Literature DB >> 35813876

Trimeric receptor-binding domain of SARS-CoV-2 acts as a potent inhibitor of ACE2 receptor-mediated viral entry.

Shrikanth C Basavarajappa1, Angela Rose Liu1, Anna Bruchez1, Zhenlu Li2, Vinicius G Suzart1, Zhonghua Liu1, Yinghua Chen2, Tsan Sam Xiao1, Matthias Buck2,3,4,5, Parameswaran Ramakrishnan1,3,6.   

Abstract

The COVID-19 pandemic has caused over four million deaths and effective methods to control CoV-2 infection, in addition to vaccines, are needed. The CoV-2 binds to the ACE2 on human cells through the receptor-binding domain (RBD) of the trimeric spike protein. Our modeling studies show that a modified trimeric RBD (tRBD) can interact with three ACE2 receptors, unlike the native spike protein, which binds to only one ACE2. We found that tRBD binds to the ACE2 with 58-fold higher affinity than monomeric RBD (mRBD) and blocks spike-dependent pseudoviral infection over 4-fold more effectively compared to the mRBD. Although mRBD failed to block CoV-2 USA-WA1/2020 infection, tRBD efficiently blocked the true virus infection in plaque assays. We show that tRBD is a potent inhibitor of CoV-2 through both competitive binding to the ACE2 and steric hindrance, and has the potential to emerge as a first-line therapeutic method to control COVID-19.
© 2022.

Entities:  

Keywords:  Molecular structure; Virology

Year:  2022        PMID: 35813876      PMCID: PMC9251894          DOI: 10.1016/j.isci.2022.104716

Source DB:  PubMed          Journal:  iScience        ISSN: 2589-0042


Introduction

Severe acute respiratory syndrome coronavirus type 2 (SARS-CoV-2) is the etiological cause of the ongoing 2019 coronavirus disease (COVID-19) and global pandemic (Zhu et al., 2020). The continued development of novel methods to combat SARS-CoV-2 virus entry is a top priority of current research for more efficacious disease management. As more virulent strains of SARS-CoV-2 are being discovered, successful intervention strategies to curb their cell entry are needed. SARS-CoV-2 belongs to the betacoronavirus family and is closely related to SARS-CoV and MERS-CoV, the etiological agents of the SARS and MERS pandemics. Like other coronaviruses, SARS-CoV-2 uses a glycosylated homotrimeric class 1 fusion spike (S) protein to gain entrance into host cells. The spike protein is produced as a homotrimer in its metastable prefusion state (Kirchdoerfer et al., 2016; Walls et al., 2016). Each spike protein monomer is composed of a receptor-binding S1 domain and viral fusion S2 domain. The S1 segment specifically binds to the host cell ACE2 receptor using its highly conserved receptor-binding domain (RBD) (Wrapp et al., 2020). The main functional motif within the RBD is called the receptor-binding motif (RBM) which directly forms the interface between the spike protein and host cell ACE2 receptor (Wrapp et al., 2020). SARS-CoV-2 RBD binds to ACE2 with increased binding affinity compared to SARS-CoV owing to its more compact binding ridge and key residue substitutions. The SARS-Cov-2 spike protein, in contrast to its predecessor, also has a unique furin cleavage site between S1 and S2 (Shang et al., 2020; Walls et al., 2020; Wrapp et al., 2020). Binding of RBD and ACE2 mechanically induces the dissociation of the S1 from S2 and also allows S2 to transition into a post-binding state essential for membrane fusion. Infection of SARS-CoV-2 into several cell types has proven to require endogenous or supplemental ACE2 receptor, and SARS-CoV-2 is unable to infect cells without ACE2 receptor expression (Blanco-Melo et al., 2020; Hoffmann et al., 2020; Zhou et al., 2020). Surface colocalization of GFP-tagged ACE2 and spike protein has been observed (Wang et al., 2020), with specific binding between surface ACE2 receptor and RBD of spike protein (Lan et al., 2020). These findings support in silico studies which found spike protein to bind with high affinity to human ACE2 receptor (Ortega et al., 2020). Altogether the ACE2 receptor is essential for membrane fusion and viral entry. The spike protein is organized as a trimer, with some intertwining of the subdomains. Within the spike protein, the RBD is found in the open (up) or closed (down) configurational states. Only the “up” conformation is able to bind ACE2 while the “down” conformation occurs when part of the binding interface is occluded from possible binding interactions (Walls et al., 2020). Structural as well as biophysical studies have revealed the nature of the up and down equilibrium (Herrera et al., 2021; Shang et al., 2020; Walls et al., 2020; Wrapp et al., 2020). It is likely that the binding of up to three ACE2 receptors to one spike trimer helps with the dissociation of the S2 and S1 segments (Benton et al., 2020). Given that the RBD:ACE2 interaction appears necessary for viral infection, the RBD of the spike protein has been a major target of interest for its potential ability to block SARS-CoV-2 viral entry. Purified RBD fragments bind strongly to human ACE2 and can block the entry of SARS-CoV-2 and SARS-CoV into human ACE2 expressing cells (Tai et al., 2020; Tian et al., 2020). A recombinant vaccine of RBD has been shown to induce functional antibody response that can neutralize SARS-CoV-2 in vitro and in vivo (Yang et al., 2020) while a recombinant RBD protein fused with human IgG1 Fc fragment was also able to induce highly potent neutralizing antibodies against SARS-CoV (He et al., 2004). Vaccines comprised of only the RBD of SARS-CoV spike protein have also shown promise previously (Chen et al., 2017; Jiang et al., 2012). Synthetic nanobodies directed against RBD have also been able to compete with ACE2 binding to neutralize SARS-CoV-2 spike pseudovirus (Custódio et al., 2020). Usage of a trimerized RBD and spike protein, as opposed to just a monomer, is expected to more closely mimic the intact live virus. Current FDA-approved vaccines consist of mRNA encoding SARS-CoV-2 full-length spike modified to remain in its homotrimeric prefusion conformation (Jackson et al., 2020; Walsh et al., 2020). However, trimerized vaccine approaches against CoV-2 are in the active developmental stage (Clover Biopharm has initiated the development of recombinant subunit-trimer vaccine based on Wuhan coronavirus (2019-nCoV), 2020). Conversely, an engineered trimeric ACE2 has been shown to bind three RBD proteins and inhibit SARS-CoV-2 infection (Guo et al., 2020; Xiao et al., 2021). An engineered RBD multimer construct coupled with an immunogenic carrier protein also induced superior immunogenicity as a multimer, than as a monomer, further suggesting the benefits of utilizing RBD multimers in SARS-CoV-2 research (Berguer et al., 2021). Tagged recombinant SARS-COV-2 RBD protein is commonly used as a tool in SARS-CoV-2 research. However, commercially available and commonly used recombinant RBD is monomeric and comprehensive studies using trimeric RBD in comparison with monomeric RBD are limited. Here, we engineered a trimeric RBD, which is expected to mimic the tertiary structure of the SARS-CoV-2 spike protein ACE2-binding interface in physiological conditions. We hypothesized that the increased similarities of trimeric RBD to physiological conditions would competitively and potently bind to host cell ACE2, thus inhibiting viral entry at a greater efficiency than recombinant RBD monomers. We designed a mammalian expression vector to express secreted trimeric RBD by cloning RBD as a fusion protein with a leucine zipper and a leader sequence (Ramakrishnan et al., 2004). We demonstrate that our engineered RBD specifically and potently binds to the ACE2 receptor. We show that our trimeric RBD more efficiently blocks SARS-CoV-2 pseudovirus entry into ACE2 expressing cells compared to monomeric RBD in vitro and also blocks the entry of SARS-CoV-2 true virus and plaque formation in Vero cells. The study demonstrates a head-to-head comparison of trimeric and monomeric RBD and shows that the use of engineered trimeric RBD is a superior method to the use of monomeric RBD, to inhibit SARS-CoV-2 infection in cellular systems.

Results

Trimeric receptor-binding domain expression in HEK 293T cells

Given the importance of the trimeric nature of the native spike protein to potently bind to host cells, we hypothesized that an engineered trimeric RBD (tRBD) would have the ability to similarly bind to multiple ACE2 receptors on host cells, and outcompete the SARS-CoV-2 virus for cell entry. We cloned the RBD region into a mammalian expression vector in fusion with a modified leucine zipper to induce trimerization, a leader sequence to allow the secretion of the recombinant protein, and FLAG or HIS epitope tag to allow purification (Figure 1A).
Figure 1

Construction and expression of tRBD and mRBD in vitro

(A and B) (A) Liner representation of FLAG or HIS-tagged SARS-COV-2 RBD construct sequence for the expression of tRBD (B) Expression levels of FLAG-tagged (top) or HIS-tagged (bottom) tRBD at varying timepoints after transfection of HEK293T-ACE2 cells.

(C) Schematic representing protocol for tRBD and mRBD protein purification.

(D) Varying concentrations of HIS-tagged commercially available recombinant SARS-COV-2 RBD protein (Lane 1–6), and conditioned media with HIS-tagged mRBD (Lane 7) or HIS-tagged tRBD (Lane 8) was separated via SDS/PAGE gel and probed with anti-HIS antibody. A linear regression curve was constructed using densitometry analysis.

(E) tRBD was crosslinked with glutaraldehyde (GLA) and incubated at temperatures indicated. Crosslinked proteins were separated in SDS/PAGE gel and probed with anti-HIS antibody. (n = 2 independent samples).

Construction and expression of tRBD and mRBD in vitro (A and B) (A) Liner representation of FLAG or HIS-tagged SARS-COV-2 RBD construct sequence for the expression of tRBD (B) Expression levels of FLAG-tagged (top) or HIS-tagged (bottom) tRBD at varying timepoints after transfection of HEK293T-ACE2 cells. (C) Schematic representing protocol for tRBD and mRBD protein purification. (D) Varying concentrations of HIS-tagged commercially available recombinant SARS-COV-2 RBD protein (Lane 1–6), and conditioned media with HIS-tagged mRBD (Lane 7) or HIS-tagged tRBD (Lane 8) was separated via SDS/PAGE gel and probed with anti-HIS antibody. A linear regression curve was constructed using densitometry analysis. (E) tRBD was crosslinked with glutaraldehyde (GLA) and incubated at temperatures indicated. Crosslinked proteins were separated in SDS/PAGE gel and probed with anti-HIS antibody. (n = 2 independent samples). We transfected HEK293T cells with our engineered tRBD plasmid to produce FLAG or HIS-tagged tRBD or HIS-tagged mRBD. The culture supernatants were assessed at the time points indicated by Western blotting. The highest expression of FLAG-tRBD (Figure 1B top) and HIS-tRBD (Figure 1B bottom) was observed at 72 h post-transfection. Thus, 72 h post-transfection period was chosen for collecting the conditioned media containing tRBD or mRBD for purification and use in all further experiments as described in the flow chart (Figure 1C). We estimated the amounts of tRBD and mRBD in the conditioned media 72 h post-transfection by Western blotting and densitometry analysis (Figure 1D). A linear regression equation was obtained by plotting the densitometry values of increasing concentrations of commercially available recombinant RBD in the range of 25–150 ng. This calibration plot was used to quantitate the amount of mRBD and tRBD in the subsequent experiments. tRBD and mRBD were purified from conditioned media using NiNTA Agarose affinity purification and ion-exchange chromatography (Figure 1C). We obtained approximately 819 μg of mRBD and 115 μg of tRBD per liter of transfected HEK293T cell culture supernatant. To confirm the trimeric nature of tRBD, purified tRBD was crosslinked with glutaraldehyde and incubated at 25°C or 80°C. Analysis by Western blot confirmed the trimeric nature of tRBD at ∼90 kDa (Figure 1E). We also found a temperature-dependent increase in cross-linking efficiency observed at 80°C compared to 25°C.

Receptor-binding domain trimer interacts more efficiently with ACE2 than receptor-binding domain monomer

To obtain direct evidence that our engineered tRBD interacts with ACE2 receptor on host cells, we treated HEK293T cells stably expressing the ACE2 receptor (HEK293T-ACE2) with FLAG-tagged or HIS-tagged tRBD and performed immunoprecipitation using anti-FLAG antibody (Figure 2A, left) or NiNTA beads (Figure 2A, right), respectively (Figure 2A, left). The assessment of immunoprecipitates confirmed that tRBD is able to bind to ACE2 in vitro. To exclude the possibility that the binding of tRBD to ACE2 is owing to the overexpression of ACE2 in HEK293T cells, we used Vero cells, which express endogenous ACE2 receptor and demonstrated that similar to HEK293T-ACE2 cells, tRBD binds to endogenously expressed ACE2 receptor (Figure 2A, bottom).
Figure 2

In vitro binding ability of RBD:ACE2

(A and B) HEK293T-ACE2 cells (3 × 105) or Vero E6 cells (8 × 105) were plated 24 h prior in 6 and 10 cm plates, respectively. (A) HEK293T-ACE2 cells were treated with 2.5 mL of FLAG-tagged tRBD (left) or HIS-tagged tRBD (right). Vero E6 cells were treated with 5 mL of FLAG-tagged tRBD or HIS-tagged tRBD (bottom). (B) HEK293T-ACE2 cells were treated with 666.7 ng/mL of HIS-tagged mRBD (indicated as one in the figure) or tRBD (indicated as one in the figure) or 2000 ng/mL of HIS-tagged tRBD (indicated as three in the figure). Thirty minutes following incubation, cells were assessed by immunoprecipitation using (A, left) anti-FLAG or (A, right and B) NiNTA Agarose beads. (B, bottom) Densitometry analysis of three independent Western blots as in Figure 2B, top, presented as mean ± SE of mean (SEM). ∗∗p< 0.01, ns - non significant.

In vitro binding ability of RBD:ACE2 (A and B) HEK293T-ACE2 cells (3 × 105) or Vero E6 cells (8 × 105) were plated 24 h prior in 6 and 10 cm plates, respectively. (A) HEK293T-ACE2 cells were treated with 2.5 mL of FLAG-tagged tRBD (left) or HIS-tagged tRBD (right). Vero E6 cells were treated with 5 mL of FLAG-tagged tRBD or HIS-tagged tRBD (bottom). (B) HEK293T-ACE2 cells were treated with 666.7 ng/mL of HIS-tagged mRBD (indicated as one in the figure) or tRBD (indicated as one in the figure) or 2000 ng/mL of HIS-tagged tRBD (indicated as three in the figure). Thirty minutes following incubation, cells were assessed by immunoprecipitation using (A, left) anti-FLAG or (A, right and B) NiNTA Agarose beads. (B, bottom) Densitometry analysis of three independent Western blots as in Figure 2B, top, presented as mean ± SE of mean (SEM). ∗∗p< 0.01, ns - non significant. Because tRBD contains three RBD units, we hypothesized that tRBD would bind more ACE2 than mRBD. To compare the binding abilities of tRBD and mRBD to ACE2, we incubated conditioned media containing HIS-tagged tRBD or mRBD with HEK293T-ACE2 cells. We estimated the total RBD protein concentration in the conditioned media expressing tRBD and mRBD using the commercial recombinant HIS-RBD protein as a standard (Figure 1D), and examined two different amounts of tRBD to study ACE2 binding. First, we treated cells with normalized total protein concentration of RBD in the conditioned media. This yielded one-third of the tRBD structural units compared to mRBD (Figure 2B, mRBD one and tRBD 1, lanes two and 3), as a single tRBD is comprised of three RBD units while a single mRBD only has one RBD unit. When used at equal protein concentrations, we found that mRBD and tRBD were able to bind similar amounts of ACE2. Next, we used three times the concentration of tRBD to normalize the number of mRBD and tRBD structural units (Figure 2B, mRBD one and tRBD 3, lanes two and 4). When equal amounts of structural units of tRBD and mRBD were used, tRBD was able to bind to and precipitate significantly higher amounts of ACE2. Taken together, this suggests that one-third structural units of tRBD are sufficient to bind and precipitate the same amounts of ACE2 as mRBD, directly showing that tRBD and ACE2 are able to bind potently (Figure 2B).

Molecular modeling of the binding of receptor-binding domain monomer and trimer to the ACE2 receptor

Our in vitro data determined that tRBD is able to bind to ACE2 receptor more potently than mRBD. We performed molecular modeling to confirm these results and comparatively studied the binding of mRBD and tRBD to the ACE2 receptor in silico (Figures 3A–3D). Our modeling studies suggest that similar to the native spike protein, mRBD can only bind to ACE2 receptor through a single RBD receptor-binding motif (RBM) (Figure 3C). However, our engineered tRBD can interact with up to three ACE2 receptors using all three RBM (Figure 3D), potentially forming larger scale networks (see discussion). Because the linker between the coiled-coil region (the leucine zipper) and the RBD is flexible and of sufficient length, the RBD may change orientation. However, even a single trimer may bind ACE2 more strongly by turning two of the RBDs by 180° allow both domains to bind to an ACE2 dimer simultaneously (Figure 3D), with the third RBD engaging a separate ACE2.
Figure 3

Molecular modeling and surface plasmon resonance data

(A–D) Structure of (A) monomeric RBD (mRBD) and configuration of (B) trimeric RBD (tRBD). (C) Binding models of mRBD with ACE2 dimer; (D) Binding models of tRBD with ACE2. tRBD binds to two units of an ACE dimer (left) as RBDs can rotate relative to one another, or binds to three separate ACE2 dimers (right).

(E) Representative binding sensorgrams for mRBD:ACE2 and tRBD:ACE2 interactions using the single cycle kinetic assay. Binding sensorgrams were generated from five independent injections of mRBD/tRBD. Black and red lines represent fitted curves generated by 1:1 binding.

(F) mRBD or tRBD in running buffer (PBSP+, pH7.4 purchased from Cytiva) were flowed over three surfaces with a density of 500–1500RU biotin-ACE2 on an S series SA sensorchip in a Biacore T200 system. Mean kinetic rate constant Ka, Kd and the equilibrium dissociation constant (KD = Kd/Ka) were measured from single-cycle kinetics and globally fitted by BiaEvaluation 3.1 software using 1:1 binding model, three sets of data were averaged and standard errors for the affinity values are shown.

Molecular modeling and surface plasmon resonance data (A–D) Structure of (A) monomeric RBD (mRBD) and configuration of (B) trimeric RBD (tRBD). (C) Binding models of mRBD with ACE2 dimer; (D) Binding models of tRBD with ACE2. tRBD binds to two units of an ACE dimer (left) as RBDs can rotate relative to one another, or binds to three separate ACE2 dimers (right). (E) Representative binding sensorgrams for mRBD:ACE2 and tRBD:ACE2 interactions using the single cycle kinetic assay. Binding sensorgrams were generated from five independent injections of mRBD/tRBD. Black and red lines represent fitted curves generated by 1:1 binding. (F) mRBD or tRBD in running buffer (PBSP+, pH7.4 purchased from Cytiva) were flowed over three surfaces with a density of 500–1500RU biotin-ACE2 on an S series SA sensorchip in a Biacore T200 system. Mean kinetic rate constant Ka, Kd and the equilibrium dissociation constant (KD = Kd/Ka) were measured from single-cycle kinetics and globally fitted by BiaEvaluation 3.1 software using 1:1 binding model, three sets of data were averaged and standard errors for the affinity values are shown. We next studied the real-time interaction between ACE2 and tRBD or mRBD using surface plasmon resonance (SPR). Biotinylated ACE2 was captured on a streptavidin sensor chip and binding assays were performed with different concentrations of purified mRBD or tRBD. Representative sensorgrams for tRBD (Figure 3E, left) and mRBD (Figure 3E, right) are shown. To calculate kinetic parameters, a 1:1 Langmuir data fitting was applied to the sensorgrams. Our engineered tRBD showed a dissociation rate of 3.54 × 10−5 1/s while mRBD showed a much faster dissociation rate of 7.26 × 10−3 1/s (Figure 3F). This indicates that tRBD has a higher affinity to ACE2 than mRBD. The binding affinity KD between mRBD and ACE2 was detected to be 30 nM, which is consistent with the binding affinity reported in previous studies (Kim et al., 2021; Lan et al., 2020; Liu et al., 2021). Importantly, our engineered tRBD binds ACE2 with a 58.8-fold higher affinity (KD = 0.51 nM) than mRBD (KD = 30 nM), further supporting our molecular modeling data indicating that tRBD binds to ACE2 with higher affinity than mRBD.

Receptor-binding domain trimer block SARS-COV-2 pseudovirus entry into ACE2 expressing cells

Our biochemical binding studies suggested that tRBD binds to ACE2 very potently and our molecular modeling indicated the plausible spatial orientation of the tRBD binding to ACE2. We then hypothesized that tRBD’s structure would prove advantageous to outcompete native spike protein and occupy host cell ACE2 to prevent viral entry. To test the functional effect of tRBD:ACE2 binding, we utilized a luciferase reporter system to measure the amount of pseudoviral entry into HEK293T-ACE2 cells as previously described (Crawford et al., 2020). Cells were incubated with equal concentrations of tRBD or mRBD simultaneously with pseudovirus for 48 h. Infectivity of SARS-CoV-2 was assessed by viral-entry-dependent luciferase expression (RLU). Starting at 30 ng, tRBD was able to better inhibit pseudovirus entry into HEK293T-ACE2 cells than mRBD (Figure 4A). Next, we assessed the separate abilities of various dilutions of mRBD and tRBD to inhibit pseudoviral entry. Although mRBD only showed moderate pseudoviral entry inhibition at 50 ng, tRBD showed significant pseudoviral entry inhibition at both 50 and 25 ng dilutions (Figure 4B). At the highest concentration tested, mRBD showed only 1.6-fold inhibition, while tRBD showed about 6-fold inhibition of pseudoviral entry (Figure 4C). Thus, tRBD was found to be able to inhibit pseudovirus entry about 4 times better than mRBD. This demonstrates the functional advantage of our trimeric tool in its ability to occupy ACE2 receptors and inhibit the spike-mediated viral infection of host cells. To ensure that mRBD and tRBD inhibition was specific to spike:ACE2-mediated viral entry, we treated infected HEK293T-ACE2 cells with a VSV-G pseudotyped virus, without or with mRBD or tRBD. VSV-G has a broad cell tropism which enables it to infect most mammalian cell types (Gillies and Stollar, 1980; Seganti et al., 1986). We found that both tRBD and mRBD were unable to block the VSV-G-mediated viral infection of HEK293T-ACE2 cells (Figure 4D), showing that mRBD and tRBD selectively blocks spike-ACE2-mediated viral entry.
Figure 4

tRBD-mediated inhibition of SARS-COV-2 pseudovirus cell entry in HEK293T-ACE2 cells

(A–D) HEK293T-ACE2 cells (1.25 × 104 cells/well) were treated with specified amounts of HIS-tagged mRBD or HIS-tagged tRBD. (A and B) SDS/PAGE gel was used to verify equal concentrations of mRBD or tRBD was used. (A–C) SARS-CoV-2 pseudovirus (1:0) or (D) VSVG virus (1:50) with the Luciferase-IRES-ZsGreen backbone were produced via calcium phosphate transfection and co-treated onto HEK293T-ACE2 cells. Luciferase activity was assessed and values are presented as RLU of infected cells treated with tRBD or mRBD over cells infected with pseudovirus alone. Data are representative of three independent experiments conducted in triplicates and are presented as mean ± SE of mean (SEM). Statistical significance was analyzed using two-tailed Student’s unpaired t test, ∗p < 0.05; ∗∗p < 0.01, ∗∗∗p<0.001, ns – non significant.

tRBD-mediated inhibition of SARS-COV-2 pseudovirus cell entry in HEK293T-ACE2 cells (A–D) HEK293T-ACE2 cells (1.25 × 104 cells/well) were treated with specified amounts of HIS-tagged mRBD or HIS-tagged tRBD. (A and B) SDS/PAGE gel was used to verify equal concentrations of mRBD or tRBD was used. (A–C) SARS-CoV-2 pseudovirus (1:0) or (D) VSVG virus (1:50) with the Luciferase-IRES-ZsGreen backbone were produced via calcium phosphate transfection and co-treated onto HEK293T-ACE2 cells. Luciferase activity was assessed and values are presented as RLU of infected cells treated with tRBD or mRBD over cells infected with pseudovirus alone. Data are representative of three independent experiments conducted in triplicates and are presented as mean ± SE of mean (SEM). Statistical significance was analyzed using two-tailed Student’s unpaired t test, ∗p < 0.05; ∗∗p < 0.01, ∗∗∗p<0.001, ns – non significant.

Trimeric receptor-binding domain blocks SARS-CoV-2 infection

To validate the inhibition findings from infection with the pseudovirus, we confirmed the ability of tRBD to block infectious SARS-CoV-2 by using an isolate of the true virus (USA-WA1/2020) for in vitro infection of Vero E6 cells. Vero E6 cells are completely susceptible to SARS-CoV-2 without exogenous overexpression of ACE2 and are commonly used for SARS-CoV-2 propagation and plaque assays. We first pre-incubated these cells with varying concentrations of mRBD and tRBD for 30 min prior to infection. We then assessed the percentage of infectivity of SARS-CoV-2 by measuring the number of plaque-forming units per milliliters (PFU/mL) 72 h post-infection. Representative images of the plaques not only show a reduction in the overall number of plaques that are formed but also a reduction in the average diameter of the plaques at high tRBD concentrations (Figure 5A). This indicates that the tRBD can prevent the entry of virus into cells and also, when present at high enough concentrations, can inhibit subsequent spread to adjacent cells after initial infection occurs. Furthermore, similarly to infection with the pseudovirus, SARS-CoV-2 infection increased at the highest media dilutions of tRBD, proving that the ability of tRBD to block SARS-CoV-2 infection is impaired at lower concentrations. In contrast, mRBD did not evoke much inhibition when compared to Mock (Mk) media in the infectious SARS-CoV-2 assays, even in the undiluted mRBD media (Figure 5B). The dose-response curve for tRBD indicated the dosage at which 50% of infectious virus was inhibited (inhibitory concentration 50 or IC50) is equal to 1602 ng/mL (95% CI 1209–2,198 ng/mL) (Figure 5C). Thus, tRBD inhibits SARS-CoV-2 infectivity in a dose-dependent manner by competing with the viral spike protein for ACE2 binding on the host cell.
Figure 5

SARS-CoV-2 Plaque reduction assay

(A and B) Vero E6 cells grown in 24-well plates were incubated with undiluted (1:0) or 2-fold serially diluted mRBD (●), tRBD (▪), or media (Mk-▲) for 30 min prior to SARS-CoV-2 infection. (A) Representative images of plaque formation on Vero E6 cells in the presence of the indicated conditioned media. (B) Plaque-forming units per milliliter (PFU/mL) were measured 72 h post-infection and values of three independent experiments, each conducted in triplicate, were combined. Individual data points represent the mean titer for each experiment. Bar plots indicate the mean of the individual experiments for each condition tested ±standard errors of mean values (SEM).

(C) Dose-response curve with normalized values from (B) graphed to represent the mean of three independent experiments, each value was normalized to the Mk titer of SARS-CoV-2 for the media dilution independently for each experiment performed. Error bars represent 95% confidence interval. (B and C) Significance was determined by ANOVA with Dunnett’s multiple comparison test. ∗p < 0.05; ∗∗p < 0.01; ∗∗∗∗p < 0.0001, presented as mean ± SE of mean (SEM).

SARS-CoV-2 Plaque reduction assay (A and B) Vero E6 cells grown in 24-well plates were incubated with undiluted (1:0) or 2-fold serially diluted mRBD (●), tRBD (▪), or media (Mk-▲) for 30 min prior to SARS-CoV-2 infection. (A) Representative images of plaque formation on Vero E6 cells in the presence of the indicated conditioned media. (B) Plaque-forming units per milliliter (PFU/mL) were measured 72 h post-infection and values of three independent experiments, each conducted in triplicate, were combined. Individual data points represent the mean titer for each experiment. Bar plots indicate the mean of the individual experiments for each condition tested ±standard errors of mean values (SEM). (C) Dose-response curve with normalized values from (B) graphed to represent the mean of three independent experiments, each value was normalized to the Mk titer of SARS-CoV-2 for the media dilution independently for each experiment performed. Error bars represent 95% confidence interval. (B and C) Significance was determined by ANOVA with Dunnett’s multiple comparison test. ∗p < 0.05; ∗∗p < 0.01; ∗∗∗∗p < 0.0001, presented as mean ± SE of mean (SEM).

Discussion

While exploring the methods to block CoV-2 infection, we found that the spike RBD was commonly studied and sold in a monomeric form, while the actual spike protein is a trimer. We realized that comprehensive studies using trimeric RBD are limited and this prompted us to model and generate a trimeric RBD. We hypothesized that the trimer may block the spike-mediated viral entry better than the monomer. In addition, the use of trimeric RBD may provide double advantage in blocking the viral infection and serve as an immunogen to generate anti-CoV-2 antibodies when used as a therapeutic agent in the host organism. In this study, we utilized the RBD region of the spike protein of SARS-CoV-2 virus to create a trimeric RBD, which effectively inhibited the entry of both psuedotyped and true SARS-CoV-2 virus. We focused on the RBD region because it is the mediator of host cell engagement and is highly conserved between various betacoronaviruses. Our focus was to develop a method to block RBD:ACE2 engagement. Recent studies have also described the ability of recombinant RBD fragment protein to block SARS-CoV-2 infection (Tai et al., 2020). The monomeric and trimeric RBD show significant differences in their three-dimensional structure (Figures 3A–3D), leading us to hypothesize that usage of either entity would result in different biological outcomes. We also suspected that trimerizing RBD protein would more mimic the actual virus conformation, and therefore lead to more favorable binding to ACE2. In our study, we show that trimeric RBD is superior to monomeric RBD in binding to ACE2 (Figures 2 and 3), blocking spike-mediated viral infection in pseudoviral assay (Figure 4) and in blocking true virus infection (Figure 5). RBD trimer was able to block viral entry about 4 times better than monomeric RBD, likely in part owing to the reorientation that is possible of the RBDs in the trimer, allowing it to bind an ACE2 dimer from both sides. The dissociation constant KD of SARS-CoV-2 has consistently been reported to be lower than that of SARS-CoV (Nguyen et al., 2020; Walls et al., 2020; Wrapp et al., 2020), thus it is plausible that the trimeric CoV-2 RBD may also block ACE2 binding of other betacoronaviruses such as SARS-CoV and MERS-CoV. Moreover, the efficacy of tRBD can be increased upon potential SARS-CoV-2 infection because if many ACE2 receptors are close in proximity, in principle, the higher local concentration of the RBDs in a trimer is expected to allow a faster Kon rate for the second ACE2:RBD pair, but a slower rate is seen suggesting a configurational change. The Koff for a single ACE2:RBD interaction is expected to be similar for both the mRBD and tRBD, but the positive cooperativity in different RBDs of tRBD probably slowed the dissociation rate (Figure 3). Furthermore, just as in the natural spike protein trimer, three ACE2 dimers may bind to one RBD trimer through one of the ACE2 units, leaving the second unit for binding to another RBD trimer. Thus, potentially a 2D network is formed on the surface of the cell. Thus, based on our molecular modeling and biochemical-binding studies as well as biophysical assays, we speculate that the trimeric RBD may simultaneously bind multiple ACE2 receptors in its vicinity. It is plausible that these tRBD:ACE2 complexes are associated with one cell or the adjacent cells, ultimately resulting in a reduced availability of ACE2 sites for the real virus infection (See graphical abstract for the speculative model). The important role that the spike protein has in membrane fusion and viral infection has made it a primary target for the development of small molecular inhibitors, antibody therapy, and vaccines. The outpouring of research after the outbreak of the coronavirus pandemic has resulted in many potential drugs targeting different portions of the SARS-CoV-2 spike protein (Huang et al., 2020). Vaccine strategies have also pinpointed different portions of the spike protein to generate host cell immunogenicity. There are several ongoing efforts toward developing trimerized full-length spike protein as well as the utilization of RBD protein to elicit an immune response for virus protection (W. H. Chen et al., 2020b). One of the RNA-based vaccine candidates evaluated by Pfizer encoded a trimerized SARS-CoV-2 RBD which was able to elicit a robust humoral and cell-mediated antiviral response (Walsh et al., 2020) showing the potential efficacy and feasibility of using tRBD as therapeutics. Previous studies following the SARS pandemic in 2003 have also shown the advantages of an RBD-based vaccine to minimize host reactivity with efficient viral neutralizing ability (Jiang et al., 2012). Recent studies have also demonstrated the ability of engineered trimeric RBD proteins to effectively elicit neutralizing antibodies in hosts (Malladi et al., 2021; Routhu et al., 2021). Our engineered trimer supports published literature (Liu et al., 2021; Xiong et al., 2020) which suggests that the flexibility and molecular similarity of a trimeric RBD protein to the native spike protein is a promising therapeutic approach to combating SARS-CoV-2. Our modeling and binding studies suggests that the engineered tRBD possesses flexibility to interact with up to three ACE2 receptors. The ability of our engineered RBD to reorient gives it the potential to form larger scale networks. This tri-prong binding likely provides an avidity effect, which is not possible in the natural spike protein trimer, as the RBDs cannot reorient. This gives an advantage for our engineered trimeric RBD to bind to and block ACE2 receptor’s spike-binding regions. We used a modified leucine zipper that has isoleucine substitutions at the a and d positions to allow for trimer formation, in contrast to the dimers formed from traditional GCN4 leucine zippers (Harbury et al., 1994). The modified leucine zipper is widely used in biomedical research for therapeutics that require trimerization for their activity, including drugs that have been tested preclinically (Melchers et al., 2011; Morris et al., 2007; Rozanov et al., 2009) and clinically (Morris et al., 1999; Vonderheide et al., 2001). Interestingly, trimeric protein vaccines utilizing a modified leucine zipper against HIV (Melchers et al., 2011), respiratory syncytial virus (Rigter et al., 2013), and influenza virus (Cornelissen et al., 2010; Loeffen et al., 2011; Rigter et al., 2013) have proven successful preclinically. Despite the extensive use of this modified leucine zipper in both preclinical and clinical models, it is possible that this trimerization protein domain has immunogenic potential. However, a mutated modified leucine zipper with specific N-linked glycosylation sites has been described to successfully dampen leucine-zipper-induced immunogenicity but not affect protein multimerization or immune response to the antigens fused to the zipper (Sliepen et al., 2015). The breadth of literature to support the successful usage of a modified leucine zipper for protein trimerization in therapeutics made us confident that this was a valid and useful approach to designing a tool against the SARS-CoV-2 virus. Our study is unique in that it demonstrates a comparative evaluation of the monomeric and trimeric RBD in binding to the ACE2 receptor and their molecular ability to block SARS-CoV-2 host cell infection through competitive inhibition. This biochemical study provides valuable mechanistic and pharmacological information that can be utilized in improving trimeric RBD-based therapeutic development. Such an evaluation may prove valuable in designing novel therapeutic methods for CoV-2 as well as other viruses that employ a similar mechanism of infection. Paired with previous publications showing the ability of trimeric RBD to elicit neutralizing antibodies, we thus believe that our study suggests that the usage of a trimeric RBD can deliver therapeutic potential using a two pronged approach: 1) protecting hosts from future infection via antibody response and 2) protection from current SARS-CoV-2 viral infection prior to antibody production. Further development of our engineered tRBD could be used as a therapeutic to stop SARS-CoV-2 infection from spreading to neighboring cells after clinical detection. SARS-CoV-2 is continuing to evolve and mutate. Many of these mutations entail amino acid changes in the receptor-binding motif (RBM) where the RBD is in direct contact with ACE2 to improve RBD:ACE2 binding (J. Chen et al., 2020a). These mutations, while not more pathogenic, are more infectious. Specific mutation variants have become resistant to some neutralizing antibodies (Li et al., 2020). We are unsure if our engineered RBD trimer generated using the wild type protein sequence will outcompete the mutated virus; however, this approach can be validated for any mutant variants of the virus by generating vectors with site-specific mutations in the RBD domain. Furthermore, viral mutations that improve RBD:ACE2 binding provide important insight into how to continuously improve our engineered trimer in the future. By analyzing the mutations that result in improved receptor binding, we will be able to improve our current trimer to further improve viral entry blockade. We view our engineered trimer as a complement to the SARS-CoV-2 vaccines that have been recently approved by the FDA. Although the SARS-CoV-2 vaccines have a >90% efficacy, they require multiple doses leaving a latency period before virus protection begins (Moderna, 2020; Rose et al., 2020). As with all vaccines, there will also be a population who will fail to mount an effective amount of neutralizing antibodies, particularly in high-risk populations (Goodwin et al., 2006). In the future, molecules such as our RBD trimer can be delivered simultaneously or prior to vaccines to confer more antiviral protection. This use of combinatorial therapeutic approaches will confer improved protection from SARS-CoV-2 and also will help prevent the induction of more severe infection.

Limitations of the study

We have generated an enforced trimeric RBD using a modified leucine zipper domain. It is not clear whether such an approach will cause any unwanted effects when used in vivo. Although our molecular modeling, in vitro and in true virus studies show the efficacy of the trimeric RBD, the actual structural details of how it binds and blocks CoV-2 infection are not known. As the trimeric RBD is likely able to bind to multiple ACE2 receptors at the cell surface, it remains to be determined whether it will cause the activation of cellular signaling downstream of the ACE2 receptor.

STAR★Methods

Key resources table

Resource availability

Lead contact

Information and requests for resources and reagents should be directed to and will fulfilled by Dr. Parameswaran Ramakrishnan (pxr150@case.edu).

Materials availability

Plasmids generated specifically for this study are available upon request.

Experimental model and subject details

Cells

Vero-E6, HEK293T, HEK293T cells stably expressing ACE2 protein (HEK293T-ACE2) were grown in complete DMEM media supplemented with 2 mM L-glutamine, 100 U/mL penicillin/streptomycin, and 10% heat inactivated FBS (Sigma Aldrich).

Virus

SARS CoV-2 isolate USA-WA1/2020 was obtained from BEI Resources, NIAID, NIH (full designation: SARS-Related Coronavirus 2, Isolate USA-WA1/2020, NR-52281, deposited by the Centers for Disease Control and Prevention).

Method details

Molecular modeling

The leucine (GCN4) zipper was used as a template (PDB 4dme) to model the structure of modified leucine zipper (MKQIEDKIEEILSKIYHIENEIARIKKLIGERLDP). This modified sequence is known to form coiled-coil trimers (Fanslow et al., 1994)The leucine zipper was fused to three spike RBD (319–541) via a flexible linker with sequence HHHHHHHHHHGGGGS. ACE2 are docked to RBDs with template of ACE2:RBD binding structure (PDB, 6m17). The linker region between RBD and leucine zipper is long and flexible. We explored the binding modes of leucine zipper RBD timer with one or multiple ACE2 dimer.

Recombinant protein expression and purification

The cDNA for RBD was purchased from Sino Biological (Cat# VG40592-NH) and cloned in fusion with a leader sequence, a modified leucine zipper that allows trimer formation (Fanslow et al., 1994), and FLAG or HIS tag into the mammalian expression vector pcDNA3, as previously described (Ramakrishnan et al., 2004). The mammalian expression vector expressing secreted monomeric HIS tagged RBD (pCAGGS-HIS RBD) was kindly provided by Dr. Florian Krammer, Icahn School of Medicine at Mount Sinai, New York. Recombinant tRBD and mRBD proteins were produced via transient transfection of HEK293T cells using calcium phosphate precipitation. Cells were washed twice with PBS after 6 hours and incubated in fresh 2% FBS DMEM. Culture medium containing tRBD and mRBD was collected after 72 hours, centrifuged, and passed through a 0.45 μm syringe filter. tRBD and mRBD conditioned media were stored at −80°C until use. Expression of tRBD and mRBD was confirmed by Western blotting. To purify tRBD, fresh cleared conditioned media containing tRBD was loaded onto a column packed with washed Ni-NTA beads (5 mL beads/500 mL media; Cat#30210) equilibrated with equilibration buffer (20 mM sodium phosphate pH 7.4; 0.5 M NaCl). Beads were sequentially washed with washing buffer (20 mM sodium phosphate pH 7.4; 0.5 M NaCl) containing 10, 20 and 30 mM imidazole to remove nonspecific protein binding. Bound proteins were eluted using elution buffer (20 mM sodium phosphate pH 7.4; 0.5 M NaCl) containing 250 mM imidazole. The eluted fraction was dialyzed against Tris-NaCl buffer (25 mM Tris pH 7.4; and 25 mM NaCl) to remove imidazole and concentrated using spin columns (MWCO 50 kDa) prior to ion-exchange chromatography. The concentrated protein samples were loaded on a MonoQ column equilibrated with Tris-NaCl buffer (25 mM Tris pH 7.4; and 25 mM NaCl) using an AKTA FPLC system. The eluted fractions containing tRBD were dialyzed against PBS (pH 7.4) and concentrated in spin columns (MWCO 50 kDa). Purified tRBD was stored at −80°C until further use.

Quantification of secreted tRBD and mRBD in culture media

Concentrations of tRBD and mRBD in the culture supernatants were estimated by western blot and densitometry analysis. Densitometry analysis of bands was done using ImageJ software (NIH). A standard curve was generated using incremental concentrations of recombinant RBD (Sino Biological, Cat.# 40592-V08B) and a regression equation was obtained. Concentrations of tRBD or mRBD were then calculated per the regression equation.

Chemical crosslinking of tRBD

Chemical crosslinking of tRBD was carried out as previously described (Wang et al., 2014). Briefly, 2.5% glutaraldehyde was added to the purified tRBD (20 μg/mL) in PBS and incubated at 25°C or 80°C for 5 min. The reaction was stopped by adding 1M Tris-HCl and proteins were analyzed by Western blot.

Immunoprecipitation and western blotting

HEK 293T-ACE2 cells were cultured to 90% confluency and treated with HIS-tagged or FLAG-tagged tRBD or mRBD media for 30 minutes. Cells were lysed in lysis buffer (1.0% Triton-X100, 20 mM HEPES [pH 7.6], 0.1% SDS, 0.5% Sodium deoxycholate, 150 mM NaCl, 1 mM EDTA and complete protease inhibitor cocktail) for 15 minutes on ice. Immunoprecipitation was carried out at 4°C for 2 hours using anti-FLAG M2 agarose beads (Sigma; Cat# A2220) or Ni-NTA agarose beads (Qiagen; Cat#30210). For Western blot analysis, cell lysates as well as immunoprecipitates were resolved through 12% SDS-PAGE gels. Proteins from gels were transferred onto nitrocellulose membranes, probed using relevant antibodies, and visualized via enhanced chemiluminescence reagent.

Surface plasmon resonance

SPR studies were performed using a BIAcore T200 device (Cytiva) at 25°C. Chamber temperature was set at 10°C to store protein samples. The binding assays were conducted in PBSP + buffer, containing 20 mM phosphate (pH 7.4), 137 mM NaCl and 2.7mM KCl, plus 0.05% surfactant Tween-20. Next, biotin-ACE2 was captured on an S-series SA sensor chip (BIAcore) at a density ranging from 500-1500RU on different flow cells. Three-fold series of tRBD ranging from 0.237 nM to 19.19nM (12.35 nM to 1000 nM for mRBD) were then injected at a rate of 30 μL/min over surfaces using the single-cycle kinetics method. The dissociation time for mRDB was 600s and that of tRBD was extended to 3000s due to its slow off-rate. Each data point was repeated at least three times and double referencing was applied to all detected traces using BIAevaluation software (version 3.1). The binding data were globally fitted to a 1:1 Langmuir binding model. Sensorgrams were redrawn using Origin 2017 software.

Luciferase assay

Pseudotyped SARS-CoV-2 spike protein and neutralization assays were performed as previously described (Crawford et al., 2020). Briefly, HEK293T cells were co-transfected with SARS-CoV-2 spike-ALAYT, pHAGE-CMV-Luc2-IRES-Zsgreen, HDM-HgPM2, HDM-tat1b, PRC-CMV-Rev1b plasmids (generously gifted from Dr. Jesse D Bloom). Culture supernatant was collected after 48 hours and passed through a 45 μM filter and stored at −80°C until use. For neutralization assay, HEK293T-ACE2 cells were plated in a 96 well plate (1.25 × 104 cells/well) overnight. Cells were incubated with undiluted spike pseudotyped virus or 1:50 diluted VSVG pseudotyped virus along with indicated dilutions of tRBD and mRBD (final volume 200 μL/well) for 48 hours. 5 μg/mL polybrene was used to facilitate lentiviral infections. Luminescence was measured using luciferase assay system following manufacturer’s instructions (Promega, Cat# E1960) on a Spectramax 3000 plate reader and results were plotted as relative light units (RLU).

SARS-CoV-2 plaque reduction assay

SARS-CoV-2 isolate USA-WA1/2020 was propagated and stocks were maintained as previously described (Bruchez et al., 2020). Twenty-four hours prior to infection 1 × 105 Vero E6 cells per well were plated in 24-well plates such that cells would be at least 90% confluent at the time of infection. The following day, two-fold serial dilutions of mRBD, tRBD, and mock (Mk) conditioned media were prepared in virus media to the concentrations indicated in the figures. Confluent cell monolayers of Vero E6 cells were incubated with 250 μL of diluted mRBD, tRBD, or Mk media for 30 minutes at 37°C, with gentle rocking after 15 minutes. After incubation with conditioned media, each well received 50μL of SARS-CoV-2 diluted in virus media at a dilution of 10−4 and plates were incubated for 1 hour at 37°C, using 24-well plates, with gentle rocking every 15 minutes. Following incubation for one hour, each well received 500 μL of overlay medium containing DMEM with 0.05% agarose and 2% FBS followed by 72 hours incubation at 37°C. After cells were fixed using a 4% formaldehyde solution in PBS for 30 minutes and stained with crystal violet for 5 minutes. Viral titers of SARS-CoV-2 were measured by counting the number of plaque-forming units (PFU) per well and then considering dilutions to back-calculate plaque-forming units per milliliter (PFU/mL). To combine multiple individual experiments for IC50 calculations, values were normalized to Mk media for each dilution and IC50 values were calculated using the concentration of inhibitor vs normalized response with a variable slope in Prism software (V9.1.0, GraphPad) and are presented with 95% confidence interval.

Quantification and statistical analysis

Statistical differences in gene expression were analyzed with a two-tailed Student’s unpaired t test with Prism software (GraphPad). Data are presented as means ± SE of mean (SEM), unless otherwise indicated. ∗∗∗p < 0.001, ∗∗p < 0.01, ∗p < 0.05. In statistical significance of true virus infection, error bars represent 95% confidence interval and significance was determined by ANOVA with Dunnett’s multiple comparison tests. ∗p < 0.05; ∗∗p < 0.01; ∗∗∗p < 0.001, ∗∗∗∗p < 0.0001.
REAGENT or RESOURCESOURCEIDENTIFIER
Antibodies

ACE2 Rabbit AbCell signaling#4355S; RRID:AB_2797606
ACE2 Rabbit AbAbcam#Ab15348; RRID:
Monoclonal Anti-FLAG M2 antibody produced in mouseSigma Aldrich#F1804; RRID:
Purified anti-DYKDDDDK tag antibodyBioLegend637319
Anti-DYKDDDDK tag (L5) affinity gel antibody FLAG beadsBioLegend651501
Anti-FLAG M2 affinity GelMillipore Sigma#A2220
Monoclonal Anti-HIS tag antibody produced in mouseSigma Aldrich#SAB1305538; RRID:AB_2687993
Anti-Mouse IgG HRP conjugateCell signalingCat#7076s; RRID:AB_330924
Anti-Rabbit IgG HRP conjugateCell signalingCat#7074s; RRID:AB_2099233

Bacterial and virus strains

SARS CoV-2 isolate USA-WA1/2020BEI ResourcesNR-52281

Chemicals, peptides, and recombinant proteins

Recombinant SARS COV-2 spike protein (RBD HIS tag)Sino biological Inc#40592-V088 LC1MC 1106
Biotinylated Recombinant human ACE2Abclonal#RP02269
Ni-NTA AgaroseQIAGEN#30210
PolybreneMillipore sigma#TR-1003-G
Amicon ultra-15 centrifugal filtersMillipore sigma#UFC9050

Critical commercial assays

Dual-Luciferase reporter assay systemPromega#E1960

Experimental models: Cell lines

VERO-E6 cellsATCCCRL-1586
HEK293T cellsATCCCRL-3216
HEK293T-ACE2 cellsCrawford et al., 2020Gift (Dr. Jesse D Bloom)

Recombinant DNA

SARS-CoV2 Spike-ALAYT, pHAGE-CMV-Luc2- IRES-Zsgreen, HDM-HgPM2, HDM-tat1b, PRC-CMV-Rev1b plasmidsGift (Dr. Jesse D Bloom)Crawford et al. (2020)
SARS-CoV-2 (2019-nCoV) Spike (RBD) ORF mammalian expression plasmid, N-His tagSino biological Inc#VG40592-NH

Software and algorithms

Prism software V9.1.0GraphPadGraphPad
ImageJSchneider et al., 2012https://imagej.nih.gov/ij/

Other

Sensor Chip SACytivaCat#29104992
15Q column with SOURCE 15Q beadsGE HealthcareCat# 17-0947-20
  53 in total

1.  Phase I study of recombinant human CD40 ligand in cancer patients.

Authors:  R H Vonderheide; J P Dutcher; J E Anderson; S G Eckhardt; K F Stephans; B Razvillas; S Garl; M D Butine; V P Perry; R J Armitage; R Ghalie; D A Caron; J G Gribben
Journal:  J Clin Oncol       Date:  2001-07-01       Impact factor: 44.544

2.  Immunosilencing a highly immunogenic protein trimerization domain.

Authors:  Kwinten Sliepen; Thijs van Montfort; Mark Melchers; Gözde Isik; Rogier W Sanders
Journal:  J Biol Chem       Date:  2015-01-29       Impact factor: 5.157

3.  Cryo-electron microscopy structure of a coronavirus spike glycoprotein trimer.

Authors:  Alexandra C Walls; M Alejandra Tortorici; Berend-Jan Bosch; Brandon Frenz; Peter J M Rottier; Frank DiMaio; Félix A Rey; David Veesler
Journal:  Nature       Date:  2016-02-08       Impact factor: 49.962

4.  Receptor binding and priming of the spike protein of SARS-CoV-2 for membrane fusion.

Authors:  Donald J Benton; Antoni G Wrobel; Pengqi Xu; Chloë Roustan; Stephen R Martin; Peter B Rosenthal; John J Skehel; Steven J Gamblin
Journal:  Nature       Date:  2020-09-17       Impact factor: 49.962

5.  Characterization of the SARS-CoV-2 S Protein: Biophysical, Biochemical, Structural, and Antigenic Analysis.

Authors:  Natalia G Herrera; Nicholas C Morano; Alev Celikgil; George I Georgiev; Ryan J Malonis; James H Lee; Karen Tong; Olivia Vergnolle; Aldo B Massimi; Laura Y Yen; Alex J Noble; Mykhailo Kopylov; Jeffrey B Bonanno; Sarah C Garrett-Thomson; David B Hayes; Robert H Bortz; Ariel S Wirchnianski; Catalina Florez; Ethan Laudermilch; Denise Haslwanter; J Maximilian Fels; M Eugenia Dieterle; Rohit K Jangra; Jason Barnhill; Amanda Mengotto; Duncan Kimmel; Johanna P Daily; Liise-Anne Pirofski; Kartik Chandran; Michael Brenowitz; Scott J Garforth; Edward T Eng; Jonathan R Lai; Steven C Almo
Journal:  ACS Omega       Date:  2020-12-21

6.  The basis of a more contagious 501Y.V1 variant of SARS-CoV-2.

Authors:  Haolin Liu; Qianqian Zhang; Pengcheng Wei; Zhongzhou Chen; Katja Aviszus; John Yang; Walter Downing; Chengyu Jiang; Bo Liang; Lyndon Reynoso; Gregory P Downey; Stephen K Frankel; John Kappler; Philippa Marrack; Gongyi Zhang
Journal:  Cell Res       Date:  2021-04-23       Impact factor: 25.617

7.  Roadmap to developing a recombinant coronavirus S protein receptor-binding domain vaccine for severe acute respiratory syndrome.

Authors:  Shibo Jiang; Maria Elena Bottazzi; Lanying Du; Sara Lustigman; Chien-Te Kent Tseng; Elena Curti; Kathryn Jones; Bin Zhan; Peter J Hotez
Journal:  Expert Rev Vaccines       Date:  2012-12       Impact factor: 5.217

8.  Structural basis of receptor recognition by SARS-CoV-2.

Authors:  Jian Shang; Gang Ye; Ke Shi; Yushun Wan; Chuming Luo; Hideki Aihara; Qibin Geng; Ashley Auerbach; Fang Li
Journal:  Nature       Date:  2020-03-30       Impact factor: 49.962

9.  Characterization of the receptor-binding domain (RBD) of 2019 novel coronavirus: implication for development of RBD protein as a viral attachment inhibitor and vaccine.

Authors:  Wanbo Tai; Lei He; Xiujuan Zhang; Jing Pu; Denis Voronin; Shibo Jiang; Yusen Zhou; Lanying Du
Journal:  Cell Mol Immunol       Date:  2020-03-19       Impact factor: 11.530

10.  Receptor-binding domain of SARS-CoV spike protein induces highly potent neutralizing antibodies: implication for developing subunit vaccine.

Authors:  Yuxian He; Yusen Zhou; Shuwen Liu; Zhihua Kou; Wenhui Li; Michael Farzan; Shibo Jiang
Journal:  Biochem Biophys Res Commun       Date:  2004-11-12       Impact factor: 3.575

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.