Literature DB >> 35873163

Interspecies Isobaric Labeling-Based Quantitative Proteomics Reveals Protein Changes in the Ovary of Aedes aegypti Coinfected With ZIKV and Wolbachia.

Luís Felipe Costa Ramos1, Michele Martins1, Jimmy Rodriguez Murillo2, Gilberto Barbosa Domont1, Danielle Maria Perpétua de Oliveira1, Fábio César Sousa Nogueira1, Rafael Maciel-de-Freitas3,4, Magno Junqueira1.   

Abstract

Zika is a vector-borne disease caused by an arbovirus (ZIKV) and overwhelmingly transmitted by Ae. aegypti. This disease is linked to adverse fetal outcomes, mostly microcephaly in newborns, and other clinical aspects such as acute febrile illness and neurologic complications, for example, Guillain-Barré syndrome. One of the most promising strategies to mitigate arbovirus transmission involves releasing Ae. aegypti mosquitoes carrying the maternally inherited endosymbiont bacteria Wolbachia pipientis. The presence of Wolbachia is associated with a reduced susceptibility to arboviruses and a fitness cost in mosquito life-history traits such as fecundity and fertility. However, the mechanisms by which Wolbachia influences metabolic pathways leading to differences in egg production remains poorly known. To investigate the impact of coinfections on the reproductive tract of the mosquito, we applied an isobaric labeling-based quantitative proteomic strategy to investigate the influence of Wolbachia wMel and ZIKV infection in Ae. aegypti ovaries. To the best of our knowledge, this is the most complete proteome of Ae. aegypti ovaries reported so far, with a total of 3913 proteins identified, were also able to quantify 1044 Wolbachia proteins in complex sample tissue of Ae. aegypti ovary. Furthermore, from a total of 480 mosquito proteins modulated in our study, we discuss proteins and pathways altered in Ae. aegypti during ZIKV infections, Wolbachia infections, coinfection Wolbachia/ZIKV, and compared with no infection, focusing on immune and reproductive aspects of Ae. aegypti. The modified aspects mainly were related to the immune priming enhancement by Wolbachia presence and the modulation of the Juvenile Hormone pathway caused by both microorganism's infection.
Copyright © 2022 Ramos, Martins, Murillo, Domont, de Oliveira, Nogueira, Maciel-de-Freitas and Junqueira.

Entities:  

Keywords:  Aedes aegypti; Wolbachia; Zika virus; immune defense; juvenile hormone; proteome; quantitative

Mesh:

Year:  2022        PMID: 35873163      PMCID: PMC9302590          DOI: 10.3389/fcimb.2022.900608

Source DB:  PubMed          Journal:  Front Cell Infect Microbiol        ISSN: 2235-2988            Impact factor:   6.073


Highlights

● Proteome changes in Ae. aegypti, Wolbachia, and ZIKV interactions ● A great diversity of Wolbachia proteins were quantified in Ae. aegypti ovary ● Mosquito cytoplasmic incompatibility increases during Wolbachia and ZIKV infection ● Juvenile Hormone pathway is modulated by both infections ● Wolbachia enhances Ae. aegypti immune priming mechanism ● ZIKV unsettles the host immune response by reducing antimicrobial peptides production ● Coinfection triggers oxidative stress and a lack of vitellogenin precursors

1 Introduction

Zika virus (ZIKV) is a mosquito-borne arbovirus from the family Flaviviridae and is related to other arboviruses such as dengue (DENV), yellow fever (YFV), West Nile (WNV), and Japanese encephalitis (JEV) (Zimler et al., 2021). It was originally reported in a primate from the Zika forest in Uganda in 1947 (Dick et al., 1952). However, the first large outbreak of ZIKV in humans occurred on the Pacific Island of Yap, in the Federated States of Micronesia in 2007 (Cao-Lormeau et al., 2014). In 2014, ZIKV emerged in the Pacific islands and a few years later invaded the Americas, being firstly identified in 2015 in Bahia state, Brazil (Campos et al., 2015). It became the first major infectious disease linked to adverse fetal outcomes, mostly microcephaly in newborns, and other clinical aspects such as acute febrile illness and neurologic complications, for example, Guillain-Barré syndrome. Such outcomes led the World Health Organization to claim a global public health emergency (Cao-Lormeau et al., 2014). Unfortunately, there are no antivirus therapies or vaccines available to mitigate ZIKV transmission, i.e., the development of effective control methods targeting the mosquito vector must be encouraged. The mosquito Aedes aegypti is the main vector of ZIKV worldwide (Chouin-Carneiro et al., 2016; Ferreira-de-Brito et al., 2016). During infection in female mosquitoes, the virus can be located in different tissues, but mainly in the gut, salivary glands, and ovaries (Sá-Guimarães et al., 2021). Ovaries infection is of paramount importance to maintain the vertical transmission of arboviruses, even if at low rates (Thangamani et al., 2016; Manuel et al., 2020; Nag et al., 2021). Therefore, evaluating physiological and molecular changes in mosquito ovaries due to arbovirus infection, especially those affecting life-history traits related to vertical transmission, might provide new insights to design innovative vector control approaches. Among the strategies to control arbovirus infection in Ae. aegypti, the use of the maternally-inherited endosymbiont Wolbachia pipientis is proving to be efficient due to a unique combination of phenotypes such as cytoplasmic incompatibility (CI), maternal transmission (MT), and viral-blocking (Moreira et al., 2009; Aliota et al., 2016; Dutra et al., 2016; Ant et al., 2018; Nazni et al., 2019; Indriani et al., 2020; Mancini et al., 2020; Ryan et al., 2020; Gesto et al., 2021; Utarini et al., 2021). Although the bacterium Wolbachia is naturally found in >60% of arthropod species, no natural infection is observed in Ae. aegypti (Gloria-Soria et al., 2018), which led to experimental transinfection by microinjection of different Wolbachia strains into mosquito eggs (McMeniman and O’Neil, 2010). After transinfection, Wolbachia is currently located in several tissues and organs of Ae. aegypti mosquitoes and the mechanisms resulting in viral blocking are under investigation. Most likely, it involves the activation of the immune system by oxidative stress and downregulation of host proteins involved in pathways that would help to produce resources essential to the virus life cycle (Ford et al., 2020; Martins et al., 2021; Ogunlade et al., 2021; Pimentel et al., 2021). Besides its effects on arbovirus blocking, many studies showed that Wolbachia presence can present multifold effects on Ae. aegypti fitness that could later be an additional hurdle for Wolbachia establishment. For instance, Wolbachia-infected larvae have more rapid development and higher survivorship (Dutra et al., 2016; de Oliveira et al., 2017) but reduced adult size (Ross et al., 2014), delayed embryogenic maturation, and Wolbachia-infected Ae. aegypti females have lower fecundity, fertility rates, quiescent eggs viability, and vector competence, affecting local invasion patterns (McMeniman and O’Neil, 2010; Dutra et al., 2015; King et al., 2018; Farnesi et al., 2019; Garcia et al., 2019; Allman et al., 2020; Garcia et al., 2020; Lau et al., 2021). Therefore, investigating the interaction network involving mosquito vectors, arboviruses, and Wolbachia could help maintain a long-term stable blocking phenotype in endemic regions (Edenbourough et al., 2021). The proteome can be considered more than a simple translation of the protein-coding regions of a genome, as some post-transcriptional and post-translation modifications generate even millions of proteoforms (Smith et al., 2013). Over the last decades, mass spectrometry-based proteomics has emerged as a powerful tool for identifying and quantifying the proteins contained in a biological sample. It has significantly contributed to unraveling many cellular and organism aspects (Schubert et al., 2017), and highlights features and emergent properties of complex systems under different conditions (Cox and Mann, 2011). To overcome the large overall experimental time, sample consumption, and quantitative variations of proteomics analysis, the isobaric labeling quantitative methods have allowed the examination of multiple samples all at once. Moreover, it increases the throughput of quantification by having a higher multiplex capability, which makes it possible to handle several biological replicates, offering statistical robustness (Chen et al., 2021). A diversity of quantitative methods have already been successfully applied in insects to analyze differentially regulated proteins (De Mandal et al., 2020; García-Robles et al., 2020; Serteyn et al., 2020), including a previous study from our group, where it was able to elucidate different mechanism responses to ZIKV and Wolbachia infection in Ae. aegypti head and salivary glands (Martins et al., 2021). This study applies isobaric labeling quantitative mass spectrometry-based proteomics to quantify proteins and identify pathways altered during either ZIKV or Wolbachia single infection and coinfection with Wolbachia/ZIKV in the Ae. aegypti ovaries. We show that it was possible to identify ZIKV peptides and more than 1000 proteins from Wolbachia in mosquitoes’ ovaries. The present study offers a rich resource of data that helps elucidate mechanisms by which Wolbachia and ZIKV infection in Ae. aegypti can interfere in immune and reproductive aspects.

2 Material and Methods

2.1 Insects

To analyze the Wolbachia and ZIKV infection repercussions on Ae. aegypti proteome, mosquitoes were used from two different sites in Rio de Janeiro (Rio de Janeiro State, Brazil), with a 13 km distance isolated from each other: Porto (22°53′43″ S, 43°11′03″ W) and Tubiacanga (22˚47’06 “S; 43˚13’32 “W). Porto is an area populated by mosquitoes without Wolbachia infection, i.e., wild type. On the other hand, Tubiacanga is the first site in Latin America where a Wolbachia (wMel strain) invasion in Ae. aegypti was established, with more than 90% frequency (Garcia et al., 2019). Eighty ovitraps were used for egg collection (Codeço et al., 2015) with a net distance of 25-50 m apart. Ovitraps were placed over an extensive geographic area to ensure we captured the local Ae. aegypti genetic variability, collecting at least 1500 eggs per site. The eggs were hatched, and the mosquitoes were maintained at the insectary under a relative humidity of 80 ± 5% and a temperature of 25 ± 3°C, with ad libitum access to a 10% sucrose solution. Mosquitoes from the F1 generation were selected for experimental infection.

2.2 ZIKV Strain and Mosquito Viral Infection

Aedes aegypti females were orally infected with the ZIKV strain Asian genotype isolated from a patient in Rio de Janeiro (GenBank accession number KU926309). Local wild Ae. aegypti populations have high vector competence to this ZIKV strain (Fernandes et al., 2016; da Silveira et al., 2018; Petersen et al., 2018). The vector competence of the Porto population was assessed in individuals belonging to the same batch as those used herein. We observed that 100% of ZIKV-infected mosquitoes have a disseminated infection on their bodies i.e., the ZIKV infection rate in ovaries was not directly estimated but the whole body (da Silveira et al., 2018). All the assays were performed with samples containing 3.55 × 106 PFU/ml (Martins et al., 2021). The experimental infection followed the protocol described in detail elsewhere (Martins et al., 2021). Briefly, 6-7 days old Ae. aegypti females from each of the two populations (Tubiacanga and Porto) were orally infected through a membrane feeding system (Hemotek, Great Harwood, UK), adapted with a pig-gut covering, which gives access to human blood. The infective blood meals consisted of 1 ml of the supernatant of infected cell culture, 2 ml of washed rabbit erythrocytes, and 0.5 mM of adenosine triphosphate (ATP) as phagostimulant. The same procedure and membrane feeding apparatus were used to feed control mosquitoes, but they received a noninfectious blood meal, with 1 ml of cell culture medium replacing the viral supernatant. After the experimental infection, we had a total of 152 Ae. aegypti females. Infected mosquitoes were maintained in incubators with a 27 ± 1°C temperature.

2.3 Ethical Approval

Ae. aegypti colonies with Wolbachia are maintained in the lab by blood-feeding of anonymous donors acquired from the Rio de Janeiro State University blood bank. The blood bags were rejected from the bank due to small blood volume. No information on the donors (including sex, age, and clinical condition) was disclosed. The blood was screened for Dengue virus (DENV) using the Dengue NS1 Ag STRIP (Bio-Rad) before use in the mosquito feeding process. The use of human blood was approved by the Fiocruz Ethical Committee (CAAE 53419815.9.0000.5248).

2.4 Sample Preparation and LC-MS/MS

A total of 152 Ae. aegypti mosquitoes were processed, in which 35 females were Wolbachia-infected (W), 42 infected exclusively with ZIKV (Z), 39 were coinfected with both Wolbachia and ZIKV (WZ), and 36 were non-infected with those microorganisms (A). At 14 days post-infection (dpi), each mosquito ovary was extracted from the body according to the previous method (Charlwood et al., 2018). Protein extraction, digestion, iTRAQ labeling, and LC-MS/MS protocol were performed as previously described (Martins et al., 2021). Proteins were extracted by lysis with buffer (7 M urea, 2 M thiourea, 50 mM HEPES pH 8, 75 mM NaCl, 1 mM EDTA, 1 mM PMSF) with the addition of a protease/phosphatase inhibitor cocktail (Roche). Lysates were centrifuged, and the supernatants were transferred to new tubes for protein quantification using the Qubit Protein Assay Kit® fluorometric (Invitrogen), following the manufacturer’s instructions. A total of 100 μg of proteins from each condition were processed. Reduction and alkylation steps were performed using 10 mM dithiothreitol (DTT -GE Healthcare) and 40mM iodoacetamide solution (GE Healthcare). Samples were diluted 10x with 50 mM HEPES buffer, reducing the concentration of urea/thiourea, and incubated with trypsin (Promega) in a 1:50 (w/w, enzyme/protein) ratio at 37°C for 18 hours. The resulting peptides were desalted with a C-18 macro spin column (Harvard Apparatus) and then vacuumed dried. Peptides were labeled with isobaric tags for relative and absolute quantitation (iTRAQ) 4-plex (ABSciex), performed as described in Martins et al. (2021), mixing the tag solutions with sample peptides at room temperature for one hour. Each condition was labeled as follows i) Tag 114 corresponded to sample W (Wolbachia infected); ii) Tag 115 to sample A (none infection); iii) Tag 116 to sample WZ (Wolbachia and ZIKV coinfection); and iv) Tag 117 to sample Z (ZIKV infection). After the labeling, samples were combined and vacuum dried for offline fractionation by HILIC (hydrophilic interaction liquid chromatography) prior to LC-MS/MS analysis. The dried samples were resuspended in acetonitrile (ACN) 90%/trifluoroacetic acid (TFA) 0.1% and injected into Shimadzu UFLC chromatography using a TSKGel Amide-80 column (15 cm x 2 mm i.d. x 3 μm - Supelco), which was equilibrated using ACN 85%/TFA 0.1% (phase A). The peptides were eluted in TFA 0.1% (phase B), and every eight fractions were collected and combined according to the separation and intensity of the peaks. The pools of fractions were dried in a speed vac and resuspended in 0.1% formic acid (FA). LC-MS/MS analysis was performed in an Easy-nLC 1000 coupled to a Q-Exactive Plus mass spectrometer (Thermo Scientific, Waltham, MA, USA). Ionization was performed in an electrospray source with the acquisition of spectra in positive polarity by data-dependent acquisition (DDA) mode, spray voltage of 2.5 kV, and temperature of 200°C in the heated capillary. The acquisition was set as follows: full scan or MS1 in the range of 375 - 1800 m/z, resolution of 70,000 (m/z 200), fragmentation of the 10 most intense ions in the HCD collision cell, with standardized collision energy (NCE) of 30, resolution of 17,000 in the acquisition of MS/MS spectra, the first mass of 110 m/z, isolation window of 2.0 m/z and dynamic exclusion of 45 s. A description of the workflow is presented in .
Figure 1

Workflow method and main protein identification results. (A) Mosquitoes infection protocol in which mosquitoes infected and non-infected with Wolbachia were captured and half were infected with ZIKV in vitro; ovaries were extracted after 14 days. (B) Sample preparation for proteomics, using trypsin enzyme for digestion step and peptides labeling was performed with iTRAQ-4plex and mixed in a 1:1:1:1 ratio; labeled peptides were fractionated offline using HILIC chromatography; samples were named depending on its infection condition: A - non-infected mosquitoes; W - Wolbachia infected; Z - ZIKV infected. (C, D) The pool of fractions was analyzed by nLC–MS/MS in Q-Exactive Plus mass spectrometer and the fragmentation scheme shows reporter ions at the low m/z region used for relative quantification of the peptides/proteins. (E) Data analysis was first performed with Proteome Discoverer 2.4 software using Ae. aegypti, Wolbachia and ZIKV peptides database and after statistical and bioinformatics analysis was done in software Perseus using VectorBase to enrich proteins differentially regulated for GO and KEGG. (F) Summary proteins identification result, where a total of 4931 proteins and 33,529 peptides were identified, including the three organisms.

Workflow method and main protein identification results. (A) Mosquitoes infection protocol in which mosquitoes infected and non-infected with Wolbachia were captured and half were infected with ZIKV in vitro; ovaries were extracted after 14 days. (B) Sample preparation for proteomics, using trypsin enzyme for digestion step and peptides labeling was performed with iTRAQ-4plex and mixed in a 1:1:1:1 ratio; labeled peptides were fractionated offline using HILIC chromatography; samples were named depending on its infection condition: A - non-infected mosquitoes; W - Wolbachia infected; Z - ZIKV infected. (C, D) The pool of fractions was analyzed by nLC–MS/MS in Q-Exactive Plus mass spectrometer and the fragmentation scheme shows reporter ions at the low m/z region used for relative quantification of the peptides/proteins. (E) Data analysis was first performed with Proteome Discoverer 2.4 software using Ae. aegypti, Wolbachia and ZIKV peptides database and after statistical and bioinformatics analysis was done in software Perseus using VectorBase to enrich proteins differentially regulated for GO and KEGG. (F) Summary proteins identification result, where a total of 4931 proteins and 33,529 peptides were identified, including the three organisms.

2.5 Data Analysis and Gene Enrichment

The spectra obtained after the LC-MS/MS analyses were processed in the Proteome Discoverer 2.4 Software (Thermo Scientific), with the Sequest HT search engine against the Ae. aegypti (genome version/assembly ID: INSDC: GCA_002204515.1), ZIKV and Wolbachia provided by VectorBase (Giraldo-Calderón et al., 2014), ViPR (Pickett et al., 2012), and UniProt (The UniProt Consortium, 2015). 2019), respectively. For the search, the following parameters were used: precursor tolerance of 10 ppm, fragment tolerance of 0.1 Da, tryptic cleavage specificity, two maximum missed cleavage sites allowed, fixed modification of carbamidomethyl (Cys), variable modification of iTRAQ 4-plex (Tyr, Lys, and peptide N-terminus), phosphate, (Ser, Thr, and Tyr) and oxidation (Met). Peptides with high confidence were selected, and only identifications with q values equal to or less than 0.01 FDR were considered. Target Decoy PSM obtained these values. Quantitative analysis was performed in Perseus software, version 1.6.12.0 (Tyanova et al., 2016), based on the intensity of the reporter ions extracted from the MS/MS spectra. All data were transformed into log2 and normalized by subtracting the column median. As a criterion to define the differential proteins, statistical Anova tests were performed between the groups, with a significance level of 0.05 of the p-value. Proteins with p < 0.05 were considered significant with a fold change threshold of 0.5. Enrichment of biological process by gene ontology and metabolic pathways by KEGG for differentially expressed proteins was performed using Fisher’s Exact Test (p<0.05) on the VectorBase website (bit.ly/38OmEX0) (Ashburner et al., 2000; Giraldo-Calderón et al., 2014).

3. Results and Discussion

3.1 Proteome Identification and Quantification

Isobaric-labeled quantitative proteomics was applied to increase proteomics analysis’s depth coverage and efficiency. By labeling mosquitoes from each of the four experimental groups with iTRAQ 4-plex, samples were multiplexed before offline fractionation and LC-MS/MS analysis ( ). We identified 4931 protein groups ( ), 36,403 peptides, 110,733 PSMs, and 987,698 MS/MS spectra. The protein search was performed using Ae. aegypti, ZIKV, and Wolbachia databases, simultaneously. Considering all identified proteins, 3913 belong to Ae. aegypti, 1015 to Wolbachia, and three unique peptides with a total of three PSMs to the ZIKV polyprotein. We contrasted our proteomic dataset of A. aegypti ovary with the ovary proteome obtained by Geiser et al., 2022. For the analysis, we initially performed conversion of the identifiers because the database used by the authors is from a different origin and version ( ). We found that the database used comprised more than one genome deposited in VectorBase. Therefore, we compared the gene IDs also by orthology and identified 1291 genes in common between both works ( ). It is essential to highlight that Winzerling’s paper used a distinct sample and MS analysis method compared to this work. After checking the quantification using the report ion signals’ abundance ( ), it is possible to observe that in samples A and Z, the signals’ abundance is very low (due mostly to isotopic contamination in tags) and shows the intensities that account for overlapping isotopic contributions of the reagent purity values, showing the signal-to-noise (S/N) behavior of iTRAQ reporter ions for the channels where Wolbachia protein signals are not expected. This control is critical to show that Wolbachia protein identifications were not random matches. Instead, they followed the expected quantification trend: only relevant signals within Wolbachia infection channels. Since in W and WZ, where we have Wolbachia infected samples, there are higher intensity and relevant signals of bacterium proteins revealing the match between identification and quantification pattern of Wolbachia proteins.
Figure 2

Quantitative proteomics data. (A) Abundance chart of the three replicates of identified Wolbachia pipientis proteins. High expression is observed in the W and ZW samples, showing that it is possible to compare the expression of proteins by the relative quantification of the iTRAQ; (B) Volcano plot of Wolbachia proteins comparing WZ/W. The red dots represent upregulated proteins; (C) Heatmap of all Ae aegypti identified proteins that were upregulated (red) or downregulated (blue) during the comparison between control, monoinfected, and coinfected samples; (D) Mainly upregulated pathways statistically relevant in each condition comparison. (E) Mainly downregulated pathways statistically relevant in each condition comparison.

Quantitative proteomics data. (A) Abundance chart of the three replicates of identified Wolbachia pipientis proteins. High expression is observed in the W and ZW samples, showing that it is possible to compare the expression of proteins by the relative quantification of the iTRAQ; (B) Volcano plot of Wolbachia proteins comparing WZ/W. The red dots represent upregulated proteins; (C) Heatmap of all Ae aegypti identified proteins that were upregulated (red) or downregulated (blue) during the comparison between control, monoinfected, and coinfected samples; (D) Mainly upregulated pathways statistically relevant in each condition comparison. (E) Mainly downregulated pathways statistically relevant in each condition comparison.

3.1.1 Wolbachia Localization in Insect Ovary and Its Protein Identification

The accumulation of Wolbachia in ovaries improves its vertical transmission efficiency through the female germline suggesting that a balance between vertical transmission and optimum densities is critical for a long-term, stable endosymbiosis (Kaur et al., 2021). Since only 1205 protein-coding genes were reported in the Wolbachia pipientis genome (Sinha et al., 2019), we applied an identification strategy using a combined database containing Uniprot proteins addressed to Wolbachia species in general. Using this strategy, we were able to identify 1015 unique protein groups from Wolbachia. As an additional analysis, we compared W and WZ to observe possible Wolbachia proteins that might be modulated during ZIKV infection ( ). Proteins with p < 0.05 were considered significant with a fold change threshold of 0.5. A total of 38 proteins were upregulated in response to virus infection ( ), mostly related to catalytic activity, structure-activity, metal ion binding, nucleotide binding, and RNA and DNA binding. Similar findings were noted after evaluating that the transcriptional response of Wolbachia to DENV involves the regulation of Wolbachia DNA production and energetic metabolic genes (Leitner et al., 2021).
Table 1

Wolbachia proteins with significant differences in abundance between W and WZ.

UniprotProteinsp-valueFold changes W/WZBiological ProcessCellular Component Molecular Function
Q73IW9Bifunctional DNA-directed RNA polymerasesubunitbeta-beta'0,0004444610,411035542metabolic processcatalytic activity;DNA binding
Q73H30Porin 4 domain-containing protein0,0120585390,595912427
A0A5R9MDU9ATP-dependentchaperoneClpB0,002478004
A0A5R9MBZ5Insulinase family protein0,049015280,579255197
Q73G77Outer membrane protein assembly factor BamA0,0184722150,527555786cell organization and biogenesismembrane
Q73HD5Cytoplasmic incompatibility factor CifA779842E-050,560087056
Q73H52Hypothetical protein0,0249884870,51835011membrane
AQA098ASI2Pyruvate, phosphatedikinase1,05157E-050,579445156metabolic processcatalyticactivity;metal ion binding;nucleotide binding
A0AO98ASBSRibosome-recycling factor0,0217488630,503098093cell organization and biogenesis;metabolicprocesscytoplasmRNA binding
Q73HB3TranscriptionelongationfactorGreA0,0344704630,440927891metabolic process;regulation of biological processDNAbinding;proteinbinding;RNAbinding
Q4ECB1OmpA family protein0,0017393360,485774855membrane
Q73HQ7Surface antigen, Wspparalog0,0114698950,62249352
A0A09SAS15MgtEintracelularN domain0,0009089490,704846358
M9WUJ8SOS ribosomal protein L30,0262632190,67093336metabolic processribosomeRNAbinding;structural molecule activity
C0F8V0Phosphatidylserine decarboxylase proenzyme0,0450935240,427720959metabolic processmembranecatalytic activity
Q4EAL950SribosomalproteinL10,0344079040,666474541metabolic process;regulation of biological processribosomeRNAbinding;structural molecule activity
Q73HX6Aspartate-tRNA(Asp/Asn) ligase0,0053445620,52587834metabolic processcytoplasmcatalytic activity;nucleotide binding
Q73FS0ATP-dependent zinc metalloprotease FtsH0,0104454940,585365863cell division; metabolic process;response tostimulusmembranecatalyticactivity;rnetal ion binding;nucleotide binding
A0A5B9K3B3SOS ribosomal protein L50,0395048060,505903393
A0AQ98ATK8Citrate synthase0,0111278460,515264518metabolic processcytoplasmcatalytic activity
C0F9Z9Protein HfIC0,0318682410,403411331regulation of biological processmembrane
A0A2A4IJ89Inositol monophosphatase0,0052069780,597804797
Q73HW7Isoleucine-tRNA ligase0,007134020,427841423metabolic process;regulation of biological processcytoplasmcatalytic activity;metal ion binding;nucleotidebinding;RNAbinding
AOA060Q1B9Iron(lll) transportsystem substrate-binding protein0,0234157840,589204769transportmetal ion blnding;transporter activity
Q73GT7Hypothetical protein0,016015640,452984557
A0A1V2N3U3Leucine-tRNA ligase1.26546E-050,529255411metabolic process;regulation of biological processcytoplasmcatalytic activity;nucleotide binding
Q73GS5Type IV secretion system protein VirB60,008577890,61741491transportmembrane
A0A2A4IGS0ATPsynthaseganmachain0,0422139120,574342268
A0AQ98ARZ7Fido domain-containing protein0,011555349
A0A5R9MDS2Folate-bindingproteinYgfZ0,0420299070,7052091
C0F8P8MalonylCoA-acylcarrierproteintransacylase0,0058191310,598572843metabolic processcatalytic activity
A0A225X8G2DNA mismatch repair protein MutS0,0122699480,422355559
Q4ECU7NADH-quinoneoxidoreductasesubunitC0,0257138810,631272563metabolic process;transportmembranecatalytic activity
M9WVR3ReplicativeDNA helicase0,0159918170,575902317metabolic processcatalyticactivity;DNAbinding;nucleotide binding
A0A2A4IK13Magnesium transporter MgtE0,0490137470,435309293
B7TW57RmlD_sub_bind domain-containing protein (Fragment)0,0349948320,592799831
I7IU09Putative pyruvate, phosphate dikinase regulator/ protein0,0040121210,545064889metabolic processcatalytic activity;nucleotide binding
B5Y8B7Ankyrinrepeatdomainprotein0,0125615680,38957124nucleotide binding;protein binding
A0AO98AU34Peptidyl-prolyl cis-trans isomerase0,0192304570,562841529metabolic processmembranecatalytic activity
Wolbachia proteins with significant differences in abundance between W and WZ. One of the positively modulated proteins in WZ compared to W was the Cytoplasmic incompatibility factor (CifA). LePage et al. (2017) concluded that the cytoplasmic incompatibility factor genes enhanced the cytoplasmic incompatibility leading to embryonic lethality in D. melanogaster. The gene additively, through transgenic mechanisms, augments embryonic lethality in crosses between infected males and uninfected females after pioneering genetic studies. The discovery of cifA pioneers genetic studies of prophage WO-induced reproductive manipulations and informs the continuing use of Wolbachia to control dengue and Zika virus transmission to humans.

3.1.2 ZIKV Polyprotein Peptides Were Identified in Mosquito Ovaries

A total of three ZIKV peptides were identified in mosquito ovaries using the Isobaric-labeled quantitative proteomics approach: VPAETLHGTVTVEVQYAGNDGPCKIPVQMAVDMQTLTPVGR, NGGYVSAITQGRREEETPVECFEPSMLK, and DGDIGAVALDYPAGTSGSPILDR ( ). However, no protein quantification data were obtained despite its borderline identification in ovary tissue. This result leads to two different hypotheses: ZIKV was not located in mosquito ovaries, or a low amount of ZIKV polyprotein peptides was detected in LC-MS/MS analysis leading to a poor quantification in this tissue by the method used. Vector competence is a crucial feature in determining the likelihood of pathogen transmission in a given area and has hitherto shown heterogeneous results among field populations (Epelboin et al., 2017; Kauffmann and Kramer, 2017; Boyer et al., 2018). ZIKV disseminates through several organs and tissues of mosquitoes, including the ovaries, to support further vertical transmission (Campos et al., 2017; Li et al., 2017; González et al., 2019; Lai et al., 2020; Sá-Guimarães et al., 2021). The infection of ovaries by ZIKV is dependent primarily on mosquito genetics, temperature, viral load, and the availability of blood meals but peaks around 18 dpi (Thangamani et al., 2016; Nag et al., 2021). Sá-Guimarães et al. (2021) identified ZIKV in Ae. aegypti ovaries at 3 dpi after orally challenging insects with a 2.5×109 PFU/ml viral load, whereas our ZIKV isolate was 3.55×106 PFU/ml. Intuitively, the higher viral load used by Sá-Guimarães et al. (2021) and the long incubation period before ovaries dissection by Nag et al. (2021) together might explain the lack of ZIKV peptides quantification in Ae. aegypti ovaries in our study. Nevertheless, we achieved ZIKV identification in ovaries and revealed that ZIKV mono-infection modulated several proteins in Ae. aegypti ovaries that will be further discussed.

3.2 Modulated Proteins and Pathways by Infections

A total of 480 proteins from Ae. aegypti with significant differences were statistically determined by the ANOVA test. Using the Tukey post-test ANOVA, we defined pairs of proteins with significant differences between the groups ( ) ( ). Pathways were enriched using VectorBase software and the Gene Ontology/KEGG list is represented in . Pathways related to reproductive and immune aspects were the main interest in this data and were the focus of discussion ( ).

3.2.1 ZIKV Mono-Infection Controls Mosquito Machinery to Favor Its Replication and Transmission

3.2.1.1 ZIKV Infection Downregulates Antimicrobial Peptides and Mannose-Binding C-Type Lectin

During the investigation of modulated proteins in ZIKV mono-infection samples compared to control, it was possible to identify attacin (AAEL003389), included in the antimicrobial humoral response (GO:0019730), humoral immune response (GO:0006959), and antibacterial humoral response (GO:0019731) pathways, and gambicin (AAEL004522) downregulation. Both molecules are classified as antimicrobial peptides (AMPs), crucial effectors of the insect’s innate immune system that can provide the first line of defense against various pathogens (Wu et al., 2018). It is widely known that AMPs are normally produced by the Toll/IMD signaling pathway, which is the case of attacins (Buonocore et al., 2021), or can also be produced by JAK-STAT pathway, as gambicin (Zhang et al., 2017). The probable reason for its downregulation is the influence of AMPs in virus infection and the difficult DENV and ZIKV establishment in Ae aegypti (Xi et al., 2008; Martins et al., 2021). In addition to attacin and gambicin, RpS23: 40S ribosomal protein S23 (AAEL012686) was also downregulated, and it was recently discovered that new AMP functioning as they are capable of recognizing microorganisms molecules, and an effector, capable of killing the potential pathogens (Ma et al., 2020). Besides AMPs, a mannose-binding C-type lectin (AAEL000563) was also downregulated. C-type lectins (CTLs) are a family of proteins that contain characteristic modules of carbohydrate recognition domains and play important roles in insect immune responses, such as opsonization, nodule formation, agglutination, encapsulation, melanization, and prophenoloxidase activation (Xia et al., 2018). A more specific function related to mannose-binding lectins is a pattern recognition component of the complement system that binds carbohydrate groups on the surface of microbial pathogens triggering the lectin activation pathway of complement (Takahashi et al., 2006). It is described that this pathway can neutralize DENV and West Nile Virus (WNV) infection (Avirutnan et al., 2011; Fuchs et al., 2011). Moreover, it was recently described that CTLs can act as a recognition receptor for JAK-STAT immune pathway (Geng et al., 2021), which downregulation may interfere in AMPs production, as gambicin peptide. Those downregulations combined can facilitate ZIKV infection.

3.2.1.2 ZIKV Enhance Juvenile Hormone Production and Pro-Viral Host Factors for Establishing Infection

Juvenile Hormone (JH), a representant from a family of sesquiterpenoid hormones in insects, was originally described in Rhodnius prolixus as a molecule capable of maintaining the juvenile character of insect larvae to ensure proper metamorphosis timing (Wigglesworth, 1934). However, JHs govern many insects’ essential aspects of development, metamorphosis, and reproduction (Tsang et al., 2020). Its absence in vertebrates may qualify this hormone as a target to control insect pests and disease vectors (Jindra et al., 2015). Its signaling and production pathways comprehend the interaction between insects’ neuronal and fat body organs, and the main effect in female ovaries is the vitellogenin production activation (Santos et al., 2019). Besides, Chang et al. (2021) recently described that JH acts in AMP negative regulation, especially after the post-eclosion phase of the Ae. aegypti female gonadotrophic reproductive cycle. In regard to Ae. aegypti, it was described that JH analogs enhance ZIKV infection (Alomar et al., 2021). On the other hand, the silencing of ribosomal protein (Rp) genes, responsive to JH, increased ZIKV blocking once the virus increased global ribosomal activity in the insect (Shi et al, 2021). Taking all of that information into account, it is vital to understand JH modulation during ZIKV infection and if Wolbachia infection plays any changes as well. Evaluating our data, the first aspect that will be discussed is ZIKV upregulation in the JH production pathway, as a farnesol dehydrogenase (AAEL017302) was upregulated ( ). Farnesol dehydrogenase was found in Ae. Aegypti (Mayoral et al., 2009), and its activity is observed on the second JH branch, oxidizing farnesol to farnesal (Nouzova et al., 2011). It is considered a rate-limiting enzyme and critical in regulating the production of JH in adult mosquitoes (Zifruddin et al., 2021), so its enhancement in ZIKV infection can lead to JH production, as previously described in the literature and exposed in the last paragraph, favoring mosquito reproduction aspects and maybe helping ZIKV vertical and horizontal transmission. Experiments involving farnesol dehydrogenase inhibition showed larvicidal activity and inhibited the ovary growth of female Ae. albopictus (Park et al., 2020). Farnesol dehydrogenase modulated several pathways in our analysis: juvenile hormone metabolic process (GO:0006716), cellular hormone metabolic process (GO:0034754), juvenile hormone biosynthetic process (GO:0006718), sesquiterpenoid biosynthetic process (GO:0016106), terpenoid biosynthetic process (GO:0016114), terpenoid metabolic process (GO:0006721), sesquiterpenoid metabolic process (GO:0006714), hormone metabolic process (GO:0042445), hormone biosynthetic process (GO:0042446), regulation of hormone levels (GO:0010817), oxidation-reduction process (GO:0055114), cellular biosynthetic process (GO:0044249), and organic substance biosynthetic process (GO:1901576).
Figure 3

Identification and modulation of proteins that participate in the JH pathway, composed of the mevalonate pathway (early step), represented in gray, and juvenile hormone branch (last step), represented in blue, and juvenile hormone branch (last step), represented in red (pathway adapted from Nouzova et al., 2011). Enzymes colored in green were identified in Ae. aegypti proteome in this work, and enzymes colored in purple were identified and quantified as modulated during ZIKV or Wolbachia infection. Mevalonate kinase and farnesol dehydrogenase were downregulated in Wolbachia infection and farnesol dehydrogenase was upregulated in ZIKV infection, as represented in graphs containing each condition and the respective fold change of each modulated protein.

Identification and modulation of proteins that participate in the JH pathway, composed of the mevalonate pathway (early step), represented in gray, and juvenile hormone branch (last step), represented in blue, and juvenile hormone branch (last step), represented in red (pathway adapted from Nouzova et al., 2011). Enzymes colored in green were identified in Ae. aegypti proteome in this work, and enzymes colored in purple were identified and quantified as modulated during ZIKV or Wolbachia infection. Mevalonate kinase and farnesol dehydrogenase were downregulated in Wolbachia infection and farnesol dehydrogenase was upregulated in ZIKV infection, as represented in graphs containing each condition and the respective fold change of each modulated protein. ZIKV-capsid interaction with cell host was newly investigated through quantitative label-free proteomics and showed an important contribution to the 26S protease regulatory subunit (Gestuveo et al., 2021), a component of the ubiquitin-proteasome system. We were able to identify two 26S protease regulatory subunit (AAEL002508 and AAEL012943) upregulated, related to protein catabolic process (GO:0030163), regulation of proteolysis (GO:0030162), positive regulation of catabolic process (GO:0009896), positive regulation of cellular protein catabolic process (GO:1903364), positive regulation of proteolysis involved in cellular protein catabolic process (GO:1903052), positive regulation of protein catabolic process (GO:0045732), positive regulation of proteasomal protein catabolic process (GO:1901800), positive regulation of cellular catabolic process (GO:0031331), regulation of proteolysis involved in cellular protein catabolic process (GO:1903050), regulation of cellular protein catabolic process (GO:1903362), regulation of proteasomal protein catabolic process (GO:0061136), positive regulation of proteolysis (GO:0045862), regulation of protein catabolic process (GO:0042176), and macromolecule catabolic process (GO:0009057). It is already described 26S protease regulatory subunit importance in ZIKV infection but the mechanism is currently unknown, but there is a strong relation with ubiquitination processes in other viruses and can help in viral capsid transport to the nucleus, for example (Schneider et al., 2021). Moreover, this ribosomal activity increases the proteolytic activity of the proteasome, which is required for female insect reproduction (Wang et al., 2021), it is sensible to JH and enhances viral replication in Ae. aegypti as observed by Shi et al. (2021). Two ribosomal proteins, RpL27a (AAEL013272) and RpL17 (AAEL000180), were also upregulated, related to the organonitrogen compound biosynthetic process (GO:1901566), cellular biosynthetic process (GO:0044249), and organic substance biosynthetic process (GO:1901576).

3.2.2 Wolbachia Harms Mosquito Reproductive Characteristics But Helps Its Immune System

3.2.2.1 Juvenile Hormone Pathway Is Negatively Affected by Wolbachia Mono-Infection

While ZIKV infection induces JH, Wolbachia infection downregulates two proteins related to its pathway ( ). One of them is in the same farnesol dehydrogenase (AAEL017302) discussed before, which will affect the second part of JH output cascade. The other protein identified as downregulated is mevalonate kinase (AAEL006435). Mevalonate kinase belongs to the fourth reaction step of the mevalonate pathway, which is responsible for the biosynthesis of many essential molecules important in insect development, reproduction, chemical communication, and defense (Li et al., 2016). Concerning JH, the mevalonate pathway is classified as the early step that forms farnesyl pyrophosphate used on the late step, known as JH branch (Noriega, 2014). Both mevalonate kinase and farnesol dehydrogenase downregulation in Wolbachia presence may infer that JH production is negatively affected. This can impact the germline lifecycle from meiosis to gametogenesis, once it was found that JHs influence embryonic reproductive development (Barton et al., 2021). Both farnesol dehydrogenase and mevalonate kinase have modulated pathways that interact with themselves and are related to hormone synthesis ( ).
Figure 4

Ontology network of summarized enriched biological processes related to mevalonate kinase and farnesol dehydrogenase. The size of the bubble corresponds to the LogSize value for the GO Term. The overview and the interaction network were obtained in software revigo and cytoscape 3.8.0, respectively.

Ontology network of summarized enriched biological processes related to mevalonate kinase and farnesol dehydrogenase. The size of the bubble corresponds to the LogSize value for the GO Term. The overview and the interaction network were obtained in software revigo and cytoscape 3.8.0, respectively. Allied to this event, a yellow protein was also downregulated. Yellow protein (dopachrome conversion enzyme) is involved in the melanin biosynthetic pathway that significantly accelerates pigmentation reactions in insects and belongs to a rapidly evolving gene family generating functionally diverse paralogs with physiological functions still not understood (Noh et al., 2015). Noh et al. (2020) discovered that two yellow proteins are required for egg desiccation resistance, so maybe Wolbachia downregulation may decrease egg resistance leading to a lower reproduction success, which was described before (McMeniman et al., 2011).

3.2.2.2 Host Immune Defense Is Activated by Wolbachia Mono-Infection as a Protection Barrier to Other Microorganisms

Microorganisms are important modulators of host phenotype, providing heritable variation upon which natural selection acts (Brinker et al., 2019). Host-parasite interactions represent one of the strongest selection pressures in nature, with a considerable impact on the ecology and evolution of parasites and thus on disease epidemiology (Bose and Schulte, 2014). The endosymbiotic bacteria Wolbachia has shown an increase in host protection range against pathogens, including bacteria, viruses, nematodes, and the malaria parasite (Wong et al., 2011). A single mechanism called immune priming might explain this broad-based pathogen protection. Wolbachia presence upregulates the basal immune response, preparing the insect to defend against subsequent pathogen infection (Ye et al., 2013). Our results showed that macroglobulin complement protein (AAEL001794) was upregulated during Wolbachia infection compared to control. Macroglobulin complement-related factor (MCR) is known for being a thioester-containing proteins (TEP) family component in insects, presenting a protease inhibitor activity (Blandin, 2004). TEPs were previously described in Anopheles gambiae and Drosophila melanogaster models, and act in the innate immune response by promoting recruitment of immune cells, phagocytosis, and direct lysis of microbial invaders (Shokal & Eleftherianos, 2017), usually in insects hemolymph (Cheng et al., 2016; Mukherjee et al., 2019). Xiao et al. (2014) performed molecular biology assays evolving MCR in Ae. aegypti containing Wolbachia during DENV infection, describing that MCR does not directly interact with the flavivirus, requiring a mosquito homolog of scavenger receptor-C (SR-C), which interacts with DENV and MCR simultaneously (in vitro and in vivo) and this SR-C/MCR axis regulates the expression of antimicrobial peptides (AMPs) consequently increasing anti-DENV immune response. In addition to MCR, three leucine-rich repeat immune proteins (LRRIM) were upregulated during Wolbachia infection: LRRIM1, LRRIM8, and LRRIM10A (AAEL012086, AAEL001420, AAEL001401, respectively). LRRIM is evolutionarily conserved among many proteins correlated with innate immunity in an array of organisms, including invertebrates, and it usually forms a disulfide-bridged complex that interacts with the third factor, TEP, more specifically TEP1, revealing its antimicrobial activity in insect immune response (Waterhouse et al., 2010). More importantly, it was noticed that LRRIM responded to ZIKV infection in Ae. aegypti female adults in a transcriptional analysis approach (Zhao et al., 2019; Shi et al., 2021), therefore corroborating the idea that LRRIM enhancement mediated by Wolbachia presence can help in ZIKV block. A DEAD box ATP-dependent RNA helicase (AAEL008738) was also upregulated during bacterial infection. DEAD-box helicases are a large family of conserved RNA-binding proteins that belong to the broader group of cellular DExD/H helicases, with emerging evidence that it plays a role in the recognition of foreign nucleic acids and the modulation of viral infection (Taschuk & Cherry, 2020). DEAD-box helicases can play an essential role in sensing viral infection and directly affecting virus RNA by participating in the RNAi pathway and Toll-like and retinoic acid-inducible gene-I-like receptors signaling pathway, for example (Ahmad & Hur, 2015; Baldaccini & Pfeffer, 2021; Su et al., 2022). However, there is evidence that noncoding subgenomic flavivirus RNA from ZIKV can bind to DEAD/H-box helicase ME31B in Ae. aegypti as a way of overcoming this defense (Göertz et al., 2019).

3.4 Microorganisms Coinfection Generate Oxidative Stress and Affect Yolk Component

3.4.1 Immune Response Mediated by Reactive Oxygen Species and DExD/H Helicases

Martins et al. (2021) earlier described that Wolbachia and ZIKV coinfection increased host cellular aerobic metabolism to accumulate reactive oxygen species (ROS) in Ae. aegypti head and salivary glands quantitative proteomics. Several pathways related to aerobic metabolism were upregulated in mosquito ovaries analysis, thus corroborating previous data. The increase in aerobic respiration metabolism has already stimulated ROS production in insect cells as part of the host immune response, but it is counterbalanced by the activation of antioxidant pathways (Zug & Hammerstein, 2015; Martins et al., 2021). ROS accumulation activates the mosquito Toll immune pathway, resulting in the production of AMPs (Pan et al., 2012). Possibly as a result of this ROS amount, Cu-Zn superoxide dismutase (SOD) proteins (AAEL019937 and AAEL025388) were upregulated comparing WZ with W, Z, and A. SODs are important antioxidant enzymes that convert superoxide into oxygen and hydrogen peroxide (Park et al., 2012; Lomate et al., 2015) and it is also related to protecting insects’ ovaries during diapauses (Sim and Denlinger, 2011). Besides ROS-mediated immune response, a DEAD box ATP-dependent RNA helicase (AAEL004978) was upregulated in coinfection. DExD box RNA helicase was already discussed in Wolbachia mono-infection upregulations and leads us to believe that it is a Wolbachia-mediated attempt to overcome ZIKV infection, even though this virus has a way of overcoming this immune mechanism (Göertz et al., 2019).

3.4.2 Vitellogenin A1 Downregulation During Coinfection

During WZ comparison with Z, W, and A, it was noticed that vitellogenin A1 (AAEL010434) was downregulated in all analyses, related to macromolecule localization (GO:0033036), organic substance transport (GO:0071702), biological process (GO:0008150), transport (GO:0006810), the establishment of localization (GO:0051234), localization (GO:0051179), lipid transport (GO:0006869), and lipid localization (GO:0010876). Vitellogenins are the predominant yolk protein precursors produced extra ovarian and taken up by the growing oocytes against a concentration gradient (Engelmann, 1979). By having this important role, it is relevant to understand how it behaves during microorganisms’ infection. Depending on which Wolbachia is allocated in the host, the ovary protein level can change, resulting in different protein content in embryos (Christensen et al., 2016), nonetheless, there is a report that establishes a link between the vitellogenin-related mode of transovarial transmission and efficient maternal transmission of Wolbachia, assuming that the bacteria utilized vitellogenin transportation system to enter the insect ovaries (Guo et al., 2018). Vitellogenesis can be directly regulated by insect hormones, including JH (Shapiro and Taylor, 1982; Wu et al., 2021). As was discussed before, Wolbachia decreases enzyme levels of the JH pathway, and it might interfere in vitellogenesis, together with the yellow protein downregulation. On the other hand, female mosquitoes with regular blood-feeding presented high oviposition, probably mediated by nutrition influence in hormones, and it enhanced ZIKV infection (Rocha-Santos et al., 2021). This may lead to comprehension of reproduction–immunity trade-offs in insects. Immune defense and reproduction are physiologically and energetically demanding processes. They have been observed to trade off in a diversity of female insects: increased reproductive effort results in reduced immunity, and reciprocally, infection and activation of the immune system reduce reproductive output (Schwenke et al., 2016). Moreover, endocrine regulation of immunity in insects involving some hormones was already described, including JH, which is characterized as an immune suppressor (Nunes et al., 2021). Our result corroborates this influence shown in literature, once coinfected mosquitoes have to deal with a major microorganism invasion.

4 Conclusions

Proteomics analysis of Ae. aegypti ovaries mono-infected with ZIKV or Wolbachia highlighted how those microorganisms interplay almost antagonistic responses considering insect reproducibility and immune response particularities. Our data support that ZIKV induces JH production, probably enhancing insect reproduction capability, while Wolbachia seems to harm the same hormone pathway and also egg survival. As for innate insect immunity, Wolbachia helps to reinforce Ae. aegypti basal features, while ZIKV block it to facilitate infection. During coinfection, Wolbachia helps Ae. aegypti to prevent virus infection by stimulating ROS production, leading to a Toll-pathway humoral immune response and SOD production to control cell homeostasis. Besides, coinfection showed a potential role between the immune system and reproduction features. Finally, this work should be an important resource for understanding how microorganism infection can influence Ae. aegypti immune response and reproducibility, exposing those findings to the insect research community.

Data Availability Statement

The mass spectrometry proteomics data have been deposited to the ProteomeXchange Consortium via the PRIDE (Perez-Riverol et al., 2022) partner repository with the dataset identifier PXD031728.

Author Contributions

LR, MM, and JR performed the experiments and data analysis. MM produced paper figures. LR, MM, JR, GD, DO, FN, RM-D-F, and MJ wrote the manuscript. GD, FN, RM-D-F, and MJ provided resources and acquired funding. RM and MJ idealized and coordinated the study. All authors approved the manuscript.

Funding

The present work was supported by Fundação Carlos Chagas Filho de Amparo à Pesquisa do Estado do Rio de Janeiro (FAPERJ) (Project Temáticos FAPERJ E-26/211.348/2021) and Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq).

Conflict of Interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

Publisher’s Note

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.
  115 in total

1.  Zika virus. I. Isolations and serological specificity.

Authors:  G W A DICK; S F KITCHEN; A J HADDOW
Journal:  Trans R Soc Trop Med Hyg       Date:  1952-09       Impact factor: 2.184

Review 2.  Mosquito Defense Strategies against Viral Infection.

Authors:  Gong Cheng; Yang Liu; Penghua Wang; Xiaoping Xiao
Journal:  Trends Parasitol       Date:  2015-11-25

3.  ViPR: an open bioinformatics database and analysis resource for virology research.

Authors:  Brett E Pickett; Eva L Sadat; Yun Zhang; Jyothi M Noronha; R Burke Squires; Victoria Hunt; Mengya Liu; Sanjeev Kumar; Sam Zaremba; Zhiping Gu; Liwei Zhou; Christopher N Larson; Jonathan Dietrich; Edward B Klem; Richard H Scheuermann
Journal:  Nucleic Acids Res       Date:  2011-10-17       Impact factor: 16.971

4.  Surveillance of Aedes aegypti: comparison of house index with four alternative traps.

Authors:  Claudia T Codeço; Arthur W S Lima; Simone C Araújo; José Bento P Lima; Rafael Maciel-de-Freitas; Nildimar A Honório; Allan K R Galardo; Ima A Braga; Giovanini E Coelho; Denise Valle
Journal:  PLoS Negl Trop Dis       Date:  2015-02-10

5.  Aedes aegypti insecticide resistance underlies the success (and failure) of Wolbachia population replacement.

Authors:  Gabriela A Garcia; Ary A Hoffmann; Rafael Maciel-de-Freitas; Daniel A M Villela
Journal:  Sci Rep       Date:  2020-01-09       Impact factor: 4.379

Review 6.  DExD/H-box helicases: multifunctional regulators in antiviral innate immunity.

Authors:  Chenhe Su; Yan-Dong Tang; Chunfu Zheng
Journal:  Cell Mol Life Sci       Date:  2021-12-15       Impact factor: 9.261

7.  Shotgun and TMT-Labeled Proteomic Analysis of the Ovarian Proteins of an Insect Vector, Aedes aegypti (Diptera: Culicidae).

Authors:  Dawn L Geiser; Wenzhou Li; Daphne Q-D Pham; Vicki H Wysocki; Joy J Winzerling
Journal:  J Insect Sci       Date:  2022-03-01       Impact factor: 1.857

8.  Differential Susceptibilities of Aedes aegypti and Aedes albopictus from the Americas to Zika Virus.

Authors:  Thais Chouin-Carneiro; Anubis Vega-Rua; Marie Vazeille; André Yebakima; Romain Girod; Daniella Goindin; Myrielle Dupont-Rouzeyrol; Ricardo Lourenço-de-Oliveira; Anna-Bella Failloux
Journal:  PLoS Negl Trop Dis       Date:  2016-03-03

Review 9.  The rich somatic life of Wolbachia.

Authors:  Jose E Pietri; Heather DeBruhl; William Sullivan
Journal:  Microbiologyopen       Date:  2016-07-26       Impact factor: 3.139

10.  Vertical transmission of zika virus in Aedes albopictus.

Authors:  Zetian Lai; Tengfei Zhou; Jiayong Zhou; Shuang Liu; Ye Xu; Jinbao Gu; Guiyun Yan; Xiao-Guang Chen
Journal:  PLoS Negl Trop Dis       Date:  2020-10-15
View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.