Simon A Levy1,2,3, Gabrielle Zuniga1,2,3, Elias M Gonzalez1,2,3, David Butler4, Sally Temple4, Bess Frost1,2,3. 1. Barshop Institute for Longevity and Aging Studies, University of Texas Health San Antonio, San Antonio, TX 78229, USA. 2. Glenn Biggs Institute for Alzheimer's and Neurodegenerative Diseases, University of Texas Health San Antonio, San Antonio, TX 78229, USA. 3. Department of Cell Systems and Anatomy, University of Texas Health San Antonio, San Antonio, TX 78229, USA. 4. Neural Stem Cell Institute, Rensselaer, NY 12144, USA.
Abstract
Tau protein aggregates are a defining neuropathological feature of "tauopathies," a group of neurodegenerative disorders that include Alzheimer's disease. In the current study, we develop a Drosophila split-luciferase-based sensor of tau-tau interaction. This model, which we term "tauLUM," allows investigators to quantify tau multimerization at individual time points or longitudinally in adult, living animals housed in a 96-well plate. TauLUM causes cell death in the adult Drosophila brain and responds to both pharmacological and genetic interventions. We find that transgenic expression of an anti-tau intrabody or pharmacological inhibition of HSP90 reduces tau multimerization and cell death in tauLUM flies, establishing the suitability of this system for future drug and genetic modifier screening. Overall, our studies position tauLUM as a powerful in vivo discovery platform that leverages the advantages of the Drosophila model organism to better understand tau multimerization.
Tau protein aggregates are a defining neuropathological feature of "tauopathies," a group of neurodegenerative disorders that include Alzheimer's disease. In the current study, we develop a Drosophila split-luciferase-based sensor of tau-tau interaction. This model, which we term "tauLUM," allows investigators to quantify tau multimerization at individual time points or longitudinally in adult, living animals housed in a 96-well plate. TauLUM causes cell death in the adult Drosophila brain and responds to both pharmacological and genetic interventions. We find that transgenic expression of an anti-tau intrabody or pharmacological inhibition of HSP90 reduces tau multimerization and cell death in tauLUM flies, establishing the suitability of this system for future drug and genetic modifier screening. Overall, our studies position tauLUM as a powerful in vivo discovery platform that leverages the advantages of the Drosophila model organism to better understand tau multimerization.
The deposition of tau into fibrillar aggregates is a hallmark of a host of neurodegenerative diseases, which include Alzheimer’s disease, collectively termed “tauopathies” (Arendt et al., 2016). A prevailing hypothesis to explain the stereotypical temporal pattern of tau deposition in Alzheimer’s disease (Braak and Braak, 1991; Braak et al., 2011) is the prion hypothesis, which posits that small, mobile multimeric tau seeds propagate misfolding of native tau between cells (Frost and Diamond, 2010). While the prion hypothesis of tauopathy has been validated in various systems (Clavaguera et al., 2009, Frost et al., 2009a, Frost et al., 2009b, Vaquer-Alicea and Diamond, 2019), the initial steps that lead to the formation of pathogenic tau seeds are still incompletely understood.A barrier to gaining better insight into the biological underpinnings of tau multimerization and to developing strategies to target this process is the difficulty of quantifying active tau multimerization in a living animal. Current in vivo approaches rely mainly on single time points with postmortem analyses of brain tissue using either histology or western blotting. Current cell-based approaches typically rely on monocultures that do not accurately model the myriad cell types in a living brain and often utilize cell types that are not present in the brain. There is a need for in vivo platforms that enable us to measure tau multimerization in a living, aging brain and to examine the dynamics of tau multimerization over time. Biochemically, protein-protein interaction lies at the core of tau multimerization and, as such, can be measured using techniques aimed at detecting protein-protein interactions. Split-protein complementation assays are a set of such techniques that include split-luciferase assays as well as fluorescence-based approaches (Villalobos et al., 2007). Split-luciferase assays are based on the concept that fragments of the luciferase enzyme can recover partial activity and emit bioluminescence when brought into close proximity to one another and supplied with D-Luciferin as a substrate. They have been used to quantify protein-protein interactions both in cell culture and in vivo (Naik and Piwnica-Worms, 2007).Building upon previous work utilizing a split-luciferase approach to detect tau-tau interactions in cultured cells (Sanders et al., 2014), we have developed an in vivo platform to quantify tau multimerization in the adult Drosophila brain. Our model, which we name tauLUM, provides a readout of tau multimerization and responds to both pharmacological and genetic interventions. Performing these studies in a living, aging Drosophila brain allows experiments investigating aging-related processes, as aging is the greatest risk factor for tauopathies.
Results
TauLUM is expressed in neurons and causes cell death in the adult Drosophila brain
We created Drosophila that transgenically express the disease-associated (Hutton et al., 1998; Lewis et al., 2000) P301L variant of full-length 2N4R human MAPT, hereafter referred to as “tau,” fused to either the C-terminal (CLuc) or N-terminal (NLuc) portion of the luciferase enzyme (Figure 1A). In these flies, which we refer to as tauLUM, multimerization of tau protein brings the NLuc and CLuc fragments together and allows them to emit bioluminescence in the presence of the luciferase substrate D-Luciferin (Figure 1B). We also created a non-multimerizing genetic control for the tauLUM system, which we term EGFPLUM. This control system features fusion of the NLuc and CLuc fragments to transgenic EGFP rather than transgenic tau (Figure 1A). Both tauLUM and EGFPLUM were created using site-directed integration of transgenes into the same location within the Drosophila genome to control for any positional effects of gene insertion. All transgenes are expressed pan-neuronally using the elav-Gal4 promoter.
Figure 1
TauLUM and EGFPLUM systems
(A) Gene models of the transgenes used for tauLUM and EGFPLUM systems.
(B) Schematic overview of the tauLUM system.
(C) Protein expression in EGFPLUM and tauLUM flies at 1 and 10 days of age by western blotting.
(D) Tau and EGFP protein expression in EGFPLUM and tauLUM flies at 1 day of age based on immunofluorescence.
(E) Native gel blotting reveals high molecular weight smear in tauLUMDrosophila at 1 and 10 days of age.
(F) EGFPLUM flies do not exhibit significant EGFP multimerization.
(G) Low levels of cell death in 1-day-old tauLUM and EGFPLUMDrosophila assayed by TUNEL staining.
(H) Increased levels of cell death in 10-day-old tauLUM flies compared with EGFPLUM.
(G and H) n = 6 per group. Data are presented as mean ± SEM. (G) One-way ANOVA with Dunnett’s post-hoc test. (H) One-way ANOVA with Tukey’s post-hoc test. ∗∗∗∗p < 0.0001.
TauLUM and EGFPLUM systems(A) Gene models of the transgenes used for tauLUM and EGFPLUM systems.(B) Schematic overview of the tauLUM system.(C) Protein expression in EGFPLUM and tauLUM flies at 1 and 10 days of age by western blotting.(D) Tau and EGFP protein expression in EGFPLUM and tauLUM flies at 1 day of age based on immunofluorescence.(E) Native gel blotting reveals high molecular weight smear in tauLUMDrosophila at 1 and 10 days of age.(F) EGFPLUM flies do not exhibit significant EGFP multimerization.(G) Low levels of cell death in 1-day-old tauLUM and EGFPLUMDrosophila assayed by TUNEL staining.(H) Increased levels of cell death in 10-day-old tauLUM flies compared with EGFPLUM.(G and H) n = 6 per group. Data are presented as mean ± SEM. (G) One-way ANOVA with Dunnett’s post-hoc test. (H) One-way ANOVA with Tukey’s post-hoc test. ∗∗∗∗p < 0.0001.Based on western blotting, we observe robust expression of tauP301L-CLuc, tauP301L-NLuc, EGFP-CLuc, and EGFP-NLuc fusion proteins in Drosophila heads at days 1 and 10 of adulthood (Figure 1C). The lower intensity of NLuc fusion protein bands compared with CLuc is likely due to positional effects of transgene insertion sites. Additionally, immunofluorescence-based detection of tau and EGFP in 1-day-old tauLUM and EGFPLUM flies shows widespread expression of transgenes in Drosophila neurons (Figure 1D). We next asked whether the transgenic tau in tauLUM forms multimeric species. Native gel electrophoresis performed without SDS to preserve quaternary structure revealed a smear of high molecular weight tau species (Figure 1E), indicative of multimerization at both 1 and 10 days of age. EGFPLUM flies did not exhibit a high molecular weight smear and only had very faint signal outside of the monomeric bands (Figure 1F). As proteins are not linearized in SDS-free conditions, exact molecular weights of the various protein species cannot be determined with this technique.While we do not detect significant levels of cell death in tauLUM or EGFPLUM at day 1 of adulthood based on terminal deoxynucleotidyl transferase dUTP nick end labeling (TUNEL) (Figure 1G), we find that TUNEL-positive cells are significantly increased in tauLUM
Drosophila compared with EGFPLUM by day 10 of adulthood (Figure 1H), indicating that the transgenic tau protein has toxic consequences for the Drosophila brain that manifest progressively with age. The amount of neurodegeneration observed in tauLUM flies is comparable to that of flies pan-neuronally expressing tauP301L alone (Figure 1H). We observe similarly increased levels of neurotoxicity in tauLUM animals compared with EGFPLUM controls when quantifying vacuoles in the Drosophila brain (Figure S1). Taken together, these data show that tauLUM and EGFPLUM
Drosophila models have robust expression of their constituent transgenes, that tau, but not EGFP, forms high molecular weight species in the Drosophila brain, and that transgenic overexpression of tau protein in tauLUM leads to progressive cell death.
Luminescence-based quantification of tau multimerization in live tauLUM flies
Having demonstrated that the components of the tauLUM and EGFPLUM systems are expressed as expected and that tauLUM causes neurotoxicity in the Drosophila brain, we next investigated whether the tauLUM model can be used to measure tau multimerization via bioluminescence. A major advantage of a bioluminescence-based platform such as tauLUM is that signal can be acquired from live animals. After being placed on food enriched with D-Luciferin, the substrate for luciferase, the animals were individually placed into wells of a 96-well plate (Figure 2A) at least 30 min prior to signal acquisition in a plate reader. At both 1 and 10 days of age, tauLUM
Drosophila exhibited significantly higher luminescence signal than EGFPLUM control animals (Figures 2B and 2C). The difference in luminescence between tauLUM and EGFPLUM is approximately 0.7 on the logarithmic scale, which corresponds to a linear difference on the order of 5-fold. Importantly, none of the constituent transgenes of tauLUM or EGFPLUM emitted luminescence above that of a wild-type fly when expressed alone, indicating that luminescence emission is specific to protein-protein interaction between NLuc and CLuc fusion proteins (Figure 2B). When normalized to the signal from sex-matched EGFPLUM controls, two-way ANOVA reveals no main effect of sex on the luminescence signal from tauLUM
Drosophila at either 1 or 10 days of age, indicating that sex is not a confounding variable for the tauLUM system (Figure S2).
Figure 2
Quantifying tau multimerization by luminescence
(A) Schematic overview of luminescence experimental setup.
(B and C) Luminescence measurements of EGFPLUM and tauLUM flies at 1 (B) and 10 (C) days of age by plate reader.
(D) Longitudinal measurements of luminescence in EGFPLUM and tauLUM flies by plate reader.
(B–D) n = 16 per group. Data are presented as mean ± SEM. One-way ANOVA with Dunnett’s post-hoc test (B) and Student’s two-tailed unpaired t test (C). ∗∗∗∗p < 0.0001.
Quantifying tau multimerization by luminescence(A) Schematic overview of luminescence experimental setup.(B and C) Luminescence measurements of EGFPLUM and tauLUM flies at 1 (B) and 10 (C) days of age by plate reader.(D) Longitudinal measurements of luminescence in EGFPLUM and tauLUM flies by plate reader.(B–D) n = 16 per group. Data are presented as mean ± SEM. One-way ANOVA with Dunnett’s post-hoc test (B) and Student’s two-tailed unpaired t test (C). ∗∗∗∗p < 0.0001.Since luminescence can be acquired from live Drosophila, we also tested whether tauLUM was amenable to quantifying tau multimerization over time. After placing the animals into wells of a 96-well plate containing food fortified with D-Luciferin, the luminescence signal was acquired every hour for 2 days (Figure 2D). We find that the luminescence signal can be stably acquired over multiple days using this approach and that tauLUM flies consistently emit a higher signal than EGFPLUM control animals. In summary, tau multimerization can be quantified in tauLUM
Drosophila via bioluminescence in vivo either at single time points or repeatedly over time. We find that increased bioluminescence in tauLUM flies precedes increased levels of cell death observed at 10 days of age.
Anti-tau intrabodies reduce tauLUM luminescence and cell death
One of the major strengths of Drosophila as a model organism is its extensive genetic toolkit and the ease with which potential genetic modifiers can be introduced. We next took a genetic approach to assess whether the tauLUM luminescence signal responds to interventions targeting tau multimerization. Intrabodies are transgenically expressed custom antibodies that have been used previously to target huntingtin aggregation (Wolfgang et al., 2005) and tau toxicity (Krishnaswamy et al., 2020) in Drosophila models. Co-expression of tauLUM with an anti-tau intrabody recognizing amino acids 368–391 (Visintin et al., 2002) (Figures 3A and 3B) significantly reduces luminescence-based detection of tau multimerization in 1-day-old Drosophila (Figure 3C). Intriguingly, the effect of the tau intrabody on tau multimerization is no longer present at day 10 of adulthood (Figure 3D), suggesting that tau multimerization overcomes the barrier posed by intrabody interference given enough time. We find reduced cell death in brains of tauLUM animals co-expressing the intrabody at 10 days of age (Figure 3E), indicating that the early effects of the intrabody are sufficient to reduce toxicity later in adulthood. The tau intrabody is not coupled to a degradation signal and was thus not expected to alter overall transgenic tau protein levels. Indeed, we do not observe changes in tau-NLuc or tau-CLuc levels at either 1 or 10 days of age upon co-expression of the anti-tau intrabody (Figures 3F–3H), suggesting that changes in luminescence reflect altered tau-tau interaction rather than a simple reduction in tau protein levels.
Figure 3
Anti-tau intrabodies reduce tau multimerization
(A) Recombinant intracellular antibodies, or intrabodies, contain the variable heavy (VH) and variable light (VL) antigen binding domains of conventional full-length antibodies. Red, light blue, yellow, and dark blue areas represent constant heavy, constant light, VH, and VL domains, respectively.
(B) Anti-tau intrabody was selected against amino acids 151–441, which contain proline-rich regions (RPPs) and microtubule-binding domains (MTBDs). The intrabody recognizes an epitope residing within amino acids 368–391.
(C) Decreased tauLUM luminescence with anti-tau intrabody in 1-day-old flies.
(D) No change in tauLUM luminescence with anti-tau intrabody in 10-day old flies.
(E) Decreased levels of cell death in tauLUM brains expressing anti-tau intrabodies at 10 days of age.
(F) Tau protein levels in tauLUM with or without anti-tau intrabody at 1 or 10 days of age by western blotting.
(G and H) Quantification of western blotting data reveals no change in tau protein levels at 1 (G) or 10 (H) days of age.
(C and D) n = 20 per group; (E, G, and H) n = 6 per group. Data are presented as mean ± SEM.
(C and D) One-way ANOVA with Dunnett’s post-hoc test.
(E) Unpaired two-tailed Student’s t test.
(G and H) Two-way ANOVA with Sidak’s multiple comparisons post-hoc test. ∗∗p < 0.01, ∗∗∗∗p < 0.0001.
Anti-tau intrabodies reduce tau multimerization(A) Recombinant intracellular antibodies, or intrabodies, contain the variable heavy (VH) and variable light (VL) antigen binding domains of conventional full-length antibodies. Red, light blue, yellow, and dark blue areas represent constant heavy, constant light, VH, and VL domains, respectively.(B) Anti-tau intrabody was selected against amino acids 151–441, which contain proline-rich regions (RPPs) and microtubule-binding domains (MTBDs). The intrabody recognizes an epitope residing within amino acids 368–391.(C) Decreased tauLUM luminescence with anti-tau intrabody in 1-day-old flies.(D) No change in tauLUM luminescence with anti-tau intrabody in 10-day old flies.(E) Decreased levels of cell death in tauLUM brains expressing anti-tau intrabodies at 10 days of age.(F) Tau protein levels in tauLUM with or without anti-tau intrabody at 1 or 10 days of age by western blotting.(G and H) Quantification of western blotting data reveals no change in tau protein levels at 1 (G) or 10 (H) days of age.(C and D) n = 20 per group; (E, G, and H) n = 6 per group. Data are presented as mean ± SEM.(C and D) One-way ANOVA with Dunnett’s post-hoc test.(E) Unpaired two-tailed Student’s t test.(G and H) Two-way ANOVA with Sidak’s multiple comparisons post-hoc test. ∗∗p < 0.01, ∗∗∗∗p < 0.0001.
Inhibition of the molecular chaperone HSP90 reduces tau multimerization and cell death in tauLUM
In addition to the ease of genetic manipulation, Drosophila are well suited for pharmacological screening, as drug candidates can be administered by simply mixing them into the food. Our next step was to thus test whether tauLUM activation responds to pharmacological intervention. Tau is a client protein of the molecular chaperone HSP90 (Karagöz et al., 2014), which aids in the folding of tau. We tested whether radicicol, a macrocyclic antibiotic inhibitor of HSP90 (Beljanski, 2007), changes tau multimerization as measured by tauLUM luminescence. After 1 day of treatment, we did not detect a significant change in tauLUM luminescence (Figure 4A). After 10 days of treatment, however, the tauLUM signal in radicicol-treated Drosophila was significantly reduced compared with control animals (Figure 4B). Concurrent with the decrease in luminescence, we also found reduced cell death in the brains of 10-day-old tauLUM animals after HSP90 inhibition (Figure 4C). As with the genetic intervention described above, radicicol treatment does not significantly alter tau protein levels at either time point (Figures 4D–4F), indicating that the radicicol-induced decrease in luminescence reflects a change in tau-tau interaction. To verify that the difference in luminescence between vehicle- and radicicol-treated tauLUM
Drosophila is not due to changes in available substrate because of altered feeding, we placed tauLUM animals on food containing blue dye and measured food intake by absorbance (Figure S3). We observed no difference in food intake between Drosophila fed vehicle or radicicol, indicating that luminescence differences reflect changes in tau-tau interaction. Taken together, these data indicate that the tauLUM system provides a quantitative measure of tau-tau interaction in vivo that can be modulated by genetic or pharmacological interventions targeting tau to identify new avenues to reduce tau-induced cell death.
Figure 4
HSP90 inhibition reduces tau multimerization
(A) No significant change in tauLUM luminescence after 24 h of radicicol treatment.
(B) Decreased tauLUM luminescence after 10 days of HSP90 inhibition.
(C) Reduced levels of cell death in tauLUM brains after 10 days of HSP90 inhibition.
(D) Tau protein levels in tauLUM animals exposed to either vehicle (0.01% DMSO) or 1 μg/mL radicicol at 1 and 10 days of age by western blotting.
(E and F) Quantification of western blotting data reveals no change in tau protein levels at 1 (E) or 10 (F) days of age.
(A and B) n = 40 per group; (C, E, and F) n = 6 per group. Data are represented as mean ± SEM.
(A–C) Two-way ANOVA with Tukey’s post-hoc test.
(E and F) Two-way ANOVA with Sidak’s multiple comparisons post-hoc test. ∗∗p < 0.01, ∗∗∗p < 0.001, ∗∗∗∗p < 0.0001.
HSP90 inhibition reduces tau multimerization(A) No significant change in tauLUM luminescence after 24 h of radicicol treatment.(B) Decreased tauLUM luminescence after 10 days of HSP90 inhibition.(C) Reduced levels of cell death in tauLUM brains after 10 days of HSP90 inhibition.(D) Tau protein levels in tauLUM animals exposed to either vehicle (0.01% DMSO) or 1 μg/mL radicicol at 1 and 10 days of age by western blotting.(E and F) Quantification of western blotting data reveals no change in tau protein levels at 1 (E) or 10 (F) days of age.(A and B) n = 40 per group; (C, E, and F) n = 6 per group. Data are represented as mean ± SEM.(A–C) Two-way ANOVA with Tukey’s post-hoc test.(E and F) Two-way ANOVA with Sidak’s multiple comparisons post-hoc test. ∗∗p < 0.01, ∗∗∗p < 0.001, ∗∗∗∗p < 0.0001.
Discussion
In this study, we present tauLUM, an in vivo biosensor of tau multimerization. Based on transgenic expression of a split-luciferase system, tauLUM is able to quantitatively detect tau-tau interaction and provide an in vivo luminescence readout that can be measured via plate reader at single time points or over multiple days. Our studies show that the tauLUM signal rises above background levels produced by simply overexpressing a soluble protein fused to a split-luciferase system in neurons, as tauLUM
Drosophila emit a 5-fold increase in luminescence compared with EGFPLUM control animals. We further show that split-luciferase components have negligible levels of background luminescence that do not differ from those of wild-type flies.It is important to note that while tauLUM provides a readout of overall tau multimerization, the system is agnostic regarding the exact nature of multimeric tau. Tau can adopt a range of multimeric species, ranging from dimers and trimers to larger oligomers and filamentous insoluble aggregates (Patterson et al., 2011). All of these types of multimers would be detectable using split-luciferase assays and should be captured by tauLUM. Of note, split-luciferase interactions are reversible and thus do not produce artifacts by artificially stabilizing tau-tau interactions.In its current form, the tauLUM system utilizes the P301L tau mutant. This form of tau has previously been shown to be highly prone to multimerization and seeding of aggregation (Von Bergen et al., 2001; Guo and Lee, 2011; Strang et al., 2017). While wild-type tau exhibited less multimerization potential than P301L tau in these studies, many tauopathies, including Alzheimer’s disease, primarily feature aggregates of wild-type tau. The transgene-linker-luciferase structure of tauLUM transgenes makes the design of transgene sequences for future tauLUM versions straightforward and will allow future work to investigate the differences in multimerization between different tau isoforms and mutant using the tauLUM platform. Furthermore, the modular nature of Drosophila genetics will make it simple to investigate non-neuronal tauopathies by using different genetic driver lines to achieve expression of the tauLUM system in glia or other cell types of interest.As expected, we find elevated numbers of TUNEL-positive cells in the brains of tauLUM flies compared with controls, indicating that transgenic expression of the P301L disease-associated tau mutation causes cell death in Drosophila. The level of cell death detected in tauLUM
Drosophila is comparable to that of flies pan-neuronally expressing tauP301L not fused to luciferase fragments. This finding is consistent with observations in other Drosophila models expressing mutant or wild-type tau in neurons, which exhibit neurodegeneration to varying degrees (Wittmann et al., 2001; Bardai et al., 2018).A major advantage of Drosophila as a model organism is the relative ease of genetic and pharmacological interventions. The large toolkit available for Drosophila genetics allows for the introduction of modifier genes into a model system. In addition, drugs can be delivered to fruit flies by simply mixing them into food. In order to validate the potential of tauLUM as a platform for future discovery of novel regulators and modifiers of tau multimerization, we tested both genetic and pharmacological interventions of tau multimerization and quantified changes in the tauLUM signal. We first employed an anti-tau intrabody approach to genetically interfere with tau-tau interaction. The anti-tau intrabody was transgenically expressed in neurons along with the constituent proteins of the tauLUM system. The intrabody design was based on previous work using an anti-huntingtin intrabody to inhibit huntingtin aggregation in Drosophila (Wolfgang et al., 2005), which ameliorated huntingtin-associated disease phenotypes. We found a decrease in tauLUM luminescence in 1-day-old flies upon co-expression of the anti-tau intrabody, consistent with decreased tau multimerization. However, this effect did not persist through day 10 of adulthood, indicating that the intrabody-mediated interference of tau-tau interactions can be overcome given enough time. We nevertheless find decreased levels of cell death in intrabody-expressing flies at day 10 of adulthood, which suggests that the intrabody’s early effects on tau positively impact cell viability later in adulthood. Since the intrabody used in this study is not fused to a degradation signal that would target tau to the proteasome or lysosome, the most likely mechanism by which it interferes with tau multimerization is steric hindrance upon associating with tau protein.We next tested inhibition of HSP90 as a pharmacological intervention. HSP90 has been shown to promote tau multimerization in vitro (Weickert et al., 2020). In vivo activation of HSP90 leads to increased deposition of hyperphosphorylated and oligomeric tau in mice (Criado-Marrero et al., 2021), as well as a decrease in the number of hippocampal neurons (Shelton et al., 2017). Inhibition of HSP90 in mice has further been reported to mitigate the effects of mutant, but not wild-type, tau (Luo et al., 2007). We would therefore expect inhibition of HSP90 to reduce tau multimerization and lower tauLUM luminescence, which we observe after 10 days of HSP90 inhibition, along with a reduction in cell death. The presence of a non-significant trend toward lower tauLUM luminescence after 1 day of inhibition suggests that the effects of HSP90 inhibition occur on a time scale of several days. Overall, we show that the tauLUM system is able to quantify the impacts of both genetic and pharmacological interventions targeting tau or regulators of tau multimerization.Taken together, our findings showcase the potential of the tauLUM system as a discovery platform to investigate the biological underpinnings of tau multimerization. TauLUM provides a quantitative, in vivo readout of tau-tau interaction that can be acquired at single time points or longitudinally. Furthermore, we use tauLUM to identify two interventions to modulate tau multimerization and lower cell death that leverage two main advantages of the Drosophila model organism, namely the ease of drug delivery and the introduction of genetic modifiers to the system. In both cases, tauLUM is able to quantify the impact of the modifiers and identify differential effects at two distinct time points. The ability to acquire longitudinal measurements also allows the examination of dynamic processes. When combined with the rapid generational turnover and short lifespan of Drosophila, tauLUM is an excellent platform to leverage into future medium-throughput screens of genetic modifiers and pharmacological inhibitors of tau multimerization.
Limitations of the study
The genetic framework we present allows the investigation of tau multimerization in living Drosophila through a luminescence readout. This method is ideally suited for examining the effects of pharmacological and genetic interventions on tau-tau interaction. However, the throughput of the tauLUM system is limited by two factors: first, the need to manually insert flies into the wells of a 96-well plate prior to measurement, and second, the need to have sufficient numbers of flies at the appropriate age and of all experimental groups available on the day of measurement. This means that careful planning of Drosophila crosses is required. While the throughput of tauLUM remains high compared with other in vivo systems and constitutes a net asset to the system—assaying a full 96-well plate of Drosophila is entirely feasible in one experiment—analyzing many different genotypes and treatment groups in sufficient numbers in a single experiment can become technically challenging due to the above constraints. A consideration for longitudinal luminescence measurements is that Drosophila food inside 96-well plates may be a limiting factor for how long an experiment may last. It is necessary to monitor the health of the animals in the plate periodically to ensure their continued access to food and to appropriately exclude animals from analysis should they die prematurely.
STAR★Methods
Key resources table
Resource availability
Lead contact
Further information and requests for resources and reagents should be directed to and will be fulfilled by the lead contact, Bess Frost (bfrost@uthscsa.edu).
Materials availability
All unique and stable reagents generated in this study are available from the lead contact.
Experimental model and subject details
Drosophila genetics and models
Drosophila were housed and all crosses were performed at 25°C with a 12h light/dark cycle. Full genotypes are listed in the Key resources table. Pan-neuronal expression of transgenes was achieved using the Gal4/UAS system with the elav promoter driving expression of the Gal4 transcription factor. elav-Gal4 Drosophila were obtained from the Bloomington Drosophila Stock Center (BDSC #458). Plasmids for TauP301L-NLuc, TauP301L-CLuc, EGFP-NLuc, EGFP-CLuc, and the anti-tau intrabody scFv5 were generated by GeneWiz and inserted into the pUA vector (Addgene #58372) (Han et al., 2014), which contains ten UAS sequences. Drosophila embryo injection of plasmids for PhiC31 integrase-mediated site-specific integration of transgenes was performed by BestGene Inc. NLuc-containing transgenes were inserted at site VK27 (integrase-carrying stock #9744) and CLuc-containing transgenes were inserted at site VK33 (integrase-carrying stock #9759). The intrabody transgene was inserted at site attP1 (integrase-carrying stock #8621) and the tauP301L transgene was inserted at site attP2 (integrase-carrying stock #8622). The sequences for all transgenes used in this study are available in Table S1.
Intrabody generation
GenScript synthesized and codon-optimized the anti-tau single chain fragment variable (scFv) intrabody, #F, originally described by Visintin and colleagues (Visintin et al., 2002). The intrabody was arranged in the following format: Variable heavy chain (VH), flexible linker (Gly4Ser)3, variable light chain (VL), hemagglutinin (HA) epitope tag, and scrambled inactive PEST degron (ACCGEHPIRPPVEDFEESRASSTASAWLANMVQNKPVSDA). Because many intrabodies suffer from reduced cytoplasmic solubility due to the intracellular redox potential and macromolecular crowding (Kvam et al., 2010; Messer and Butler, 2020), the anti-tau intrabodies were fused to a highly charged proteasomal retargeting sequence to increase soluble cytoplasmic expression and improve intracellular functionality (Joshi et al., 2012).
Method details
Drug treatment
Radicicol was prepared as a 10 mg/mL stock solution in DMSO and diluted in liquid fly food cooled to 60°C to a final concentration of 1 μg/mL. For vehicle controls, an equivalent volume of DMSO was diluted in fly food. Drosophila were randomly assigned DMSO or radicicol treatment and placed on drug-containing food from the day of eclosion until the day of measurement.
Immunofluorescence and histology
Drosophila brains were dissected in PBS and fixed for 20 min in methanol. After washing with PBS +0.3% Triton X-100 (PBS-Tr), brains were incubated with blocking buffer (2% w/v milk in PBS-Tr) for 30 min, followed by overnight incubation with primary antibody in blocking buffer at room temperature. After washing with PBS-Tr, brains were incubated with Alexa Fluor conjugated secondary antibody in blocking buffer for 2 h at room temperature. Brains were washed with PBS-Tr again and mounted in DAPI Fluoromount-G (SouthernBiotech #0100-20) to visualize nuclei. Images were acquired by confocal microscopy (Zeiss LSM 880) and analyzed using ImageJ (Schneider et al., 2012).TUNEL staining was performed using the FragEL DNA Fragmentation Detection Kit (EMD Millipore #QIA33) on 4μm sections of formalin fixed, paraffin embedded Drosophila brain tissue. DAB was used to visualize the staining. TUNEL positive nuclei were counted throughout the entire brain by bright-field microscopy.
Western and native gel blotting
For Western blotting, frozen Drosophila heads were homogenized in 15μL 2x Laemmli buffer. One head was used per lane. After boiling for 10 min, samples were run on an Any kD Mini-PROTEAN TGX gel (Bio-Rad #4569033) and equal loading of protein was ascertained using Ponceau S staining. For native gel electrophoresis, five frozen Drosophila heads per lane were homogenized in 15μL Laemmli buffer. Samples were not boiled and were run on an Any kD Mini-PROTEAN TGX gel in SDS-free running buffer. After blotting, membranes were washed in PBS +0.1% Tween 20 (PBS-Tw) and blocked for 15 min at room temperature in blocking buffer (2% w/v milk + PBS-Tw). Membranes were then incubated with primary antibody diluted in blocking buffer overnight at 4°C on a rocker, washed in PBS-Tw, and incubated with an HRP-conjugated secondary antibody diluted in blocking buffer for 2 h at room temperature. Blots were developed using Super-Signal West Femto ECL kit (ThermoFisher #34095) and band intensities were quantified using ImageJ.
Luminescence measurements
End-point measurements: Drosophila were placed on food containing 15mM D-Luciferin (Thermo Scientific #PI88294) in addition to any drug treatments for 24 h. On the day of measurement, flies were anesthetized and transferred to the wells of a 96-well plate. Each well contained one fly. The plate was then covered with a clear plastic adhesive cover (Sigma-Aldrich #Z721417). The flies were left to recover from the anesthesia for 30 min in the plate and transferred to the plate reader, where luminescence signal from each well was integrated for 10 s.Longitudinal measurements: Live Drosophila were placed in 96-well plate wells containing 300μL food with 15mM D-Luciferin. The plate was covered with a clear plastic adhesive cover and small holes were punched above each well to ensure air supply to the animals. The plate was transferred to the plate reader and luminescence signal was integrated for 10 s every hour for two days. The plate was kept in the dark inside the plate reader for the duration of the experiment.
Food intake measurements
On the last day of drug treatment, tauLUM
Drosophila were placed on food containing 1% (w/v) FD&C Blue #1 dye (Fisher Scientific #18-602-610) along with radicicol or vehicle for 45 min. Five flies were placed in each vial with dyed food. After 45 min, the animals from each vial were frozen, and homogenized in 100μL PBS +1% Triton X-100, and centrifuged briefly to pellet debris. The absorbance of the supernatant at 629nm was then measured with a spectrophotometer. Age-matched flies that were placed on dye-free food served as the baseline absorbance measurement and the amount of ingested food was calculated from a standard curve of serial dilutions of dyed food in PBS +1% Triton X-100.
Quantification and statistical analysis
Two-tailed unpaired Student’s t test was used to compare two means and one-way ANOVA with Dunnett’s post-hoc test or two-way ANOVA with Tukey’s or Sidak’s post-hoc test was used to compare multiple means as appropriate. Exact statistical tests for each graph are listed in figure legends. The experimental unit for all experiments was a single fly. Normality tests indicated that tauLUM and EGFPLUM data were distributed lognormally. We therefore first normalized tauLUM luminescence data to EGFPLUM and then log10 transformed the data. All single time-point luminescence data are presented as log10[luminescence(% of EGFPLUM)].
Authors: David W Sanders; Sarah K Kaufman; Sarah L DeVos; Apurwa M Sharma; Hilda Mirbaha; Aimin Li; Scarlett J Barker; Alex C Foley; Julian R Thorpe; Louise C Serpell; Timothy M Miller; Lea T Grinberg; William W Seeley; Marc I Diamond Journal: Neuron Date: 2014-05-22 Impact factor: 17.173
Authors: Marangelie Criado-Marrero; Niat T Gebru; Danielle M Blazier; Lauren A Gould; Jeremy D Baker; David Beaulieu-Abdelahad; Laura J Blair Journal: Acta Neuropathol Commun Date: 2021-04-08 Impact factor: 7.801