monomeric unit decreases as the oligomeric assembly grows. However, the difference in arrival time of the tetramer to the most intense feature is 2.92ms, which allows us to deduce that this feature must be a large oligomer (n>5). (B) Mass spectral peak of m/z 3311. Spacing that roughly correlates to z = +8 are highlighted within the spectrum. This leads us to believe that the previously unknown feature (blue arrow) in panel A is that of an octamer with z = +8. (C) Comparison of arrival time distributions of higher-order Candidalysin oligomers. For m/z 3311, the collisional cross section for the feature highlighted in red is calculated under the assumption that this feature is an octamer. We note that the species at n/z=7/8 and 8/9 exhibit faster arrival times compared to the putative n/z=8/8. This follows the expectant logic since n/z=8/9 has a higher charge state than n/z=8/8, and thus traverses the drift cell faster. On the other hand, n/z=7/8 has the same charge state as n/z=8/8, but is a smaller oligomer, which results in a shorter arrival time. (D) Atomistic model of the CL 8-mer, with a molecular weight of 26.5 kDa. Each monomer helix is colored differently, and the C- and N-termini are marked.

CL forms complex assemblies in solution.

(A) SDS-PAGE of CL shows a~4 kDa monomeric band, and a band corresponding to a large oligomer. Molecular weight markers are shown on the left. (B) IM-MS mass spectrum of CL annotated with oligomer-to-charge (n/z) ratios. The inset spectrum reveals oligomers that are not immediately identifiable in the top spectrum. (C) Arrival time distribution of the 8-mer (n/z=1/1) species. This peak was more populated than those corresponding to smaller oligomers, which might result from decomposition of the 8-mer in the gas phase. The experimental collisional cross section for the single 8-mer (highlighted in salmon) is given. (D) Analytical ultracentrifugation data identifies populations of increasingly larger CL oligomers. (E) Mass photometry data of CL oligomeric species. The green area marks the approximate mass range (<50 kDa) below the resolution of the technique. Data distribution was best fit with six Gaussian populations (shown as blue lines, and summary fit is the black line). The mass of the peaks agree with the expected mass for 2, 3, 4, 8, 13, and 22 CL 8-mers (similar to a Fibonacci sequence).

IM-MS results.

(A) The 2D-ion mobility plot and corresponding arrival time distribution of m/z 3311. It is unambiguous from the isotope spacings that the peaks represent multiple very high charge state species. Our instrument can routinely discern up to z = +6 within the ion mobility plot, but in this case, the spacing of the most abundant species is too small to be resolved. The trimer is largest species with a resolved isotopic spacing as shown in panel A. We conservatively assigned the feature next to the trimer as a tetramer. Note that the difference in arrival time of the features decrease from the dimer to the trimer (4ms), and the trimer to the tetramer (1.61ms). One would expect the arrival time difference between the tetramer and a pentamer to be smaller than 1.61ms, since the contribution of one monomeric unit decreases as the oligomeric assembly grows. However, the difference in arrival time of the tetramer to the most intense feature is 2.92ms, which allows us to deduce that this feature must be a large oligomer (n>5). (B) Mass spectral peak of m/z 3311. Spacing that roughly correlates to z = +8 are highlighted within the spectrum. This leads us to believe that the previously unknown feature (blue arrow) in panel A is that of an octamer with z = +8. (C) Comparison of arrival time distributions of higher-order Candidalysin oligomers. For m/z 3311, the collisional cross section for the feature highlighted in red is calculated under the assumption that this feature is an octamer. We note that the species at n/z=7/8 and 8/9 exhibit faster arrival times compared to the putative n/z=8/8. This follows the expectant logic since n/z=8/9 has a higher charge state than n/z=8/8, and thus traverses the drift cell faster. On the other hand, n/z=7/8 has the same charge state as n/z=8/8, but is a smaller oligomer, which results in a shorter arrival time. (D) Atomistic model of the CL 8-mer, with a molecular weight of 26.5 kDa. Each monomer helix is colored differently, and the C- and N-termini are marked.

Deconvolution of MP data.

(A) Gaussian fitting of the MP data of CL WT. The table shows the fitting parameters and the resulting errors. BIC (Bayesian information criterion) analysis was used to determine the optimal number of Gaussian terms for the fitting. (B) The relative mass of the six Gaussian components shows that the first peaks, corresponding to two, three, five and eight 8-mers, are the most abundant species, and are similarly populated. We used two additional biophysical methods to confirm and further investigate CL oligomerization in solution. We first performed analytical ultracentrifugation of CL (Figure 1D). The sedimentation velocity results reveal a low sedimentation peak, likely corresponding to a CL monomer, and several larger assemblies, in agreement with the IM-MS data analysis. We next used mass photometry (MP), a technique that allows mass determination of biomolecules with single-molecule resolution from their combined light scattering and reflection signature (Asor and Kukura, 2022). While MP is insensitive to the mass of an CL 8-mer (26.5 kDa), as the resolution of the instrument is limited to particles >50 kDa, MP has high sensitivity to larger species. Figure 1E displays MP data of CL, consisting of a main peak and a long tail. The main peak agrees with the mass of two bound 8-mers, while the larger mass peaks would correspond to the progressive assembly of 8-mers (see Figure 1—figure supplement 2). The long tail of the MP data reaches beyond 600 kDa, which would correspond to the assembly of tens of 8-mers. Taken together, the four techniques reveal that CL readily forms large oligomers in solution and suggest that the 8-mer is the seed for CL self-assembly into large structures.
Figure 1—figure supplement 2.

Deconvolution of MP data.

(A) Gaussian fitting of the MP data of CL WT. The table shows the fitting parameters and the resulting errors. BIC (Bayesian information criterion) analysis was used to determine the optimal number of Gaussian terms for the fitting. (B) The relative mass of the six Gaussian components shows that the first peaks, corresponding to two, three, five and eight 8-mers, are the most abundant species, and are similarly populated.

We employed microscopy to resolve the assemblies that CL forms in solution. We first performed negative-stain transmission electron microscopy (TEM), and observed that CL does not form amorphous aggregates, but instead assembles into linear structures (Figure 2A). The TEM data revealed a basic structural unit, which seemed to grow in a step-wise fashion into polymers (Figure 2A, side panels). The longer polymers curved, and in some cases closed in on themselves, forming a loop with diameter ≥10 nm. We further studied CL polymerization by atomic force microscopy (AFM) since this technique provides high resolution images of single particles and can also be readily used to image membrane pores (Dufrêne et al., 2017). AFM images of CL adsorbed onto mica in buffer (Figure 2B) agreed with the TEM results and confirmed that CL polymerizes and can form loops. The bending stiffness of CL polymers was calculated from AFM images through persistence length, Lp, analysis (Lp = 9 nm±2 nm, N=100, Figure 2—figure supplement 1). The bending stiffness of linear CL polymers is significantly lower than other biological polymers, like actin fibers (Gittes et al., 1993), explaining the ability of CL polymers to close into loops.
Figure 2.

CL in solution forms progressively longer linear polymers and loops.

(A) TEM reveals CL polymerization; scale bar = 100 nm. Features of growing complexity are magnified in the side panels; scale bar = 10 nm. (B) AFM imaging in fluid shows overall agreement with TEM data; scale bar = 100 nm. Four similar CL features are also highlighted in the side panels; scale bar = 10 nm. (C) Smoothed volume histogram of N=7838 individual features (solid black line) fitted with Gaussian distributions (solid colored lines, summary fit is the gray dashed line). The inset compares the experimental volume of the first four peaks (squares colored as in panel C) with simulated volumes (black diamonds) calculated from N 8-mers. The cartoon shows an example of head-to-toe assembly of two 8-mers. Error bars for the peak positions represent the standard deviation. (D) When the height of the individual features was measured, it yielded a bimodal distribution, with heights of 3.2 nm and 4.6 nm. The insets show the two proposed orientations of the 8-mer. The topographic surface is overlaid to show convolution of the AFM tip.

(A) AFM images of CL in solution yield a persistence length, Lp, of 9±2 nm. The value was calculated from a fit (solid line, coefficient of determination = 0.87) to the mean square end-to-end distance of N=100 polymers. (B) An identical value of Lp (within uncertainty of the analysis) was obtained by calculating the decay of tangent-tangent correlations. I9A in solution yielded a persistence length, Lp, of 13±2 nm. The value was calculated from the exponential decay (solid line) of tangent-tangent correlations of N=100 polymers. Inset: The angle q is defined by polymer segments separated by a distance l along the contour of the polypeptide.

AFM volume analysis indicates that the subunit observed to consitute the polymer seed is significantly larger than a peptide monomer. Based on comparison between simulated and experimental data, the primary subunit volume peak is at least a pentamer, but probably larger due to tip deconvolution.

Comparison of N 8-mer subunits in the side orientation arranged either linearly or with an added curvature (Scale bar = 15 nm). Volumes are plotted for each particle showing larger volumes for curved polymers. Error bars for the peak positions represent the standard deviation.

Figure 2—figure supplement 1.

Persistence length of CL polymers.

(A) AFM images of CL in solution yield a persistence length, Lp, of 9±2 nm. The value was calculated from a fit (solid line, coefficient of determination = 0.87) to the mean square end-to-end distance of N=100 polymers. (B) An identical value of Lp (within uncertainty of the analysis) was obtained by calculating the decay of tangent-tangent correlations. I9A in solution yielded a persistence length, Lp, of 13±2 nm. The value was calculated from the exponential decay (solid line) of tangent-tangent correlations of N=100 polymers. Inset: The angle q is defined by polymer segments separated by a distance l along the contour of the polypeptide.

CL in solution forms progressively longer linear polymers and loops.

(A) TEM reveals CL polymerization; scale bar = 100 nm. Features of growing complexity are magnified in the side panels; scale bar = 10 nm. (B) AFM imaging in fluid shows overall agreement with TEM data; scale bar = 100 nm. Four similar CL features are also highlighted in the side panels; scale bar = 10 nm. (C) Smoothed volume histogram of N=7838 individual features (solid black line) fitted with Gaussian distributions (solid colored lines, summary fit is the gray dashed line). The inset compares the experimental volume of the first four peaks (squares colored as in panel C) with simulated volumes (black diamonds) calculated from N 8-mers. The cartoon shows an example of head-to-toe assembly of two 8-mers. Error bars for the peak positions represent the standard deviation. (D) When the height of the individual features was measured, it yielded a bimodal distribution, with heights of 3.2 nm and 4.6 nm. The insets show the two proposed orientations of the 8-mer. The topographic surface is overlaid to show convolution of the AFM tip.

Persistence length of CL polymers.

(A) AFM images of CL in solution yield a persistence length, Lp, of 9±2 nm. The value was calculated from a fit (solid line, coefficient of determination = 0.87) to the mean square end-to-end distance of N=100 polymers. (B) An identical value of Lp (within uncertainty of the analysis) was obtained by calculating the decay of tangent-tangent correlations. I9A in solution yielded a persistence length, Lp, of 13±2 nm. The value was calculated from the exponential decay (solid line) of tangent-tangent correlations of N=100 polymers. Inset: The angle q is defined by polymer segments separated by a distance l along the contour of the polypeptide.

Simulated monomer versus experimental subunit.

AFM volume analysis indicates that the subunit observed to consitute the polymer seed is significantly larger than a peptide monomer. Based on comparison between simulated and experimental data, the primary subunit volume peak is at least a pentamer, but probably larger due to tip deconvolution.

Simulated CL polymer volumes are comparable to experimental volumes.

Comparison of N 8-mer subunits in the side orientation arranged either linearly or with an added curvature (Scale bar = 15 nm). Volumes are plotted for each particle showing larger volumes for curved polymers. Error bars for the peak positions represent the standard deviation. Examination of AFM images containing thousands of particles yielded a volume distribution with a sharp peak and a long tail (Figure 2C), which resembles the distribution observed in the MP data (Figure 1E). Such agreement suggests that the AFM results are robust and are not caused by spurious interactions with the AFM tip. The AFM volume histogram was deconvolved by fitting Gaussian distributions, revealing a primary peak and several larger sub-populations of larger volumes (Figure 2C). The volume increased in approximately constant steps between the populations (see side panels of Figure 2B), confirming that a basic intermediate oligomer grew first by dimerization, followed by sequential addition to further increase linear polymer length. We measured the height of the individual particles observed by AFM, and the resulting histogram (Figure 2D) yielded two peaks, with heights of 3.2±0.4 nm and 4.6±0.5 nm. We reasoned that the bimodal height distribution could indicate two orientations (vertical and horizontal) of the basic structural unit that serves as an intermediate oligomer (Figure 2B inset, labeled ‘1’), which is probably the CL 8-mer identified by IM-MS (Figure 1B, Figure 2—figure supplement 2). We tested this possibility by using the CL 8-mer model (Figure 1—figure supplement 1) to generate simulated AFM images through morphological dilation of the estimated tip geometry for the 8-mer, either on its horizontal or vertical orientations (Figure 2D, insets). We found good agreement between the simulation [heights of 3.3 nm and 4.8 nm] and the two experimental peaks shown in Figure 2D. Interestingly, the volume of the modeled 8-mer in the horizontal orientation additionally agrees within uncertainty with the value of the basic AFM structural unit (Figure 2C inset). Taken together, these results support the notion that CL assembles into an 8-mer in solution that acts as an intermediate step in the self-assembly process.
Figure 2—figure supplement 2.

Simulated monomer versus experimental subunit.

AFM volume analysis indicates that the subunit observed to consitute the polymer seed is significantly larger than a peptide monomer. Based on comparison between simulated and experimental data, the primary subunit volume peak is at least a pentamer, but probably larger due to tip deconvolution.

Polymer growth of CL 8-mers in the horizontal orientation (lying flat on a surface) can occur by addition of a second 8-mer in two fundamental modes, side-by-side or head-to-toe. When we modeled the latter arrangement for the assembly of two, three, and four head-to-toe 8-mers (Figure 2C, inset), we found agreement between the simulated and experimental AFM volumes (Figure 2C, inset; Figure 2—figure supplement 3). Taken together, the data indicate that a CL polymer is formed when a basic subunit, which our results suggest is an 8-mer, is aligned in the longest dimension, and grows by sequential head-to-toe addition of additional subunits.
Figure 2—figure supplement 3.

Simulated CL polymer volumes are comparable to experimental volumes.

Comparison of N 8-mer subunits in the side orientation arranged either linearly or with an added curvature (Scale bar = 15 nm). Volumes are plotted for each particle showing larger volumes for curved polymers. Error bars for the peak positions represent the standard deviation.

CL forms two classes of membrane pores

CL mediates C. albicans infection by damaging the integrity of the plasma membrane of human cells (Moyes et al., 2016). It has been proposed that CL forms membrane pores (Moyes et al., 2016), but such structures have never been observed. We performed AFM imaging on supported lipid bilayers made of DOPC (1,2-dioleoyl-sn-glycero-3-phosphocholine) to gain insights into how CL causes membrane disruption. We observed that in the presence of CL, bilayers indeed exhibited punctate depressions commonly associated with pores (Figure 3A). Though the AFM tip is sharp (nominal radius ~8 nm), the pores’ radii were often smaller than the tip, preventing passage all the way through the 4-nm-thick membrane, which cause artificially shallow readings (Pittman et al., 2018; Schaefer et al., 2022; Figure 3—figure supplement 1).
Figure 3.

CL forms two types of membrane pores.

Representative images showing predominantly unrimmed (A) and rimmed (B) pore features in supported DOPC membranes; scale bars = 100 nm. The insets show zoomed views of green boxed features; scale bars = 10 nm. (C) Area histograms show that unrimmed pores (gray line) display a broad peak at 41±25 nm2 (mean ± S.D.) with a shoulder at ~130 nm2, similar to loops found in solution (38±21 nm2, aqua blue line). In contrast, the rimmed pores (black line) exhibit a narrower distribution with a smaller area (26±19 nm2) (Nunrimmed pores = 1468, Nrimmed pores = 492, Nloops = 261). (D) Unrimmed (top) and rimmed (bottom) features were imaged over several minutes; scale bars = 10 nm. (E) Line scans, marked as white lines in the previous panel, show the dynamics of the pore profile in both cases. Different colors were used for each image. The average depth (Avg) and relative deviation (Dev), defined as the standard deviation of the depth divided by Avg, are listed.

(A) Inset shows the height distribution of all pixels for N=313 unrimmed pores (gray, n=153,832 pixels) and N=193 rimmed pores (black, n=114,996 pixels). Zero height represents the top of the upper leaflet of the lipid bilayer. The main graph is rescaled to show the area encompassed by the dark green dashed line. Multiple Gaussians are fitted to the histograms to deconvolve the different populations. Both unrimmed and rimmed pores had populations that deviated from the background (~0 nm), which are plotted in addition to the summary fits. The unrimmed pores show two distinct depths, –0.7±0.5 nm and –0.3±0.2 nm (mean ± σ.) The rimmed pores have a single population lower than the background, located at –1.0±0.4 nm. Additionally, a positive population is located at +0.3 ± 0.4 nm, corresponding to the topographically high rims. (B) A line scan (white dashed line) across an image of rimmed pores demonstrates the 4 nm depth of the DOPC bilayer in profile; scale bar = 100 nm.

(A) Lateral diffusion of an unrimmed pore (arrows). (B) A void forms two pores. The arrows highlight positive features; scale bars = 20 nm.

Both unrimmed and rimmed pore species present in the same image; scale bar = 100 nm. Two pores of similar size are shown in line scan profile (unrimmed in blue, rimmed in green).

Figure 3—figure supplement 1.

Quantification of pore depth.

(A) Inset shows the height distribution of all pixels for N=313 unrimmed pores (gray, n=153,832 pixels) and N=193 rimmed pores (black, n=114,996 pixels). Zero height represents the top of the upper leaflet of the lipid bilayer. The main graph is rescaled to show the area encompassed by the dark green dashed line. Multiple Gaussians are fitted to the histograms to deconvolve the different populations. Both unrimmed and rimmed pores had populations that deviated from the background (~0 nm), which are plotted in addition to the summary fits. The unrimmed pores show two distinct depths, –0.7±0.5 nm and –0.3±0.2 nm (mean ± σ.) The rimmed pores have a single population lower than the background, located at –1.0±0.4 nm. Additionally, a positive population is located at +0.3 ± 0.4 nm, corresponding to the topographically high rims. (B) A line scan (white dashed line) across an image of rimmed pores demonstrates the 4 nm depth of the DOPC bilayer in profile; scale bar = 100 nm.

CL forms two types of membrane pores.

Representative images showing predominantly unrimmed (A) and rimmed (B) pore features in supported DOPC membranes; scale bars = 100 nm. The insets show zoomed views of green boxed features; scale bars = 10 nm. (C) Area histograms show that unrimmed pores (gray line) display a broad peak at 41±25 nm2 (mean ± S.D.) with a shoulder at ~130 nm2, similar to loops found in solution (38±21 nm2, aqua blue line). In contrast, the rimmed pores (black line) exhibit a narrower distribution with a smaller area (26±19 nm2) (Nunrimmed pores = 1468, Nrimmed pores = 492, Nloops = 261). (D) Unrimmed (top) and rimmed (bottom) features were imaged over several minutes; scale bars = 10 nm. (E) Line scans, marked as white lines in the previous panel, show the dynamics of the pore profile in both cases. Different colors were used for each image. The average depth (Avg) and relative deviation (Dev), defined as the standard deviation of the depth divided by Avg, are listed.

Quantification of pore depth.

(A) Inset shows the height distribution of all pixels for N=313 unrimmed pores (gray, n=153,832 pixels) and N=193 rimmed pores (black, n=114,996 pixels). Zero height represents the top of the upper leaflet of the lipid bilayer. The main graph is rescaled to show the area encompassed by the dark green dashed line. Multiple Gaussians are fitted to the histograms to deconvolve the different populations. Both unrimmed and rimmed pores had populations that deviated from the background (~0 nm), which are plotted in addition to the summary fits. The unrimmed pores show two distinct depths, –0.7±0.5 nm and –0.3±0.2 nm (mean ± σ.) The rimmed pores have a single population lower than the background, located at –1.0±0.4 nm. Additionally, a positive population is located at +0.3 ± 0.4 nm, corresponding to the topographically high rims. (B) A line scan (white dashed line) across an image of rimmed pores demonstrates the 4 nm depth of the DOPC bilayer in profile; scale bar = 100 nm.

CL pores exhibit lateral dynamics in the AFM supported membrane.

(A) Lateral diffusion of an unrimmed pore (arrows). (B) A void forms two pores. The arrows highlight positive features; scale bars = 20 nm.

Unrimmed and rimmed pores locally coexist in the membrane.

Both unrimmed and rimmed pore species present in the same image; scale bar = 100 nm. Two pores of similar size are shown in line scan profile (unrimmed in blue, rimmed in green). The CL pores fell into two broad categories: simple depressions (Figure 3A), and complex pores surrounded by a rim of discrete protrusions of an approximate height of 0.3 nm above the bilayer surface (Figure 3B). To differentiate between the two types of pores, they are henceforth referred to as ‘unrimmed’ (Figure 3A) and ‘rimmed’ (Figure 3B) pores, respectively. Both types of pores were free to diffuse in the bilayer (Figure 3—figure supplement 2), indicating that CL is not immobilized by interactions with the mica surface. Occasionally rimmed and unrimmed pores were observed in the same image area (Figure 3—figure supplement 3), suggesting that variations in imaging conditions were not responsible for driving the system between rimmed and unrimmed states. Rimmed pores generally have a smaller area than unrimmed pores (Figure 3C). Unrimmed pores have a broad area distribution, with the main population at 41 nm2 (Figure 3C, gray), while the rimmed pores have a narrower distribution, and an area peak at 26 nm2 (Figure 3C, black). Selected areas of the samples were imaged repeatedly to produce a time series of both unrimmed and rimmed pores. A representative unrimmed pore (Figure 3D, top row) shows dynamic behavior, with large variations over time. The pore depth visibly varies, flickering between deep and shallow states. On the other hand, the rimmed pore (Figure 3D, bottom row) appears deeper, and is more stable, as shown by the constant profile over time (Figure 3E). While the two types of pores are likely to cause membrane permeabilization, we propose that the presence of the rim endows the pore with increased stability, which could potentially be a mechanism to afford CL pores with enhanced membrane damaging capabilities.
Figure 3—figure supplement 2.

CL pores exhibit lateral dynamics in the AFM supported membrane.

(A) Lateral diffusion of an unrimmed pore (arrows). (B) A void forms two pores. The arrows highlight positive features; scale bars = 20 nm.

Figure 3—figure supplement 3.

Unrimmed and rimmed pores locally coexist in the membrane.

Both unrimmed and rimmed pore species present in the same image; scale bar = 100 nm. Two pores of similar size are shown in line scan profile (unrimmed in blue, rimmed in green).

CL polymers insert into the membrane, and loops become membrane pores

We noticed that there were strong similarities between the shape and size of the loops that CL forms in the absence of membrane and the unrimmed membrane pores (Figure 3C, compare blue and gray lines). This agreement led us to hypothesize that CL loops could insert into membranes and become unrimmed pores. We could test this hypothesis as occasionally a patch of supported bilayer would spontaneously dissociate from the underlying mica surface (Figure 4A). Upon imaging the exact same area again, we observed features similar to the CL polymers and loops detected in the absence of lipid bilayers. Indeed, loops, often inter-connected, were observed where pores were previously present (see blue arrows). Linear features similar to the CL polymers observed for solution samples were also present, which had been previously obscured by the presence of a bilayer. This observation indicates that linear polymers can insert into membranes without causing membrane disruption, but when they close into a loop they form an unrimmed membrane pore.
Figure 4.

CL polymers and loops insert into membranes.

(A) Lipid patches exhibiting pore-like features occasionally dissociated from the mica surface, revealing underlying structures similar to CL polymers in solution [see Figure 2B]; scale bars = 200 nm. Blue arrows indicate pore features and corresponding polymer loops/tangles. Linear features were revealed that were not previously observed when lipid was present (red arrows). A green asterisk draws attention to a tall positive feature that remains in both images, serving as a reference. (B) Detergent was used to forcibly remove lipid bilayers. The addition of DβM followed by rinsing revealed underlying CL structures. Scale bars = 100 nm. (C) A histogram of particle heights compares data of CL adsorbed in solution (black, N=7838) to the features remaining after addition of DβM to the CL +DOPC system (gold, N=8170). The control results were bimodal, indicating two overall 8-mer orientations. The features left after detergent removal of the membrane exhibited a broad peak roughly encapsulating both of the solution peaks.

(A) Adding DβM to CL in solution (i.e. in the absence of lipid) induces no drastic change in CL polymers, which remain adhered to the mica surface (scale bars = 100 nm). (B) DβM added to bare DOPC bilayers removes the bilayer with a small amount of residual lipid left behind on the mica surface. (C) A volume histogram of CL after DβM addition (gray) shows a slight increase in size of the features compared to the CL in solution data (black), likely attributable to occasional detergent molecules binding to CL. The fraction of looped features before and after the addition of DβM are shown in the table on the right (σ=standard deviation, 3 experiments).

CL polymers and loops insert into membranes.

(A) Lipid patches exhibiting pore-like features occasionally dissociated from the mica surface, revealing underlying structures similar to CL polymers in solution [see Figure 2B]; scale bars = 200 nm. Blue arrows indicate pore features and corresponding polymer loops/tangles. Linear features were revealed that were not previously observed when lipid was present (red arrows). A green asterisk draws attention to a tall positive feature that remains in both images, serving as a reference. (B) Detergent was used to forcibly remove lipid bilayers. The addition of DβM followed by rinsing revealed underlying CL structures. Scale bars = 100 nm. (C) A histogram of particle heights compares data of CL adsorbed in solution (black, N=7838) to the features remaining after addition of DβM to the CL +DOPC system (gold, N=8170). The control results were bimodal, indicating two overall 8-mer orientations. The features left after detergent removal of the membrane exhibited a broad peak roughly encapsulating both of the solution peaks.

Detergent effect on bare lipid and CL on a surface.

(A) Adding DβM to CL in solution (i.e. in the absence of lipid) induces no drastic change in CL polymers, which remain adhered to the mica surface (scale bars = 100 nm). (B) DβM added to bare DOPC bilayers removes the bilayer with a small amount of residual lipid left behind on the mica surface. (C) A volume histogram of CL after DβM addition (gray) shows a slight increase in size of the features compared to the CL in solution data (black), likely attributable to occasional detergent molecules binding to CL. The fraction of looped features before and after the addition of DβM are shown in the table on the right (σ=standard deviation, 3 experiments). In order to replicate these spontaneous events in a deterministic manner, we used the mild detergent dodecyl beta-D-maltoside (DβM) to remove the lipid bilayer (Milhiet et al., 2006; Rinia et al., 2001). Once the detergent and solubilized lipid were rinsed away, the CL structures remaining were imaged (Figure 4B). Control experiments showed that DβM efficiently removed DOPC molecules from the mica support, but did not dissociate the CL polymers (Figure 4—figure supplement 1); however, our data suggest that detergent treatment might reduce the fraction of polymers that close into a loop (Figure 4—figure supplement 1). The histogram in Figure 4C reveals similarities between the height of CL features adsorbed to mica in solution, showing a bimodal population, and in membrane areas post-DβM treatment. In these latter samples, there was a broadening of the primary height peak, which can be attributed to binding between CL and the detergent. However, the increase in taller features could also be an indication that the vertical 8-mer orientation (Figure 2D) is favored in the presence of lipid membranes.
Figure 4—figure supplement 1.

Detergent effect on bare lipid and CL on a surface.

(A) Adding DβM to CL in solution (i.e. in the absence of lipid) induces no drastic change in CL polymers, which remain adhered to the mica surface (scale bars = 100 nm). (B) DβM added to bare DOPC bilayers removes the bilayer with a small amount of residual lipid left behind on the mica surface. (C) A volume histogram of CL after DβM addition (gray) shows a slight increase in size of the features compared to the CL in solution data (black), likely attributable to occasional detergent molecules binding to CL. The fraction of looped features before and after the addition of DβM are shown in the table on the right (σ=standard deviation, 3 experiments).

Our data indicate that loops can insert into membranes and form unrimmed pores. These might later mature into the rimmed pores, which have better defined dimensions. The question then arises regarding what orientation, head-to-toe or side-by-side, does the CL 8-mer adopt in the two types of pores. To investigate this question, we modeled loops of N subunits in the two 8-mer orientations, head-to-toe and side-by-side (Figure 5A). Comparison between the experimental inner areas and the models (Figure 5A, Figure 5—figure supplement 1) suggest that the loops found in solution, similar to the linear polymers, assemble into a head-to-toe fashion. The average loop would be composed of six head-to-toe 8-mers, for a mass (159 kDa) that corresponds with the start of the tail in the MP distribution (Figure 1E).
Figure 5.

Rimmed pores appear upon a conformational rearrangement.

(A) CL pores were simulated using two possible arrangements of the 8-mer subunit, side-by-side (green) and head-to-toe (dark blue). The particle area is plotted versus the number of subunits. The insets show simulations for N=6 in both orientations. Closed loops with less subunits were not geometrically feasible. The side panel shows the experimental areas for unrimmed pores (gray symbol), rimmed pores (black), and the loops found in solution (aqua blue); error bars represent standard deviation. A cartoon depicts which measurements are being compared, the inner loop area (top) and the pore area (bottom). (B) Standard circular dichroism (CD) of CL in buffer (blue) and in the presence of lipid vesicles (black). (C) OCD data in supported membranes for CL WT (black), I9A (green), and G4W (red). The inset shows theoretical OCD curves for a TM helix (blue) or an α-helix aligned parallel to the membrane plane (red).

(A) Simulated images of loops formed by six 8-mers are shown side-by-side with experimental data compatible for the two orientations. The upper panel compares a head-to-toe simulation with a solution loop, and the lower panel shows the vertical model compared to a CL pore after lipid spontaneously dissociated; scale bars = 10 nm. (B) Line scans through the feature demonstrate geometric agreement between models (black lines) and experimental data (red lines).

Figure 5—figure supplement 1.

Direct comparison of simulated loops with AFM data.

(A) Simulated images of loops formed by six 8-mers are shown side-by-side with experimental data compatible for the two orientations. The upper panel compares a head-to-toe simulation with a solution loop, and the lower panel shows the vertical model compared to a CL pore after lipid spontaneously dissociated; scale bars = 10 nm. (B) Line scans through the feature demonstrate geometric agreement between models (black lines) and experimental data (red lines).

Rimmed pores appear upon a conformational rearrangement.

(A) CL pores were simulated using two possible arrangements of the 8-mer subunit, side-by-side (green) and head-to-toe (dark blue). The particle area is plotted versus the number of subunits. The insets show simulations for N=6 in both orientations. Closed loops with less subunits were not geometrically feasible. The side panel shows the experimental areas for unrimmed pores (gray symbol), rimmed pores (black), and the loops found in solution (aqua blue); error bars represent standard deviation. A cartoon depicts which measurements are being compared, the inner loop area (top) and the pore area (bottom). (B) Standard circular dichroism (CD) of CL in buffer (blue) and in the presence of lipid vesicles (black). (C) OCD data in supported membranes for CL WT (black), I9A (green), and G4W (red). The inset shows theoretical OCD curves for a TM helix (blue) or an α-helix aligned parallel to the membrane plane (red).

Direct comparison of simulated loops with AFM data.

(A) Simulated images of loops formed by six 8-mers are shown side-by-side with experimental data compatible for the two orientations. The upper panel compares a head-to-toe simulation with a solution loop, and the lower panel shows the vertical model compared to a CL pore after lipid spontaneously dissociated; scale bars = 10 nm. (B) Line scans through the feature demonstrate geometric agreement between models (black lines) and experimental data (red lines). We further studied CL morphology after membrane insertion by analyzing the features that remained after spontaneous lipid dissociation (Figure 4A). For unrimmed pores, the AFM data also corresponded to a head-to-toe 8-mer arrangement (Figure 5A). Loops with a side-by-side orientation were rare in the solution data, but were common in CL samples that had been exposed to lipid. Indeed, comparison between the model and the rimmed pores data suggest that in these pores the 8-mers switch from the head-to-toe orientation found in the unrimmed pores (gray square, side panel of Figure 5A), to a side-by-side orientation (black square). Specifically, the modeled areas predict that unrimmed pores contain six to eight head-to-toe 8-mers, while rimmed pores are formed by six to twelve side-to-side 8-mers. Therefore, we propose that a rimmed pore (Figure 3B) appears when the 8-mer subunits in an unrimmed pore rotate 90 degrees, switching from the head-to-toe to the side-by-side arrangement (compare insets in Figure 5A). We interrogated the results of the modeling using circular dichroism (CD). Figure 5B shows that CL forms, as expected (Moyes et al., 2016), an α-helical structure in solution, as evidenced by the spectral minima at 208 and 222 nm. We also observed that the presence of lipid vesicles promotes modest additional helix formation, possibly by growth of the α-helix and its ends. The orientation of the CL α-helix with respect to the membrane plane can be determined using oriented CD (OCD), which is performed using supported lipid membranes (Nguyen et al., 2019). OCD can discriminate between helices aligned along the membrane plane, and transmembrane (TM) helices (Wu et al., 1990; Figure 5C, inset). The OCD data of CL displayed low intensity, and a minimum at ~225 nm and a maximum at ~195 nm, similarly to the expected result for TM helices (Alves et al., 2018; Stefanski et al., 2021). The OCD spectrum therefore indicates that the predominant orientation of helices in CL in membranes was inserted across the membrane, in a TM orientation. This is the proposed helical alignment that is expected in the side-by-side 8-mer arrangement of the rimmed pores. However, the presence of a depression at ~210 nm agrees with the presence of a population of α-helices oriented along the plane of the membrane, like those expected for the unrimmed pore. Therefore, the OCD result supports the presence of a combination of rimmed and unrimmed CL pores with the respective helical orientations predicted by the AFM modeling.

Mutational analysis of CL provides mechanistic insights

Our experimental data and modeling indicate that CL 8-mers in solution polymerize in a head-to-toe fashion. We sought to further validate this hypothesis by testing mutations in the CL sequence. A head-to-toe assembly of a parallel helical bundle implies interaction between the N-terminal (Nt) helical ends of an 8-mer with the C-termini of the adjacent subunit (Figure 6—figure supplement 1). Our 8-mer model predicts that the Nt is slightly kinked at residue G4 (Figure 6A). Since glycine residues confer flexibility to α-helices (Choy et al., 2003), we reasoned that the mutation of residue G4 (Figure 6A) might affect CL self-assembly. We replaced this residue with a bulky tryptophan side chain to maximize the expected disturbance. We first tested the ability of the resulting G4W CL variant to polymerize in solution using MP, and observed that G4W formed few large assemblies (Figure 6B). The residue G4 lies at the outer surface of the hollow cylinder that the 8-mer forms. We sought to test the effect of a residue at the opposite side of the helix, which is predicted to form the core of the structure. We therefore tested the I9A mutation. The MP results show that the I9A variant, on the other hand, self-assembles efficiently in solution (Figure 6B).
Figure 6—figure supplement 1.

Head-to-toe model of CL 16-mer (dimer of octamer).

N-termini are shown in red, and C-termini in blue.

Figure 6.

Mutational analysis indicates that polymerization in solution is required for pore formation.

(A) The position of the residues G4 (red) and I9 (green) are shown for two different orientations of the 8-mer model. The CL sequence highlighting the position of the mutations is shown at the bottom. (B) Mass photometry shows that the G4W variant has a lower tendency to form large assemblies than I9A in solution. (C) AFM data of CL variants in the absence of membranes. The I9A variant exhibits increased loop features, while G4W does not form polymers; scale bar = 100 nm. Representative I9A features are selected from the image: a protomer, a loop, and a large loop; scale bars = 10 nm. (D) The volumes of the features observed by AFM were calculated, and are shown as accumulated fraction. Data are shown for CL WT (N=7838 features), I9A (N=3609), and G4W (N=190). (E) The fraction of all polymers that close into a loop was calculated for all variants. Error bars are standard deviations (n=3 independent experiments); p-values are the result of a Student’s t-test comparing the I9A and G4W data to the WT. (F) I9A CL forms membrane pores, while pores were not observed for G4W; scale bars = 100 nm for full images, 10 nm for inset. (G) Liposome dye release assay shows that CL variants display different membrane disruption. Top panel shows a time course of dye release for CL WT (black), I9A (green), and G4W (red) at 333 nM, and the bottom panel shows the percentage of dye release after 2 hrs for different peptide concentrations. N=3–4 and error bars are S.D. (H) SDS-PAGE of variants. The 16% tricine gel was silver-stained. Samples were incubated at 37 °C. The position of molecular weight markers is shown. The lower mobility of the G4W oligomer results from the corresponding differences in molecular weight (MWCL-WT=3310 Da, and MWCL-G4W = 3439 Da).

N-termini are shown in red, and C-termini in blue.

(A) A volume histogram of CL in solution compares the wildtype (N=7838 features), I9A (N=3609), and G4W (N=422). The I9A mutant has a smaller primary peak,~100 nm3, indicating a large number of smaller features. The larger volumes of the loops fall into the long high-volume shoulder. (B) An area histogram of N=1397 unrimmed pore-like features shows I9A increases the pore area of the primary peak population >20%, from 50 nm2 (unrimmed wild type, N=1468)–61 nm2. N=156 I9A loops are analyzed with the Hessian blob algorithm to get the inner areas and compared to the unrimmed I9A pore areas (N=1397). The overall agreement between pore geometry and loop inner areas for both the I9A mutant and the WT (Nrings = 261) suggests that structures formed in solution can directly translate into membrane pores.

(A) Circular dichroism (CD) spectra of WT and variant CL collected in buffer. (B) CD spectra collected in the presence of a 200:1 molar excess of POPC LUVs, in 1 mM NaPi buffer, pH. Data are provided for CL WT (black), I9A (Green) and G4W (red).

Mutational analysis indicates that polymerization in solution is required for pore formation.

(A) The position of the residues G4 (red) and I9 (green) are shown for two different orientations of the 8-mer model. The CL sequence highlighting the position of the mutations is shown at the bottom. (B) Mass photometry shows that the G4W variant has a lower tendency to form large assemblies than I9A in solution. (C) AFM data of CL variants in the absence of membranes. The I9A variant exhibits increased loop features, while G4W does not form polymers; scale bar = 100 nm. Representative I9A features are selected from the image: a protomer, a loop, and a large loop; scale bars = 10 nm. (D) The volumes of the features observed by AFM were calculated, and are shown as accumulated fraction. Data are shown for CL WT (N=7838 features), I9A (N=3609), and G4W (N=190). (E) The fraction of all polymers that close into a loop was calculated for all variants. Error bars are standard deviations (n=3 independent experiments); p-values are the result of a Student’s t-test comparing the I9A and G4W data to the WT. (F) I9A CL forms membrane pores, while pores were not observed for G4W; scale bars = 100 nm for full images, 10 nm for inset. (G) Liposome dye release assay shows that CL variants display different membrane disruption. Top panel shows a time course of dye release for CL WT (black), I9A (green), and G4W (red) at 333 nM, and the bottom panel shows the percentage of dye release after 2 hrs for different peptide concentrations. N=3–4 and error bars are S.D. (H) SDS-PAGE of variants. The 16% tricine gel was silver-stained. Samples were incubated at 37 °C. The position of molecular weight markers is shown. The lower mobility of the G4W oligomer results from the corresponding differences in molecular weight (MWCL-WT=3310 Da, and MWCL-G4W = 3439 Da).

Head-to-toe model of CL 16-mer (dimer of octamer).

N-termini are shown in red, and C-termini in blue.

Particle volume and pore area histograms of CL variants.

(A) A volume histogram of CL in solution compares the wildtype (N=7838 features), I9A (N=3609), and G4W (N=422). The I9A mutant has a smaller primary peak,~100 nm3, indicating a large number of smaller features. The larger volumes of the loops fall into the long high-volume shoulder. (B) An area histogram of N=1397 unrimmed pore-like features shows I9A increases the pore area of the primary peak population >20%, from 50 nm2 (unrimmed wild type, N=1468)–61 nm2. N=156 I9A loops are analyzed with the Hessian blob algorithm to get the inner areas and compared to the unrimmed I9A pore areas (N=1397). The overall agreement between pore geometry and loop inner areas for both the I9A mutant and the WT (Nrings = 261) suggests that structures formed in solution can directly translate into membrane pores.

CD spectra of WT and variant CL in the presence and absence of lipid vesicles.

(A) Circular dichroism (CD) spectra of WT and variant CL collected in buffer. (B) CD spectra collected in the presence of a 200:1 molar excess of POPC LUVs, in 1 mM NaPi buffer, pH. Data are provided for CL WT (black), I9A (Green) and G4W (red). We next tested the two variants using AFM to visualize the morphology of the polymers they formed. The AFM results agreed with the MP, as I9A formed long polymers and closed loops, while G4W formed few large structures (Figure 6C, compare top and bottom panels). We quantified the AFM images by measuring the volume of all particles, and compared these results with AFM data of WT CL. The resulting Figure 6D shows that G4W does not efficiently assemble into large (>1000 nm3) structures, while WT and I9A do. However, only the I9A variant forms a significant number of very large assemblies (>3000 nm3), which generally corresponded with over-sized loops (Figure 6C, side panel). Since the AFM data (Figure 4) indicate that linear polymers need to close to form membrane pores, a key parameter for membrane disruption would be the ability of polymers to close into loops. We determined the frequency of loop formation for the three peptides (Figure 6E), and observed that there is overall agreement between the ability to form polymers and the loop formation propensity. Consistent with the model that loops in solution become pores, we observed that I9A formed larger membrane pores than WT (Figure 6—figure supplement 2), while we did not observe membrane pores formed by G4W (Figure 6F). Additionally, the higher I9A pore area has a corresponding increase in the inner area of the loops compared to WT CL (Figure 6—figure supplement 2), supporting the hypothesis that the pore architecture is defined by the loops.
Figure 6—figure supplement 2.

Particle volume and pore area histograms of CL variants.

(A) A volume histogram of CL in solution compares the wildtype (N=7838 features), I9A (N=3609), and G4W (N=422). The I9A mutant has a smaller primary peak,~100 nm3, indicating a large number of smaller features. The larger volumes of the loops fall into the long high-volume shoulder. (B) An area histogram of N=1397 unrimmed pore-like features shows I9A increases the pore area of the primary peak population >20%, from 50 nm2 (unrimmed wild type, N=1468)–61 nm2. N=156 I9A loops are analyzed with the Hessian blob algorithm to get the inner areas and compared to the unrimmed I9A pore areas (N=1397). The overall agreement between pore geometry and loop inner areas for both the I9A mutant and the WT (Nrings = 261) suggests that structures formed in solution can directly translate into membrane pores.

We studied next the ability of CL WT and the two variants to disrupt the integrity of POPC (1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine) vesicles in suspension. Specifically, we carried out an assay where membrane damage is measured by the fluorescence de-quenching that occurs when the dye calcein is released from vesicles. Figure 6G shows the kinetics of membrane disruption caused by the addition of WT and the two CL variants. We observed that G4W did not induce membrane disruption, in agreement with the lack of membrane pores observed by AFM. WT CL efficiently disrupted membranes, but I9A was the most efficacious at disrupting membrane integrity, as expected from the high loop formation probability (Figure 6E) and the presence of larger membrane pores (Figure 6—figure supplement 2). The differences in leakage were consistent over a variety of peptide concentrations in the nanomolar range (Figure 6G). To study why the G4W mutation impacted the ability to disrupt membranes, we performed CD and OCD experiments on the variants. CD revealed that G4W showed reduced helical structure in solution and in the presence of POPC liposomes (Figure 6—figure supplement 3). Figure 5C also shows changes in the OCD spectrum for G4W in comparison to WT and I9A, which indicate substantial differences in how this variant interacts with lipid membranes. When we performed SDS-PAGE of the variants, we observed that I9A displayed higher levels of oligomeric intermediates (Figure 6H). This result suggests that the higher tendency of I9A to polymerize is due to its enhanced oligomerization ability. G4W, on the other hand, displayed similar levels of oligomers as WT. We therefore speculate that a W present at the Nt might impair the ability of two oligomers to bind. This effect would therefore reduce the formation of polymers, and explain the loss-of-function effect of this mutation. Overall, the mutational data confirm that CL uses a novel molecular mechanism, where the peptide first self-assembles in solution to form linear polymers that close into pore-competent soluble loops. The results of the loss-of-function G4W variant revealed that formation of polymers in solution is a necessary step for the formation of membrane pores.
Figure 6—figure supplement 3.

CD spectra of WT and variant CL in the presence and absence of lipid vesicles.

(A) Circular dichroism (CD) spectra of WT and variant CL collected in buffer. (B) CD spectra collected in the presence of a 200:1 molar excess of POPC LUVs, in 1 mM NaPi buffer, pH. Data are provided for CL WT (black), I9A (Green) and G4W (red).

CL pores damage the plasma membrane of epithelial cells. This attack triggers the activation of danger response signaling, which induces phosphorylation of MAPK phosphatase 1 (MKP1) and subsequent overexpression of the transcription factor c-Fos (Richardson et al., 2018b; Richardson et al., 2018a). When we treated the oral epithelial cell line TR146 with WT CL, we observed robust increases in c-Fos (threefold) levels and phosphorylation of MKP1 (5-fold) (Figure 7), as expected (Moyes et al., 2016). The I9A variant also induced strong MKP1 phosphorylation, but significantly higher c-Fos expression. Conversely, G4W CL failed to activate the danger response signaling pathway altogether, revealing an overall agreement between the effect of CL mutations in biophysical and cellular assays. Our data therefore indicate that mutations that alter polymerization impact epithelial cell damage response signaling. Taken together, these results suggest that polymerization of CL in solution is a major factor defining C. albicans infection.
Figure 7.

The polymerization-defective G4W variant does not cause danger response signaling in epithelial cells.

(A) Representative western blots of oral epithelial cells (TR146) probed for c-Fos expression and phosphorylation of MKP1 after 2 hr treatment with WT and variant CL. (B) Quantification of c-Fos and MKP1 phosphorylation was used to assess danger response signaling. Data were normalized to values obtained in control conditions. Actin was used as a loading control. N=4, and bars are the S.D.

The polymerization-defective G4W variant does not cause danger response signaling in epithelial cells.

(A) Representative western blots of oral epithelial cells (TR146) probed for c-Fos expression and phosphorylation of MKP1 after 2 hr treatment with WT and variant CL. (B) Quantification of c-Fos and MKP1 phosphorylation was used to assess danger response signaling. Data were normalized to values obtained in control conditions. Actin was used as a loading control. N=4, and bars are the S.D.

Discussion

Pore-forming toxins (PFTs) populate different states on their way to form membrane pores. PFTs are typically released as soluble monomers that later bind to the target lipid bilayer. After membrane binding, PFT monomers find each other and oligomerize (Leung et al., 2014; Verma et al., 2021), often forming membrane-anchored pre-pores that later transition into the mature pores that permeabilize membranes (Mondal and Chattopadhyay, 2020; De Schutter et al., 2021). Here, we show that CL follows a different molecular mechanism for pore formation. Multiple lines of evidence indicate that CL forms both linear and closed loop polymers before binding to the membrane (Figure 8). Further, acting as soluble pre-pores, closed loop CL polymers insert into lipid bilayers to cause membrane damage without any observable conformational change.
Figure 8.

Candidalysin utilizes a novel mechanism of pore formation to attack human cell membranes.

The CL monomer oligomerizes into an intermediate oligomer, which we propose is 8-mer. CL polymers are formed when the oligomer assembles in a head-to-toe fashion. Polymers can close into loops, which have the ability to insert into membranes forming unrimmed pores. Upon insertion, pores exist in a dynamic equilibrium between unrimmed and rimmed pores, which cause cellular toxicity. Scale bars in the AFM images are 10 nm.

Candidalysin utilizes a novel mechanism of pore formation to attack human cell membranes.

The CL monomer oligomerizes into an intermediate oligomer, which we propose is 8-mer. CL polymers are formed when the oligomer assembles in a head-to-toe fashion. Polymers can close into loops, which have the ability to insert into membranes forming unrimmed pores. Upon insertion, pores exist in a dynamic equilibrium between unrimmed and rimmed pores, which cause cellular toxicity. Scale bars in the AFM images are 10 nm. It is interesting to compare the topography and mode of action of CL pores to those formed by other PFTs and other proteins. AFM imaging revealed that CL (3.3 kDa) assembles into intermediate size membrane pores, of diameter ≤80 Å, deduced from area distribution peaks <50 nm2 (Figures 5A and 3C) and assuming circularity, which matched many of the pores observed. This diameter is smaller than the well-studied aqueous pores formed by the proteins gasdermin-D (Mulvihill et al., 2018), suilysin (Leung et al., 2014) and perfringolysin O (Ramachandran et al., 2002; Czajkowsky et al., 2004), of molecular weights in the 50–60 kDa range, but is probably larger than pores formed by α-hemolysin (diameter: 14–46 Å, 33 kDa) (Song et al., 1996). Further differences exist between the assembly mechanism of these proteins and the mode of action of CL. Multiple PFT families such as hemolysins form large pre-pore structures at the membrane surface prior to insertion and pore maturation (Dal Peraro and van der Goot, 2016). In contrast, CL unrimmed pores present no features above the upper leaflet of the bilayer. Instead, these dynamic structures appear topographically similar to those induced by the antimicrobial peptide melittin and its derivatives (Pittman et al., 2018; Hammond et al., 2021; Kim et al., 2019). The rimmed CL pores are quite distinct from the unrimmed pores. Not only are they more stable on the timescale of AFM imaging (>0.1 s), but rimmed pores have a punctate pattern about their periphery. Such structure is reminiscent of the pores formed by the N-terminal segment of gasdermin-D (Mulvihill et al., 2018) however, the overall size of the CL rim is smaller, only reaching ~0.3 nm outside each side of the bilayer surface. This height corresponds to the difference between the 8-mer (4.6 nm) and the DOPC bilayer thickness (4.0 nm, as measured by AFM, Figure 3—figure supplement 1). This observation suggests that the pore rims arise when the ends of the TM helices of the 8-mer stick out of the bilayer surface upon 90 degree rotation of the 8-mer in the unrimmed pore, which transitions from the head-to-toe into the side-to-side arrangement (Figure 8). Some rimmed pores were decorated with protrusions covering the whole pore periphery, forming a corona (Figure 3B). However, other pores were only partially covered with puncta (Figure 4A). This observation suggests that maturation into rimmed pores occurs progressively and is not an all-or-none process. Pore maturation for perfringolysin O (Czajkowsky et al., 2004; Nelson et al., 2008) and suilysin (Leung et al., 2014), involves a vertical collapse that allows formation of a TM pore. In contrast, the rearrangement of the 8-mer orientation that leads to rim formation causes CL to protrude from the bilayer and could be defined as a vertical swell between the two types of pores. The reason why pore maturation in CL occurs is not clear, but it might be related to the three K residues located at the Ct (Figure 6A). In the unrimmed pores, the head-to-toe orientation of the 8-mers would likely place the positive charges of the K side chain in contact with lipid molecules, resulting in a meta-stable configuration. However, in the vertical 8-mer orientation found in the rimmed pore, the K residues are expected to be solvent-exposed, resulting in a more stable conformation. An additional difference with some pore-forming proteins is that imaging of bilayers in the presence of CL did not show open polymers. However, bilayer removal revealed that linear CL polymers insert into the membranes, but they cannot be readily observed as they do not disturb the bilayer surface or protrude significantly from it. This behavior contrasts with the arcs formed by suilysin, as these rigid open polymers were able to remove lipid molecules from the bilayer to cause perforations (Leung et al., 2014). Finally, we compare the CL mechanism with the membrane attack (MAC) system that forms membrane pores in pathogens. MAC employs the 71 kDa C9 protein, which polymerizes in solution prior to forming pores (Song et al., 1996; Dudkina et al., 2016; DiScipio and Hugli, 1985). However, C9 needs other components of the MAC system inserted into the membrane (e.g. C7 and C8), which then serve to recruit multiple C9s. Hence significant distinctions remain between the pore-forming mode of action of CL and that of the MAC system.

Conclusions

Here, we elucidate how CL forms the membrane pores that damage cells infected by C. albicans. Our data show that CL preassembles into a pore-competent loop conformation in solution. To the best of our knowledge, this process represents a novel mechanism of pore formation, since other PFT that form aqueous pores require binding to the plasma membrane as monomers to self-assemble. The assembly of CL into an insertion-competent state in solution might provide an infectivity advantage for C. albicans, as it could facilitate faster membrane damage. At the same time, we propose that this assembly mechanism might constitute a therapeutic opportunity to inhibit CL pore formation. Targeting membrane pores presents several drug delivery drawbacks, and it is therefore significantly more challenging than a soluble target. However, drug molecules that prevent CL polymerization in solution could be used as therapeutics to fight C. albicans infection. Specifically, a molecule that inhibits the formation of CL loops would be expected to prevent the assembly of the membrane pores that damage human epithelial cells.

Limitations of the study

Our data suggest that the oligomeric state of the basic assembly unit is a CL 8-mer, as indicated by the native mass spectrometry data and this assignment is consistent with AFM volume analysis. However, it is intrinsically challenging to precisely determine the stoichiometry of large oligomeric assemblies. We therefore cannot rule out that CL assembles instead through an intermediate of different stoichiometry (e.g., a 7-mer or a 9-mer). High resolution methods will also be required to confirm the directionality that the CL oligomers adopt in the polymer, to confirm that they are aligned head-to-tail. We additionally identified the loss-of-function variant G4W, and the possible gain-of-function I9A. Future studies that unravel how these mutations affect the biophysical parameters that govern peptide self-assembly and membrane interaction, are expected to shed light on the specific reasons behind the disparate effects of the mutations. Additionally, these investigations could allow us to determine if CL pore formation is indeed under kinetic control, as we suspect.

Materials and methods

Peptide preparation

Wild-type (sequence: SIIGIIMGILGNIPQVIQIIMSIVKAFKGNK) and variant candidalysin were synthesized employing solid-phase synthesis by Peptide 2.0 (Chantilly, VA) and HPLC-purified. Purity (>95%) was checked by MALDI-TOF and analytical HPLC. Lyophilized stocks were resuspended in MilliQ H2O, stored at –80 °C, and diluted in the desired buffer at the time of experimentation.

Ion-mobility mass spectrometry

Peptide samples were directly injected via a syringe pump into a JetStream ESI nebulizer. Mass spectral data and ion mobility measurements were collected using an Agilent 6560 IMS-QTOF mass spectrometer. The peptides were ionized in positive-mode and ions were subsequently pulsed into a helium-filled drift cell in a multi-field fashion (ΔV=890, 790, 690, 590, and 490 V). The pressure of the drift cell was maintained at 3.940 Torr with the pressure differences between the drift cell and trap funnel being approximately 300 mTorr. An exit funnel and hexapole ion guide focused the ions into the QTOF mass spectrometer. Mobility data were collected over the course of 5.2 min (additional instrument parameters are given in Supplementary file 1). Arrival time distributions were extracted with the Agilent IM-MS Browser software and graphed with Origin Pro. The ion’s arrival time can be related to the change in drift cell voltage (ΔV) to determine the ion’s reduced mobility (). To calculate the momentum transfer collision integral, which approximates the experimental collisional cross section (), the Mason-Schamp equation was used (Mason and McDaniel, 1988): where z is the ionic charge, e is the elementary charge, is the number gas density, µ is the reduced mass of the ion-buffer gas pair, is the Boltzman constant, and T is the temperature of the buffer gas. Theoretical collisional cross sections were calculated using the trajectory method available in the Mobcal package (Mesleh et al., 1996).

Molecular dynamics simulation

An atomistic model of CL 8-mer was built by aligning the peptide sequence to that of the eight-helix coiled coil CC-Type2-II (PDB ID 6G67) (Rhys et al., 2018) using EMBOSS (Madeira et al., 2019). The initial structure was minimized using GROMACS 4.6.7 (39) during 25 ns and the CHARMM27 force field. Molecular dynamics (MD) simulation of the two interacting 8-mers was performed using the same package and force field. The initial structure was minimized using the steepest decent method and solvated in a TIP3P cubic water box (a=14.03 nm). Chloride anions were added to neutralize the charges. Solvent and volume equilibration simulations in NPT ensemble (T=300 K and P=1 bar) were performed to optimize the box size, followed by 45-ns NPT simulations at 300 K. The LINCS algorithm (Hess, 2008) was employed to constrain bonds between heavy atoms and hydrogen, and the SETTLE algorithm (Miyamoto and Kollman, 1992) was used for water molecules. These constraints allowed an integration time step of 2.0 fs. The electrostatic and dispersion forces were computed with a real space cutoff of 1.2 nm, and particle mesh Ewald method (Darden et al., 1993) was used to treat long-range electrostatics. The temperature was maintained by the Nose-Hoover thermostat. The temperature and pressure coupling constants were 0.1 and 1.0 ps, respectively. The equations of motion were integrated according to the leap-frog algorithm.

Analytical ultracentrifugation

Sedimentation velocity experiments were performed at 20 °C with an An-60Ti rotor in a Beckman Optima XL-I ultracentrifuge at 35,000 RPM. Sedimentation was followed by absorbance at 230 nm and the continuous sedimentation coefficient distribution was obtained using SEDFIT. The following parameters were used for analysis: frictional ratio of 1.2, partial specific volume of 7.3 ml/g, buffer density of 0.9982 g/ml, and buffer viscosity of 1.002 mPa s.

Mass photometry

WT and variant CL were diluted to 333 nM in the AFM imaging buffer (10 mM HEPES, 150 mM NaCl, pH 7.3) prior to measurement. Experiments were performed on clean glass coverslips using a Mass Photometer (OneMP, Refeyn). Videos were recorded for 120 s and analyzed on DiscoverMP (Refeyn, version 2.2.0) to determine the molecular mass. The molecular mass was obtained by comparison with known protein standards measured on the same day.

TEM

Transmission electron microscopy was performed using 2 μM CL samples in AFM imaging buffer incubated on carbon grids for 2 minutes at 25 °C, negatively stained with uranyl acetate, and imaged at 120kV (JEOL, JEM-1400).

Liposome preparation

Lipids were purchased from Avanti Polar Lipids, Alabaster, AL. POPC (1-palmitoyl-2-oleoyl-glycero-3-phosphocholine), DOPC (1,2-dioleoyl-sn-glycero-3-phosphocholine) stocks were prepared in chloroform and stored at –20 °C. Lipids were dried under argon gas and stored in a vacuum overnight prior to use in experiments. Lipid films were resuspended as described below. Large unilamellar vesicles (LUVs) were prepared using a Mini-Extruder (Avanti Polar Lipids, Alabaster, AL) with a 100 nm filter (Whatman, United Kingdom) (Nguyen et al., 2015; Scott et al., 2015).

Atomic force microscopy

A sample of one hundred milligrams of DOPC in chloroform was divided into microcentrifuge tubes and dried under argon gas to form uniform films. The tubes were incubated overnight in a vacuum chamber. A dry mechanical roughing pump (XDS5, Edwards) was used to minimize the probability of contamination (Schaefer et al., 2022). Samples were back-filled with argon, sealed, and stored at –20 °C. At the time of extrusion, AFM imaging buffer was added to swell the lipids. The lipid solution was extruded (Liposofast, Avestin) through 100 nm membranes 25 times to form unilamellar vesicles. The solution was aliquoted and stored at –80 °C until the time of the experiment. A phosphorus assay was conducted to determine lipid concentration (Stewart, 1980). For AFM imaging of CL in solution, stock aliquots of CL were diluted in imaging buffer to the desired concentration (typically 333 nM). A 90 µL droplet was added to freshly cleaved mica and incubated for 10 min at 25 °C. Samples were rinsed from above the surface using buffer exchange (~100 µL of imaging buffer were exchanged over the surface 5–6 times). Images were collected in imaging buffer with biolever mini tips (Olympus, k~0.1 N/m, fo~30 kHz in fluid) using tapping mode (Cypher, Asylum Research). Care was taken to keep the magnitude of the tip sample force to ≤100 pN during imaging deduced by comparing the free space tapping amplitude (∼5 nm) to the imaging set point amplitude (∼4 nm). Under such conditions, minimal protein distortion is expected (Sanganna Gari et al., 2013). As is typical in AFM, lateral image scales are significantly larger than the false color vertical scales. To image pores, a method for forming lipid bilayers via vesicle rupture was adapted (Schaefer et al., 2022). An aliquot of DOPC liposomes was diluted to 300 µM and CL was diluted to specific concentrations The DOPC + CL solutions were incubated in a microcentrifuge tube for 10 min, with an additional mixing at the 5-min mark to encourage peptide diffusion (a pipette was inserted into the solution and the plunger depressed and released 5–6 times). Immediately after incubation in solution, 75 µL of the solution was deposited onto freshly cleaved mica and incubated for another 30 min. Material remaining in solution and loosely bound particles were removed by washing via buffer exchange (~100 µL of imaging buffer exchanged 5–6 times). All incubations were performed at room temperature (25 °C). Imaging was done in imaging buffer at ~35 °C. The underlying structure of CL peptides was revealed by removing the lipid bilayer with the non-ionic detergent dodecyl beta-D-maltoside (DβM). Stock DβM (196 mM) was diluted in the imaging buffer to 1.5 times the critical micelle concentration (CMC). After imaging pores, the AFM tip was lifted and 75 µL DβM added to the surface and incubated 15 min. To ensure all lipid and detergent molecules were removed from the surface, the samples were heavily rinsed (~100 µL of imaging buffer were exchanged 10–12 times). The remaining CL was then imaged in the imaging buffer. Analysis of solution data was performed using commercial software (Asylum Research, Inc). Pores were analyzed using the Hessian blob algorithm (Marsh et al., 2018). Probability density plots were generated using Epanechnikov kernels and the vertical axes were normalized (integrated to unity area). The number of Gaussian distributions was selected by minimizing the Bayesian information criterion for each model. For AFM simulations, the tip was modeled as two overlapping spheres of different radii (R=8 and 4 nm) (Schaefer et al., 2022) and the CL 8-mer was positioned in specified orientations. For a single octamer, the geometry of the simulated image (volume = 360 nm3) roughly corresponds with the geometry of the smallest subunits observed in AFM (volume of primary experimental peak ± σ=234 ± 130 nm3). Polymeric arrangements of the octamer subunit were made by aligning them head-to-toe in linear or in loop conformations. The inset in Figure 2C compares the first four peak locations in the experimental data to the volumes of simulated curved arrangements of 1–4 subunits. Each of the simulated volumes agree with the experimental volume peaks within error. Curved simulations were chosen for this comparison because a linear model underestimates the measured volume due to a lack of curvature-dependent convolution in the simulation. To avoid volume degeneracies, only small (1–4 subunit) features are analyzed. The persistence length was calculated using Easyworm software (Lamour et al., 2014).

Circular dichroism spectroscopy

The circular dichroism (CD) spectrum of candidalysin was collected in the presence and absence of POPC liposomes. LUVs were prepared by extruding resuspended lipid at 1 mM in sodium phosphate buffer pH 7.4. The final lipid concentration was 130 µM, and the final peptide concentration was 5 μM. CD spectra were measured in a Jasco J-850 spectropolarimeter with a 2 mm path length. A lipid blank and a buffer blank were subtracted from the lipid and lipid-free samples, respectively. Mean residue ellipticity (MRE) was calculated as: where is ellipticity (millidegrees), is cuvette pathlength (mm), is the number of amino acids in the peptide, and is the concentration of the peptide (M).

Oriented circular dichroism

Two circular quartz slides (Hellma Analytics, Müllheim, Germany) were cleaned by submerging in piranha solution (75% H2SO4, 25% H2O2) for five minutes. POPC films were resuspended in 2,2,2-trifluoroethanol with or without CL, and this mixture was air-dried onto the slides for at least twelve hours at room temperature. The amount of total lipid on each slide was 85.3 nmol, and the amount of peptide on each slide 1.71 nmol, for a lipid to peptide ratio of 50:1. The deposited lipid was then rehydrated with PBS in a chamber containing saturated potassium sulfate, which produces a relative humidity of 96% to prevent the films from dehydrating. After at least 12 hr, the slides were loaded onto an OCD cell containing saturated potassium sulfate. OCD spectra were measured eight times on a Jasco J-815 spectropolarimeter. The OCD cell was rotated 45° between measurements to correct for any imperfections in the lipid bilayers. To obtain the final spectra, the eight measurements were averaged, and peptide-free lipid blanks were subtracted.

Fluorescent dye-release assay

Dried lipid films were rehydrated with 50 mM calcein solubilized in 50 mM EDTA and 50 mM NaPi (pH 8) solution. LUVs were formed as described above, separated from free dye by gel filtration using a PD-10 column (GE Life Sciences, Chicago, IL), and diluted to a working lipid concentration of 144 μM. Peptide was added to the calcein entrapped LUVs to achieve the desired lipid:peptide molar ratios. The calcein fluorescence increase caused by dequenching was used as a proxy for CL-induced membrane leakage. A positive control was measured after each treatment, consisting of 0.016% w/v Triton X-100 (TX). A negative control of PBS in lieu of peptide treatment was used to calculate percent leakage: where FICL is the fluorescence intensity after treatment with CL, FITX corresponds to the positive control (100% leakage), and FIPBS corresponds to negative control (0% leakage). The quenching effect of TX on calcein was accounted for by measuring the fluorescence intensity of calcein in the presence and absence of TX and calculating a correction factor applied to FTX: The concentration of calcein was determined by measuring the fluorescence of calcein entrapped within the LUVs post purification. Samples were loaded into a black 96-well plate (Corning, Kennebunk, ME) and measured for two hours, with readings taken every minute, on a Cytation 5 plate reader (BioTek, Winooski, VT) using an excitation wavelength of 495 nm and an emission wavelength of 515 nm.

Cell culture

Experiments were performed using the TR146 buccal squamous carcinoma cell line obtained from the European Collection of Authenticated Cell Cultures (ECACC 10032305) and grown in Dulbecco’s Modified Eagle Medium (DMEM, Gibco) supplemented with 10% fetal bovine serum (FBS) and 1% penicillin-streptomycin. Cells were authenticated via STR profiling. Mycoplasma contamination was ruled out by PCR (Abcam 289834). All experiments were performed in serum-free DMEM.

Western blot

TR146 cells were grown to confluency and starved overnight in serum-free DMEM. Cells were treated with 15 μM peptide for two hours. Post-incubation, cells were lysed on ice with TEN-T buffer (50 mM Tris-HCl pH 7.5, 100 mM NaCl, 1 mM EDTA, 1% Triton-X 100) containing phosphatase (Sigma) and protease (ThermoFisher) inhibitors for 30 min. Lysates were collected post centrifugation (20 min, 13,000 RPM, 4 °C) and separated on 10% SDS-PAGE gels before transfer to 0.45 µm nitrocellulose membranes. Blots were probed with primary antibodies for c-Fos (1:500, Cell Signaling Technology, 2250 S) and phospho-MKP1 (1:1000, Cell Signaling Technology, 2857 S) overnight. Fluorescent secondary antibodies (1:10,000, goat-anti mouse IRDye 680, goat-anti rabbit IRDye 800, LI-COR) were used for detection on a LI-COR Odyssey CLx. Human β-actin (1:1000, Abcam, ab6276) was used as a loading control and protein expression and phosphorylation was quantified using ImageStudio software. This study by Russell et al. reveals interesting details of the mechanism of pore formation of a newly identified peptide toxin secreted by Candida albicans (candidalysin). Using atomic force microscopy along with other techniques, the authors demonstrate that pre-assembly of polymers in solution is the first step in the formation of permeabilizing pores, and identify an intriguing inactive mutant. This manuscript will be of interest to several fields, in particular to microbiologists and structural biologists studying pore forming proteins and peptides. Our editorial process produces two outputs: (i) public reviews designed to be posted alongside the preprint for the benefit of readers; (ii) feedback on the manuscript for the authors, including requests for revisions, shown below. We also include an acceptance summary that explains what the editors found interesting or important about the work. Decision letter after peer review: Thank you for submitting your article "The C. albicans virulence factor Candidalysin polymerizes in solution to form membrane pores and damage epithelial cells" for consideration by eLife. Your article has been reviewed by 3 peer reviewers, and the evaluation has been overseen by a Reviewing Editor and Richard Aldrich as the Senior Editor. The following individual involved in review of your submission has agreed to reveal their identity: Ioan iacovache (Reviewer #2). The reviewers have discussed their reviews with one another, and the Reviewing Editor has drafted this to help you prepare a revised submission. The reviewers all agreed that this is an interesting study that demonstrates a novel mechanism for membrane permeabilization by toxins, but found that some of the claims require additional experiments. These experiments are considered to be minimal, and already overlap with some of the studies already presented. Therefore, it is anticipated that they could be carried out in a reasonable amount of time and included in the revised manuscript. If this is not possible, then another option is to revise the manuscript significantly to tamper these claims. The following list outlines the essential revisions required: Essential revisions: 1) While the data shows the existence of higher order assemblies in solution, the specific 8-mer octameric assembly does not appear to be well supported here. Further experiments are required to identify that the 8-mer exists in solution, to support the proposed mechanism that the 8-mer is the basic unit that seeds CL into larger structures. There are many experiments that may provide this information, such as cross-linking with SDS-PAGE, native PAGE or SEC with MALS. If these experiments are not possible or do not provide clear information to differentiate between alternate higher oligomeric states, which is admittedly difficult for an octamer species, then the paper still requires significant revisions to temper the claims that the mechanism relies on the octamer species, allowing for the possibility that other assemblies may be factor into the formation of the larger CL structures. Additionally, the model shown in Figure 1D should be moved to a supplementary figure where a more complete description of the modeling variability and quality can be depicted. Alternate plausible models should be shown here to provide a more objective analysis of the possible oligomeric species. 2) The mutants studied here should be featured more completely with additional data characterizing their behavior, particularly SDS and native-PAGE, CD and oriented CD and solution oligomerization to determine that the effect observed is specific to the change in oligomerization. 3) Please explain the reasoning behind changing lipid compositions in various experiments. Is it possible that these membrane changes may impart differences on the observations? Please elaborate on this. 4) Please see and respond to recommended changes suggested by the reviewers below. Reviewer #1 (Recommendations for the authors): Specific queries/requests for revision to what is overall a fine manuscript, in my opinion: – A really confusing aspect of the authors' interpretation is that they postulate a mechanism by which linear polymers of octamers can land on the membrane to form "rimmed pores" (see Figure 8). This raises the question of what defines the size of the polymers in solution. If these polymers are in equilibrium, the probability would maximum for either the shortest unit (an octomer) or to a maximum size, which in practice means that the size distribution would be determined by some kinetic trapping. In that case, the polymer size is expected to be strongly dependent on detailed experimental protocols and not be very robust. And I would expect that the size/area distribution for the "rimmed pores' would be much wider than for the "unrimmed pores", since the latter have a area that is (to within some flexibility) defined by the loop-shaped polymers in solution. Figure 3C shows some difference in area distributions, but it is far from clear how robust this areal analysis is given the difference in pore profiles. Remarkably, the AFM data in Figure 3A, B, D suggest that rimmed and unrimmed pores have very similar areas, suggesting that their size is set by a very similar assembly mechanism. The manuscript conclusions should be clarified, substantiated or adjusted in light to this. Another way of interpreting this is by noting that the assembly mechanism appears relatively robust, with the total pore assembly being rather robust against whether that assembly happens in solution or on the membrane. Reviewer #2 (Recommendations for the authors): While the majority of the presented data is clear and easily accessible several additions could benefit the reader: 1. The sequence of the peptide should be given in the text early on, currently is only shown in figure 6 and not well referenced in the text. 2. How the peptide was prepared (synthesis) is also not clearly mentioned in the text. 3. Figure 1A showing an SDS-PAGE of the peptide is not well explained. Is this a standard SDS-PAGE where the sample was boiled? In addition, a native PAGE could be shown to visualize other oligomeric species that are not resistant to SDS-PAGE. 4. In addition, the circular dichroism measurements of the bulk of peptide in solution is hard to interpret as a mixture of different species. If possible, one would expect that the oligomers and polymers could be analyzed separately (after separation by gel filtration or other techniques). 5. Figure 3 AB shows AFM images of rimmed and unrimmed pores in two separate panels. If one image could be shown with both types of pores it would strengthen the message, currently, at a glance at the figure one would assume they are different experimental conditions. 6. Negative stain EM of the polymers on membranes could be shown assuming that they are visible. Cryo-EM would be a better option to see polymers embedded in the membrane if the authors have access to a cryo-EM facility. This would strengthen the paper however cryo-EM could by itself be a follow-up paper. 7. Figure 4, solubilizing the bilayer with detergent is an elegant way to image the sample however is hard to rule out that the linear polymers observed are not circular oligomers that are disturbed by the detergent solubilization step or oligomers that polymerize in presence of detergent. In addition, the figure 5B could also show the CL in buffer plus detergent (or solubilized). 8. Both mutants should be featured more extensively in the paper, in particular SDS-PAGE (and native), oligomerization state, etc. According to the presented model, the G4W mutant should be able to oligomerize into the building block while losing the ability to form the longer polymers. If this is indeed the case it would help as both controls for the CD and oriented CD as well as for follow-up studies that could try to solve the structure of the building block. 9. Some of the techniques used in the paper could benefit from short introductions. 10. Some figures do not mention the scale bar size Reviewer #3 (Recommendations for the authors): Please find below comments to the paper and further suggestions to improve it. 1. Please include the whole name of the species in the title: Candida albicans. 2. I believe the name of the protein should be written as 'candidalysin' and not 'Candidalysin', as also used for other toxin names. 3. Results section starts that oligomerization of the peptide in solution was indicated by SDS-PAGE, but not much is commented further on the mass on the higher band (8-mer?) or other additional bands and how they were sure they belonged the same peptide (and no potential impurity). Or that if you see the higher band and that it belongs to CL oligomer, it must be a strong complex to resist SDS. What would a simple size exclusion chromatography show? What would NATIVE-PAGE show (higher oligomers) and native-MS? 4. Data that lead to figure 1 show the probability of existence of 8-mers as a single unit. They do not suggest yet that they are ordered as described in the model in Figure 1D. This may be suggested with later results. Anyways, in the model, N- and C-terminus of the peptides should be marked so we can understand the orientation of the peptides in the proposed model of the 8-mer. Please comment on why CC-Type2-II model was used as a base for MD model of CL 8-mer. 5. Analytical UC results. 'The sedimentation velocity results reveal a low sedimentation peak, likely corresponding to a CL monomer (8), and several larger assemblies, in agreement with the IM-MS data analysis.' Why is reference 8 here quoted? Please mark more exactly on Figure 1E what you describe in the text (what is monomer (1 peptide?), what is 8-mer etc). What exactly is meant by 'several larger assemblies, in agreement with the IM-MS data analysis'? Please described in a quantitative manner. 6. Figure 2A/B. Please use either expression 'loop' or 'ring', band not mixed. 7. Page 7 of combined PDF: Taken together, these results support the notion that CL assembles into an 8-mer in solution. … and polymers of 8-mer, right? 8. Can you comment on possibility (or impossibility) of head-to-head dimerization of 8-mers? 9. It is rather hard to understand Figure 5A. Please, comment on this: 'Specifically, the modeled areas predict that unrimmed pores contain six to eight head-to-toe 8- mers, while rimmed pores are formed by six to twelve side-to-side 8-mers.' How do you explain this difference between unrimmed and rimmed in terms of 8-mer copy No (6-8 and 6-12 8-mers, respectively)? If the unrimmed ends up as the rimmed and the rimmed could have more 8-mers than unrimmed? 10. Figure 5B. Which lipids were used? What type of lipid vesicles? 11. Figure 5B shows that CL forms, as expected (3), an a-helical structure in solution, as evidenced by the spectral minima at 208 and 222 nm, and that the presence of lipid vesicles promote modest additional helix formation. Please comment 'additional helix formation', what could contribute to this: Elongation of the peptide helices (some of it is not structured as seen from the model)? More peptides included, more 8-mer subunits? 12. Model of the dimer of 8-mers, Suppl Figure 6. How was the model prepared? Please mark N and C termini. Is the depicted dimer head-to-toe? Hard to see. 13. Page 11 of the merged PDF: 'Our 8-mer model predicts that the Nt is slightly kinked (Figure 1D), and glycine residues confer flexibility to -helices (18).' There is something missing in this sentence. Please rewrite. The first part is saying one thing (from the model) and the other part something else. 14. Also page 11: 'We reasoned that mutation of residue G4 (Figure 6A), located at the Nt kink, might hamper CL polymerization.' Could it also hamper helix-helix interaction with 8-mer? Or when in the rimmed pore? https://www.ncbi.nlm.nih.gov/pmc/articles/PMC1300449/pdf/10465772.pdf 15. Please provide CD spectra for G4W and I9A, to correct folding of mutants (and if comparable to WT) 16. Why in AFM DOPC was used and POPC for calcein release studies? And then POPC/POPE/cholesterol in OCD? Is there any lipid specificity? Usage of lipids between different approaches should be (more) consistent. 17. Please provide info on orientation of the peptides (N and C termini). Add scale for AFM images. In the figure legend: 'Upon insertion, pores exist in a dynamic equilibrium between unrimmed and rimmed pores, which cause cellular toxicity.' Are only the rimmed pores functional (transmembrane)? Please state clearly. Would you expect any conformational changes in the rimmed pore – in terms of elongation of helices in comparison to unrimmed (CD spectra?) Can you comment on energy cost from going from unrimmed form to the rimmed form? 18. General question: what is more correct to say: unrimmed or non-rimmed? 19. Page 15 and general: Are the pores (unrimmed and rimmed) homogeneous in size? What would be the size in nm? Are they really as big as those of CDCs? To me, they look significantly smaller. 20. Monomeric forms of CDCs (perfringolysin) is 50-60 kDa, in the text it sounds as this was the Mw of the pore. First you compare the size of CL pores to CDC pores (huge) and in the next sentence you turn to hemolysins (which are 10x smaller than of CDCs and are completely different to CDC). It sounds confusing. Please revise this.The pores of CDCs and hemolysins are very different to those of CL, the mechanism of pore formation is very different (to the one proposed by you). Hemolysins, CDC, MACPF etc undergo large conformational changes upon pore formation. No conformational changes in CL case? Within 8-mers? What about switching between the flat polymers to upward position of 8-mer (unrimmed vs rimmed)? 21. Page 15. Such structure is reminiscent of the vestibule of – hemolysin or the perimeter of pores formed by the N-terminal segment of gasdermin-D. What did you mean here? Is there a vestibule in your pore? Your model of CL pores is completely different and can not be directly compared to hemolysin or gasdermin etc. Unless you have better structural data, e.i. cryoEM. What do you mean by 'perimeter'? What is this in nm? 22. Page 16. The 8-mer might rotate because the three K residues located at the Ct … (Figure 6A) are expected to be interacting with lipid molecules in the rimmed pore configuration. Please, elaborate on this? How exactly you propose for helices in 8-mer to be oriented (in either horizontal or vertical orientation). 23. Page 16. it. This behavior contrasts with the arcs formed by suilysin, as these rigid open polymers were able to remove lipid molecules from the bilayer to cause perforations (20). Arcs in suilysin are completely different than in your case in terms os structure (built by protomers). 24. Methods should be described in the same order as presented in the Results section. 25. Peptide preparation: please avoid using statements such as 'were prepared as described previously (31, 32)' Please provide a brief description how you did it. All used program, chemicals and equipment should be referenced (paper or manufacturer etc) SEDFIT (?), carbon grids, protein standards (which ones). 26. Preparation of LUVS: what was the filter size? 27. OCD: The amount of lipid on each slide was 85.3 nmol, Concentration of the lipid was calculated based on which lipid? Essential revisions: 1) While the data shows the existence of higher order assemblies in solution, the specific 8-mer octameric assembly does not appear to be well supported here. Further experiments are required to identify that the 8-mer exists in solution, to support the proposed mechanism that the 8-mer is the basic unit that seeds CL into larger structures. There are many experiments that may provide this information, such as cross-linking with SDS-PAGE, native PAGE or SEC with MALS. If these experiments are not possible or do not provide clear information to differentiate between alternate higher oligomeric states, which is admittedly difficult for an octamer species, then the paper still requires significant revisions to temper the claims that the mechanism relies on the octamer species, allowing for the possibility that other assemblies may be factor into the formation of the larger CL structures. As the editor mentions, it is difficult to experimentally establish the stoichiometry of a high-order oligomer. We suspect that the additional data obtained using some of the experimental techniques suggested might not definitively support that the oligomer is indeed an 8-mer (and not, for instance, an 7-mer or a 9-mer). Therefore, we consider that the most prudent course is to follow the route suggested by the editor, and we have tempered our claim that the 8-mer definitively is the particles that assembles into a polymer. Accordingly, the updated manuscript has been modified to include this change throughout the text. Additionally, we have added a new closing section, titled “Limitations of the study”, where we discuss that we cannot rule out that the stoichiometry of the oligomer is slightly different, despite the presence of an 8-mer being supported by three different techniques (mass photometry, atomic force microscopy, and mass spectrometry). Instead of mentioning that the mechanism for polymer formation does require an 8-mer, we introduce the term “intermediate oligomer“, the presence of which is observed by AUC, AFM and TEM. We have additionally modified the abstract to point out that we merely propose that the basic structural unit in polymer formation is a CL 8-mer. Additionally, the model shown in Figure 1D should be moved to a supplementary figure where a more complete description of the modeling variability and quality can be depicted. Alternate plausible models should be shown here to provide a more objective analysis of the possible oligomeric species. As suggested, we have moved the 8-mer from Figure 1D into the new Figure 1- Supplementary 1. We also provide additional explanation of the interpretation of the IM-MS data a new Figure 1- Supplementary 2. We briefly summarize our major points here: given a nominal of n/z (oligomer size to charge ratio), one can determine n if z is known. The isotope spacings (mainly due to the difference between 13C and 12C) suggest that the octamer (Δm/z = 0.125) is among the major oligomers at m/z 3311. Because CD data showed that CL adopts a largely α-helical conformation in the absence of lipid, we modeled the 8-mer as a cylinder composed of 8 helices. The resulting theoretical collision cross section (CCS) agrees well with the experimental CCS if we assign the ATD feature at ~ 32 ms to be an octamer. We followed the reviewers’ suggestion and we explicitly considered whether the feature could be assigned as a 9-mer. Based on structural similarity and polypeptide length, the closest 9-helix structure found corresponded to the central segment of the integral membrane light-harvesting complex II (LH2) (PDB ID 1NKZ; 2 Å resolution). The resulting 9-mer model of CL is shown In Author response image 1. We computed its theoretical CCS, and the value is significantly larger than our experimental value (if the feature at 32 ms were assigned as a 9-mer), i.e., 4,723 Å2 vs. 2,923 Å2. This result argues against the possibility of CL forming an 9-mer.
Author response image 1.
2) The mutants studied here should be featured more completely with additional data characterizing their behavior, particularly SDS and native-PAGE, CD and oriented CD and solution oligomerization to determine that the effect observed is specific to the change in oligomerization. We have performed new experiments for the G4W and I9A mutants (shown in figure 5C and Figure 6—figure supplement 3), which support our previous conclusions. The new CD data show that WT and I9A have similar levels of helicity in buffer solution and in the presence of lipid vesicles. The loss-of-function mutant G4W showed lower levels of helicity. Oriented CD (OCD) results also showed agreement between WT and I9A, while G4W again showed changes; in this case, the OCD spectrum of G4W showed less transmembrane features compared to WT, as revealed by a ratio closer to 1 of the ellipticity at 208 and 225 nm. We attribute the decrease in overall OCD signal to the reduced level of overall helicity observed in the CD result of G4W. These results are now discussed into the manuscript. We performed native-PAGE experiments, but this technique was not able to resolve any oligomers for CL, for reasons that we don’t fully understand. 3) Please explain the reasoning behind changing lipid compositions in various experiments. Is it possible that these membrane changes may impart differences on the observations? Please elaborate on this. The reviewer is correct in thinking that changes in lipid composition could potentially affect the experimental results. To address this potential problem, we have repeated the OCD experiments. Initially these were performed using lipid bilayers composed of cholesterol, PE and PC lipids. The updated figure 5C shows data performed in POPC, which shows similar results. With regards to the rest of experiments, DOPC was used for the AFM experiments because we have had more success with this lipid spreading on the mica surface than with POPC. However, we do not anticipate qualitative changes in experimental results between DOPC and POPC bilayers. The new experiments allow for a better comparison between experimental results, as all were performed in lipids of identical headgroup composition. Reviewer #1 (Recommendations for the authors): Specific queries/requests for revision to what is overall a fine manuscript, in my opinion: – A really confusing aspect of the authors' interpretation is that they postulate a mechanism by which linear polymers of octamers can land on the membrane to form "rimmed pores" (see Figure 8). This raises the question of what defines the size of the polymers in solution. If these polymers are in equilibrium, the probability would maximum for either the shortest unit (an octomer) or to a maximum size, which in practice means that the size distribution would be determined by some kinetic trapping. In that case, the polymer size is expected to be strongly dependent on detailed experimental protocols and not be very robust. And I would expect that the size/area distribution for the "rimmed pores' would be much wider than for the "unrimmed pores", since the latter have a area that is (to within some flexibility) defined by the loop-shaped polymers in solution. Figure 3C shows some difference in area distributions, but it is far from clear how robust this areal analysis is given the difference in pore profiles. Remarkably, the AFM data in Figure 3A, B, D suggest that rimmed and unrimmed pores have very similar areas, suggesting that their size is set by a very similar assembly mechanism. The manuscript conclusions should be clarified, substantiated or adjusted in light to this. Another way of interpreting this is by noting that the assembly mechanism appears relatively robust, with the total pore assembly being rather robust against whether that assembly happens in solution or on the membrane. One of the conclusions put forth in the Discussion section is that the rimmed pores could arise from a conformational change of unrimmed pores. Thus, it is unsurprising that the areas of the rimmed and unrimmed pores are similar. Indeed, if our hypothesis is correct, we expect the area of the rimmed pores to be slightly smaller, due to asymmetry of the fundamental subunit. A slight area reduction is consistent with our AFM data comparing unrimmed and rimmed pores (Figure 3C). The kinetics of the loop assembly itself are intriguing and under investigation, but outside the scope of this work. However, we have added a new section at the end of the discussion where we mention that the loops that we observed might not be in equilibrium, and hence are under kinetic control. We stand behind the robustness of our comparison between WT and the two mutants, as experiments were performed under identical conditions. Reviewer #2 (Recommendations for the authors): While the majority of the presented data is clear and easily accessible several additions could benefit the reader: 1. The sequence of the peptide should be given in the text early on, currently is only shown in figure 6 and not well referenced in the text. The sequence of WT CL has been introduced into the manuscript, at the beginning of the Methods section. 2. How the peptide was prepared (synthesis) is also not clearly mentioned in the text. Details on the synthesis of the peptides can be found in the Peptide Preparation section of the Methods. 3. Figure 1A showing an SDS-PAGE of the peptide is not well explained. Is this a standard SDS-PAGE where the sample was boiled? In addition, a native PAGE could be shown to visualize other oligomeric species that are not resistant to SDS-PAGE. We have introduced additional detail on how the SDS-PAGE experiment was performed. The legend of Figure 1 now describes that the samples were not boiled. We appreciate the suggestion of the reviewer to perform native PAGE experiments. We have tried for a long time to carry out these experiments, but in our hands, they did show a single band for CL; therefore, this technique apparently cannot be used to study CL oligomerization. 4. In addition, the circular dichroism measurements of the bulk of peptide in solution is hard to interpret as a mixture of different species. If possible, one would expect that the oligomers and polymers could be analyzed separately (after separation by gel filtration or other techniques). We followed the suggestion of the reviewer, and performed gel filtration chromatography to separate different oligomeric species of CL. However, the results were not satisfactory. When we performed the experiment in standard buffer, with 150 mM NaCl, we observed no peaks at all, suggesting unspecific interactions of the peptide with the column matrix. Performing FPLC experiments at lower ionic strength did not yield robust results either. It therefore does not seem that gel filtration can be used to isolate the CL oligomers observed in solution. 5. Figure 3 AB shows AFM images of rimmed and unrimmed pores in two separate panels. If one image could be shown with both types of pores it would strengthen the message, currently, at a glance at the figure one would assume they are different experimental conditions. We have included a new supplementary figure for this instance (Figure 3 —figure supplement 3) that shows rimmed and unrimmed pores in the same image. 6. Negative stain EM of the polymers on membranes could be shown assuming that they are visible. Cryo-EM would be a better option to see polymers embedded in the membrane if the authors have access to a cryo-EM facility. This would strengthen the paper however cryo-EM could by itself be a follow-up paper. This work lays a foundation for future studies. We agree with the reviewer that employing cryo-EM on the CL membrane system would make a very interesting follow up investigation. 7. Figure 4, solubilizing the bilayer with detergent is an elegant way to image the sample however is hard to rule out that the linear polymers observed are not circular oligomers that are disturbed by the detergent solubilization step or oligomers that polymerize in presence of detergent. In addition, the figure 5B could also show the CL in buffer plus detergent (or solubilized). We thank the reviewer for this observation. Quantification of the area of the polymers showed no significant changes in the polymers caused by the detergent. Based on the reviewer comment, we tested for any potential detergent disturbance by quantification of a second parameter, the fraction of polymers that close into a loop. A table has been added to Figure 4—figure supplement 1 displaying the results of three independent experiments. These results suggest that indeed the detergent might make the small fraction of CL loops even smaller. However, this effect would not change any of the main conclusions derived from this AFM assay, as we also report data where bilayer removal occurred spontaneously (in the absence of detergent). 8. Both mutants should be featured more extensively in the paper, in particular SDS-PAGE (and native), oligomerization state, etc. According to the presented model, the G4W mutant should be able to oligomerize into the building block while losing the ability to form the longer polymers. If this is indeed the case it would help as both controls for the CD and oriented CD as well as for follow-up studies that could try to solve the structure of the building block. We have performed additional experiments of the two mutants, consisting of CD and oriented CD. The new data are presented in Figure 5C and Figure 6-Suppl 3. We also performed native PAGE experiments, but the technique did not yield relevant information as it only showed a single band. 9. Some of the techniques used in the paper could benefit from short introductions. To provide the reader with methodology background we have added several additional references, and included an explanatory sentence on the mass photometry technique (page 5). 10. Some figures do not mention the scale bar size. We thank the reviewer for pointing out this oversight. Scale bar sizes have been added to Figure 8, which were missing. Reviewer #3 (Recommendations for the authors): Please find below comments to the paper and further suggestions to improve it. 1. Please include the whole name of the species in the title: Candida albicans. The manuscript title has been changed accordingly. 2. I believe the name of the protein should be written as 'candidalysin' and not 'Candidalysin', as also used for other toxin names. The capitalization has been changed throughout the manuscript, as suggested. 3. Results section starts that oligomerization of the peptide in solution was indicated by SDS-PAGE, but not much is commented further on the mass on the higher band (8-mer?) or other additional bands and how they were sure they belonged the same peptide (and no potential impurity). Or that if you see the higher band and that it belongs to CL oligomer, it must be a strong complex to resist SDS. What would a simple size exclusion chromatography show? What would NATIVE-PAGE show (higher oligomers) and native-MS? The purity of the CL is higher than 95%, as determined by HPLC, ruling out that any of the highly populated species observed in the SDS-PAGE or AUC data correspond to impurities. SDS-resistant oligomers are not at all uncommon for helical membrane proteins that form oligomers (e.g., the KcsA potassium channel; https://pubmed.ncbi.nlm.nih.gov/16245951/). We followed the reviewer suggestion and performed several iterations of FPLC and native-PAGE experiments with CL. However, the results were inconclusive; no peak at all was observed in FPLC experiments when experiments were performed with physiological salt concentration, as recommended per the column instructions, suggesting artifactual binding between the peptide and the material of the column. When we performed Blue Native PAGE experiments with candidalysin, we could not observe any bands corresponding to oligomers, for reasons that we don’t currently understand. 4. Data that lead to figure 1 show the probability of existence of 8-mers as a single unit. They do not suggest yet that they are ordered as described in the model in Figure 1D. This may be suggested with later results. Anyways, in the model, N- and C-terminus of the peptides should be marked so we can understand the orientation of the peptides in the proposed model of the 8-mer. Please comment on why CC-Type2-II model was used as a base for MD model of CL 8-mer. As suggested by the editor, the 8-meric model has been moved to the Figure 1 —figure supplement 1, where we now identify the N- and C-termini. We thank the reviewer for giving us a chance to clarify the construction of the octamer model. In the new Figure 1 —figure supplement 2, we show the isotope spacing roughly corresponding to z = +8, indicating that the most abundant species is n/z = 8/8 (an octamer with +8 charges). Our assignments were consistent with the ion mobilities of species with the same number of charges but smaller in size (n/z = 7/8) and species with the same size but higher charge state (n/z = 8/9). We modeled the octamer by taking into account two pieces of evidence: (a) the circular dichroism data showed that CL has α-helix structure, and (b) the homology modeling using ROSETTA that also suggested that the peptide monomer is α-helical. Thus, we start with an α-helix monomeric unit and construct an octamer. To do so, we searched the RCSB databank for α-helix multimers. The hits included 1PI7, 2H6Y, 3R3K, 6O35, 6G56, and 6G67. We then used EMBOSS to align the primary sequence of CL with the primary sequences of the structures from the RCSB. The best alignment was obtained with 6G67 which is a parallel eight-helix coiled coil CC-Type2-II. We then threaded the primary sequence of CL onto the backbone of 6G67 and minimized the structure with molecular dynamics (MD) using the Gromacs software and the CHARMM force field. Finally, we calculated the theoretical collision cross-section (CCS) of the octamer model and compared it with the experimental CCS. It appears that the theoretical CCS (in helium; 2500 Å2) is in an excellent agreement with the experimental CCS (2539 Å2). We used the Mobcal software and the trajectory method to compute the theoretical CCS. The primary sequence alignments of CL and candidate peptides from the RCSB databank are shown in Author response image 2.
Author response image 2.
5. Analytical UC results. 'The sedimentation velocity results reveal a low sedimentation peak, likely corresponding to a CL monomer (8), and several larger assemblies, in agreement with the IM-MS data analysis.' Why is reference 8 here quoted? Please mark more exactly on Figure 1E what you describe in the text (what is monomer (1 peptide?), what is 8-mer etc). What exactly is meant by 'several larger assemblies, in agreement with the IM-MS data analysis'? Please described in a quantitative manner. The citation of reference 8 has been removed, as it was out of place. We purposely avoided to try to correlate the AUC peaks observed at 2 S, 4.5 S and 9 S with specific oligomeric states, as we suspect that the different oligomeric states of CL are dynamically interacting in the time resolution of the AUC experiments. In interacting systems, the boundaries are “reaction” boundaries and not species (Ann N Y Acad Sci; 1969 Nov 7;164(1):192-225. doi: 10.1111/j.1749-6632.1969.tb14039.x.). According to this, unless you have a kinetically frozen system, the sedimentation coefficients cannot be accurately explained as species, as they merely represent the extent of reaction. Therefore, to avoid an erroneous interpretation, we think it is safer to acknowledge that AUC might not be able to quantitatively identify the identity of the oligomers we observe. 6. Figure 2A/B. Please use either expression 'loop' or 'ring', band not mixed. We thank the reviewer for identifying this oversight. Figure 2 has been adjusted accordingly. 7. Page 7 of combined PDF: Taken together, these results support the notion that CL assembles into an 8-mer in solution. … and polymers of 8-mer, right? That is correct, but we found it was clearer to instead make this point at the end of the next short paragraph. 8. Can you comment on possibility (or impossibility) of head-to-head dimerization of 8-mers? We are happy to speculate! One can certainly contemplate the possibility of head-to-head dimers. However, in this situation polymer growth would require two types of interactions, head-to-head and tail-to-tail, instead of one. However, these two interaction modes would have to overcome electrostatic repulsion, as both the Nt and Ct would be charged at neutral pH. We are of the philosophical opinion that Nature is more likely to find the easiest solution, i.e. only head-to-tail. Despite any hypotheses that we might have, the fact is that we don’t have data to support either orientation possibility for 8-mer dimerization. We indicate this in the updated version of the manuscript (in the results and the new Limitations of the Study s in the Discussion). 9. It is rather hard to understand Figure 5A. Please, comment on this: 'Specifically, the modeled areas predict that unrimmed pores contain six to eight head-to-toe 8- mers, while rimmed pores are formed by six to twelve side-to-side 8-mers.' How do you explain this difference between unrimmed and rimmed in terms of 8-mer copy No (6-8 and 6-12 8-mers, respectively)? If the unrimmed ends up as the rimmed and the rimmed could have more 8-mers than unrimmed? Discussion of the correlation between the inner area of the simulated loops and the pores has been updated. To guide the reader, a new cartoon is included in Figure 5A, which directly shows the measurements being compared. 10. Figure 5B. Which lipids were used? What type of lipid vesicles? As described in the methods, we used LUVs for the experiment. The lipid was POPC. 11. Figure 5B shows that CL forms, as expected (3), an a-helical structure in solution, as evidenced by the spectral minima at 208 and 222 nm, and that the presence of lipid vesicles promote modest additional helix formation. Please comment 'additional helix formation', what could contribute to this: Elongation of the peptide helices (some of it is not structured as seen from the model)? More peptides included, more 8-mer subunits? We have introduced in the manuscript that it is possible that the additional helical formation might result from an elongation of the helix. 12. Model of the dimer of 8-mers, Suppl Figure 6. How was the model prepared? Please mark N and C termini. Is the depicted dimer head-to-toe? Hard to see. In the Molecular Dynamics Simulation section, we describe how the 16-mer model was obtained. Briefly, starting from the octamer, we manually align the two octamer units in different orientations (head-to-head, head-to-toe, toe-to-toe) and then performed 45-ns simulations in explicit water using the GROMACS software and the CHARMM force field. The resulting structure of the head-to-toe, which is the most stable, is shown below. We have added a Figure 6—figure supplement 1, which contains the detailed figure of two 8-mers interacting in a head-to-toe orientation, where the N-termini are highlighted in red, and the C-termini in blue. More importantly, we noted that in the IM-MS data of m/z 3311, there is another major feature with shorter arrival time than the octamer. Based on the difference in arrival time between the two features, the left feature should be a larger oligomer than the octamer (in IM-MS, higher-order oligomers travel faster than smaller one due to the effect of charges outweighs the effect of size). Now, if we assign the feature to a 16-mer, the experimental CCS is 4446 Å2. We computed the theoretical CCS of the 16-mer model from MD and the theoretical CCS is 4517 Å2. 13. Page 11 of the merged PDF: 'Our 8-mer model predicts that the Nt is slightly kinked (Figure 1D), and glycine residues confer flexibility to -helices (18).' There is something missing in this sentence. Please rewrite. The first part is saying one thing (from the model) and the other part something else. We have tightened the language of the sentence. 14. Also page 11: 'We reasoned that mutation of residue G4 (Figure 6A), located at the Nt kink, might hamper CL polymerization.' Could it also hamper helix-helix interaction with 8-mer? Or when in the rimmed pore? https://www.ncbi.nlm.nih.gov/pmc/articles/PMC1300449/pdf/10465772.pdf The new language of this sentence includes the possibility of disturbance of the 8-mer. 15. Please provide CD spectra for G4W and I9A, to correct folding of mutants (and if comparable to WT) These data are now provided, as a new Figure 6—figure supplement 3. 16. Why in AFM DOPC was used and POPC for calcein release studies? And then POPC/POPE/cholesterol in OCD? Is there any lipid specificity? Usage of lipids between different approaches should be (more) consistent. As described above, we have repeated the OCD experiments in the lipid DOPC to increase lipid consistency. These results are shown on Figure 5C. 17. Please provide info on orientation of the peptides (N and C termini). Add scale for AFM images. In the figure legend: 'Upon insertion, pores exist in a dynamic equilibrium between unrimmed and rimmed pores, which cause cellular toxicity.' Are only the rimmed pores functional (transmembrane)? Please state clearly. Would you expect any conformational changes in the rimmed pore – in terms of elongation of helices in comparison to unrimmed (CD spectra?) Can you comment on energy cost from going from unrimmed form to the rimmed form? We have introduced into the manuscript further discussion with regards to the relative toxicity of rimmed and unrimmed pores. As with regards of a helical extension being part of the conformational change, it is certainly an interesting possibility, but out data cannot resolve it. We think that both types of pores would be functional (able to permeate membranes), but the rimmed pore would probably be slightly more stable. Transmembrane pores are difficult to identify in AFM due to tip size constraints. This is mentioned on page 7 of the manuscript. A study of the energetic landscape of the peptides in the lipid bilayer would be very interesting. Such studies are challenging (usually involving force spectroscopy) and beyond the scope of this work. Any comments on the energetics of the conformational change undergone by the CL assemblies cannot be made at this point based on the experiments performed. 18. General question: what is more correct to say: unrimmed or non-rimmed? Good point! We think that both options are similarly correct. We prefer “unrimmed”, as we find it easier to pronounce than the alternative proposed. 19. Page 15 and general: Are the pores (unrimmed and rimmed) homogeneous in size? What would be the size in nm? Are they really as big as those of CDCs? To me, they look significantly smaller. As shown by the area histograms (Figure 3C), the unrimmed pores are slightly larger than the rimmed pores and have a broader distribution of areas. In terms of overall size, CL pores indeed exhibit diameters <80 Å, whereas CDCs are much bigger (~300 Å, https://doi.org/10.1016/j.bbamem.2015.11.017). The discussion has been modified to more precisely talk about pore dimensions. 20. Monomeric forms of CDCs (perfringolysin) is 50-60 kDa, in the text it sounds as this was the Mw of the pore. First you compare the size of CL pores to CDC pores (huge) and in the next sentence you turn to hemolysins (which are 10x smaller than of CDCs and are completely different to CDC). It sounds confusing. Please revise this.The pores of CDCs and hemolysins are very different to those of CL, the mechanism of pore formation is very different (to the one proposed by you). Hemolysins, CDC, MACPF etc undergo large conformational changes upon pore formation. No conformational changes in CL case? Within 8-mers? What about switching between the flat polymers to upward position of 8-mer (unrimmed vs rimmed)? The relevant section of the manuscript has been clarified. We emphasize (i) that it is the difference between CL and these other peptides or protein systems that we wish to highlight and (ii) the CL mechanism is novel to our knowledge. We define that a small conformational switch, in the form of a conformational swell, occurs when rimmed pores are formed. 21. Page 15. Such structure is reminiscent of the vestibule of – hemolysin or the perimeter of pores formed by the N-terminal segment of gasdermin-D. What did you mean here? Is there a vestibule in your pore? Your model of CL pores is completely different and can not be directly compared to hemolysin or gasdermin etc. Unless you have better structural data, e.i. cryoEM. What do you mean by 'perimeter'? What is this in nm? We have modified the text to clarify that CL pores do not contain a vestibule. We also removed the comment on the perimeter, as apparently it was not clear. 22. Page 16. The 8-mer might rotate because the three K residues located at the Ct … (Figure 6A) are expected to be interacting with lipid molecules in the rimmed pore configuration. Please, elaborate on this? How exactly you propose for helices in 8-mer to be oriented (in either horizontal or vertical orientation). This sentence has been expanded in the manuscript to clarify this point. 23. Page 16. it. This behavior contrasts with the arcs formed by suilysin, as these rigid open polymers were able to remove lipid molecules from the bilayer to cause perforations (20). Arcs in suilysin are completely different than in your case in terms os structure (built by protomers). We agree with the reviewer. The mechanism of CL pore formation appears to be distinct from that of the suilysin arcs that have been reported previously. The discussion has been revised accordingly. 24. Methods should be described in the same order as presented in the Results section. As suggested, the Methods section has been re-ordered to agree with how the experiments were presented in the Results section. 25. Peptide preparation: please avoid using statements such as 'were prepared as described previously (31, 32)' Please provide a brief description how you did it. All used program, chemicals and equipment should be referenced (paper or manufacturer etc) SEDFIT (?), carbon grids, protein standards (which ones). This point has been fixed. 26. Preparation of LUVS: what was the filter size? A new table is included in the manuscript, per eLife requirements, containing this information. 27. OCD: The amount of lipid on each slide was 85.3 nmol, Concentration of the lipid was calculated based on which lipid? The number of moles refers to total amount of lipid, and the concentration was calculated for the average molecular weight of the three lipids.
Key resources table
Reagent type (species) or resourceDesignationSource or referenceIdentifiersAdditional information
Software, algorithmAgilent 6560 IMS-QTOF SoftwareAgilent Technologies
Software, algorithmOrigin ProOriginUsed to graph IMS-MS data
Software, algorithmVisual Molecular Dynamics (VMD) http://www.ks.uiuc.edu/Research/vmd/
Software, algorithmEMBOSSEMBL-EBI
Software, algorithmGROMACS 4.6.7GROMACS
Chemical compound, drugAmmonium Acetate, UltrapureVWR631-61-8
Chemical compound, drugLC-MS WaterSigma-Aldrich 7732-18-5
Cell line (Homo sapiens)Buccal squamous cell carcinomaECACCTR146ECACC 10032305
AntibodyGoat-anti mouse IRDye 680 (Goat polyclonal)LI-COR925–680701:10,000
AntibodyPhospho-MKP1 (Rabbit monoclonal)Cell Signaling Technology2857 S1:1,000
Antibodyc-Fos (Rabbit monoclonal)Cell Signaling Technology2250 S1:500
AntibodyGoat-anti rabbit IRDye 800 (Goat polyclonal)LI-COR926–322111:10,000
Antibodyβ-actin (mouse monoclonal)ABCAMab62761:1000
Peptide, recombinant proteinWild-Type CandidalysinPeptide 2.0CL
Peptide, recombinant proteinI9A CandidalysinPeptide 2.0I9A
Peptide, recombinant proteinG4W CandidalysinPeptide 2.0G4W
Chemical compound, drugPOPCAvanti Polar Lipids850457 C
Chemical compound, drugDOPCAvanti Polar Lipids850375 P
Chemical compound, drugCalceinMP02190167-CF
Software, algorithmDiscover MPRefeyn version 2.2.0
Software, algorithmAcquire MPRefeyn version 2.2.0
Software, algorithmSEDFITNIH
Software, algorithmImage StudioLI-COR
Chemical compound, drugn-Dodecyl-beta-D-MaltosideMillipore SigmaD4641DBM
Software, algorithmIgor Pro 7.08Wavemetrics
Software, algorithmIgor Pro 6.38Wavemetrics
Software, algorithmAsylum AFM SoftwareOxford instrumentsVersion 16
OtherAFM tipsOlympusSee AFM Materials and methods Section
  43 in total

Review 1.  Invasive Candidiasis.

Authors:  Bart Jan Kullberg; Maiken C Arendrup
Journal:  N Engl J Med       Date:  2015-10-08       Impact factor: 91.245

2.  The negative charge of the membrane has opposite effects on the membrane entry and exit of pH-low insertion peptide.

Authors:  Haden L Scott; Vanessa P Nguyen; Daiane S Alves; Forrest L Davis; Kristen R Booth; Jordan Bryner; Francisco N Barrera
Journal:  Biochemistry       Date:  2015-02-27       Impact factor: 3.162

Review 3.  Atomic force microscopy to elucidate how peptides disrupt membranes.

Authors:  Katharine Hammond; Maxim G Ryadnov; Bart W Hoogenboom
Journal:  Biochim Biophys Acta Biomembr       Date:  2020-08-21       Impact factor: 3.747

4.  Colorimetric determination of phospholipids with ammonium ferrothiocyanate.

Authors:  J C Stewart
Journal:  Anal Biochem       Date:  1980-05-01       Impact factor: 3.365

5.  Mechanism of Action of Peptides That Cause the pH-Triggered Macromolecular Poration of Lipid Bilayers.

Authors:  Sarah Y Kim; Anna E Pittman; Elmer Zapata-Mercado; Gavin M King; William C Wimley; Kalina Hristova
Journal:  J Am Chem Soc       Date:  2019-04-10       Impact factor: 15.419

6.  A Novel Soluble Peptide with pH-Responsive Membrane Insertion.

Authors:  Vanessa P Nguyen; Daiane S Alves; Haden L Scott; Forrest L Davis; Francisco N Barrera
Journal:  Biochemistry       Date:  2015-10-24       Impact factor: 3.162

7.  Method of oriented circular dichroism.

Authors:  Y Wu; H W Huang; G A Olah
Journal:  Biophys J       Date:  1990-04       Impact factor: 3.699

8.  Processing of Candida albicans Ece1p Is Critical for Candidalysin Maturation and Fungal Virulence.

Authors:  Jonathan P Richardson; Selene Mogavero; David L Moyes; Mariana Blagojevic; Thomas Krüger; Akash H Verma; Bianca M Coleman; Jacinto De La Cruz Diaz; Daniela Schulz; Nicole O Ponde; Giulia Carrano; Olaf Kniemeyer; Duncan Wilson; Oliver Bader; Simona I Enoiu; Jemima Ho; Nessim Kichik; Sarah L Gaffen; Bernhard Hube; Julian R Naglik
Journal:  mBio       Date:  2018-01-23       Impact factor: 7.867

9.  Candidalysin is a fungal peptide toxin critical for mucosal infection.

Authors:  David L Moyes; Duncan Wilson; Jonathan P Richardson; Selene Mogavero; Shirley X Tang; Julia Wernecke; Sarah Höfs; Remi L Gratacap; Jon Robbins; Manohursingh Runglall; Celia Murciano; Mariana Blagojevic; Selvam Thavaraj; Toni M Förster; Betty Hebecker; Lydia Kasper; Gema Vizcay; Simona I Iancu; Nessim Kichik; Antje Häder; Oliver Kurzai; Ting Luo; Thomas Krüger; Olaf Kniemeyer; Ernesto Cota; Oliver Bader; Robert T Wheeler; Thomas Gutsmann; Bernhard Hube; Julian R Naglik
Journal:  Nature       Date:  2016-03-30       Impact factor: 49.962

10.  A variant ECE1 allele contributes to reduced pathogenicity of Candida albicans during vulvovaginal candidiasis.

Authors:  Junyan Liu; Hubertine M E Willems; Emily A Sansevere; Stefanie Allert; Katherine S Barker; David J Lowes; Andrew C Dixson; Zhenbo Xu; Jian Miao; Christian DeJarnette; Helene Tournu; Glen E Palmer; Jonathan P Richardson; Francisco N Barrera; Bernhard Hube; Julian R Naglik; Brian M Peters
Journal:  PLoS Pathog       Date:  2021-09-10       Impact factor: 6.823

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.