Literature DB >> 35621743

Genome-Wide Identification and Analysis of Lipases in Fig Wasps (Chalcidoidea, Hymenoptera).

Xianqin Wei1, Jiaxing Li1, Tao Wang1, Jinhua Xiao1, Dawei Huang1.   

Abstract

Lipases are the main enzymes involved in lipid metabolism. However, the characteristics of lipases in insects were scarcely investigated. Here, we screened the recently sequenced genomes of 12 fig wasp species consisting of seven pollinator fig wasps (PFWs) and five non-pollinating fig wasps (NPFWs) for the six major lipase gene families. In total, 481 lipase genes were identified, and the two most numerous families were the neutral and acid lipases. Tandem duplication accounted for the expansion of the gene family. NPFWs had significantly more lipases than PFWs. A significant gene family contraction occurred in the clade of PFWs. The difference of lipases between NPFWs and PFWs might contribute to their distinction in life histories and feeding regimes. Phylogenetic analysis showed that the lipase genes of each fig wasp species was almost equally distributed in each clade, indicating that the lipase genes were conserved. The gene structures were similar within each clade, while they were different among clades. Most of the neutral and acid lipases were signal peptides and located extracellularly. The pathways of lipases involved were predicted. This genome-wide study provides a systematic analysis of lipase gene families in 12 hymenopteran insects and further insights towards understanding the potential functions of lipases.

Entities:  

Keywords:  acid lipase; catalytic triad; neutral lipase; phylogeny; tandem duplication

Year:  2022        PMID: 35621743      PMCID: PMC9143690          DOI: 10.3390/insects13050407

Source DB:  PubMed          Journal:  Insects        ISSN: 2075-4450            Impact factor:   3.139


1. Introduction

Lipids and their metabolites play diverse roles in insect growth as well as responses to environmental stimuli [1,2,3]. Lipases are a large family of enzymes involved in lipid metabolism [4]. Lipases are generally defined as triacylglycerol (TAG) hydrolases (EC 3.1.1.3), which play key roles in insect lipid acquisition, storage and mobilization [5]. Most lipases from all organisms can be divided into six families, including the neutral (PF00151), acid (PF04083), lipase2 (PF01674), lipase3 (PF01764), lipase with motif Gly-Asp-Ser-(Leu) (GDSL, PF00657) and hormone sensitive lipase (HSL, PF06350) [6,7]. The neutral lipases are able to hydrolyze neutral lipids such as TAGs, diacylglycerides (DAGs), monoacylglycerols (MAGs), the sn-1 position in phospholipids and galactolipids [8]. The acid lipases predominantly hydrolyze TAGs and cholesterol esters [9]. The acid lipases functioned at an acidic pH, whereas the activity of human pancreatic lipase from the neutral family has a pH optimum of 8 [9]. The GDSL family can hydrolyze fatty acids from TAGs, DAGs and MAGs, as well as from the sn-2 position of phospholipids, and can also hydrolyze carboxyl ester or thiol ester substrates [10]. The lipase2 and lipase3 family members can hydrolyze TAGs or carboxyl esters with varying fatty acid constituents [7]. The hormone-sensitive lipases hydrolyze TAGs and cholesterol esters but are under significant hormonal and neuronal control through reversible cAMP-dependent phosphorylation of a serine residue [11,12]. The lipase gene families were characterized in several insects. Horne, et al. [13] investigated the lipase of five insect species and found that the total number of the lipases varied two-fold. Five lipase gene families were identified in insects, among which the neutral and acid lipases were the two most abundant families, occupying from 69.23% (Apis mellifera) to 92.86% (Drosophila melanogaster) of the total number of lipases [13,14]. Neutral lipase family genes in Drosophila underwent multiple tandem duplication events leading to the expansion of gene family size [15]. However, most of the insect lipases lack TAG hydrolysis activity, even though the acid lipases had intact cap domains required for TAG hydrolysis [14]. Wang, et al. [14] also found the loss of catalytic activities and weak TAG hydrolytic activities of lipases in the venom of the parasitoid wasp Pteromalus puparum. Thus, the biological significance of lipase diversity remains unclear. Fig wasps are a polyphyletic assemblage of Chalcidoidea that develop in the inflorescences of fig trees [16]. Based on whether they can pollinate, they are separated into pollinating fig wasp (PFW) and non-pollinating fig wasp (NPFW) [17]. The PFWs complete their life cycles mainly within the syconia by utilizing the nutrition of the female floret ovaries inside the syconia [18]. However, most of the NPFWs oviposit from the outside using the ovipositor to penetrate the syconium [19,20]. According to their special feeding habitats, the NPFWs can be categorized into gall-makers, parasitoids and inquilines [21]. Parasitoid larvae feed on the larvae of pollinators or gall-makers, and inquilines feed on the gall tissue induced by the larvae of either gall-makers or pollinators [22]. The diversified feeding regimes of fig wasps may be related to the lipases, which has not been studied yet. Additionally, the feeding regimes affected longevity in most species, as reported in Ficus racemosa [23]. The NPFWs had a longer lifespan than the PFWs, thus the NPFWs need more energy to support their long-life histories. We suspected that the NPFWs had more lipases than PFWs. In this study, we manually annotated all the lipase in the genomes of 12 fig wasp species, analyzed the gene structures and compared the amino acid sequences encoded by these genes. We investigated the gene duplication events and conducted the gene expansions and contractions analysis. The functional analysis was also attempted, and the tertiary structures were predicted. This study was the first comprehensive analysis of the lipase gene families in fig wasps. Our results provide useful information for further probing the molecular mechanism of how lipase proteins contribute to the distinctions of life histories between PFWs and NPFWs.

2. Materials and Methods

2.1. Manual Annotation of the Lipase Gene Family

We used the seven lipase genes from Drosophila melanogaster as query sequences to make local tblastn in the genomes of 12 fig wasp species, including seven pollinators (Eupristina koningsbergeri, Platyscapa corneri, Kradibia gibbosae, Ceratosolen fusciceps, Ceratosolen solmsi, Dolichoris vasculosae, and Wiebesia pumilae), and five NPFWs (Apocrypta bakeri, Philotrypesis tridentata, Sycobia sp.2, Sycophila sp.2, and Sycophaga agraensis) (Table S1). Except for the data of C. solmsi downloaded from National Center for Biotechnology Information (NCBI, https://www.ncbi.nlm.nih.gov, accessed on 26 August 2021) under the project accession number PRJNA277475, the genomes and transcriptomes of other 11 fig wasps were deposited to NCBI under the project accession numbers PRJNA641212 and PRJNA494992 [24]. The gene sequences and structures were verified by an Integrative Genomics Viewer (IGV) (https://igv.org, accessed on 26 August 2021) [25]. Softberry (http://www.softberry.com, accessed on 26 August 2021) [26] was used to predict the gene structures of the lipase genes which lacked certain information from the IGV. All predicted lipase genes were manually validated by blastp (https://blast.ncbi.nlm.nih.gov/Blast.cgi?PROGRAM=blastp&PAGE_TYPE=BlastSearch&LINK_LOC=blasthome, accessed on 26 August 2021). Finally, we obtained the amino acid sequences and nucleic acid sequences of lipase for the 12 fig wasps. Additionally, the neutral and acid lipase genes in Acyrthosiphon pisum and Daphnia pulex were manually annotated with the same approach and used for the following analysis of gene family expansion and contraction.

2.2. Phylogenetic Analysis

Phylogenetic trees were constructed for neutral and acid lipase protein sequences of 12 fig wasps. We performed phylogenetic analysis in PhyloSuite (https://dongzhang0725.github.io, accessed on 6 September 2021) [27]. Firstly, we made multiple sequence alignments with MAFFT software (https://mafft.cbrc.jp/alignment/software/, accessed on 6 September 2021) [28]. According to the Akaike Information Criterion (AIC), ModelFinder (http://www.iqtree.org/doc/Tutorial#choosing-the-right-substitution-model, accessed on 6 September 2021) [29] revealed WAG + F + R10 and JTT + F + R7 as the best models of molecular evolution with the best fit to the neutral and acid lipase data, respectively, and Maximum-likelihood (ML) trees were constructed with the IQ-TREE (http://www.iqtree.org, accessed on 6 September 2021) [30,31]. Phylogenetic trees were visualized with the online tool iTOL v6 [32].

2.3. Gene Family Expansions and Contractions

In order to understand gene family expansions and contractions, we used the analytical approach implemented in the Computational Analysis of gene Family Evolution (CAFÉ) 4.2.1 [33]. CAFÉ employs a random birth-death process to model changes in gene family size while accounting for phylogenetic relationships. Based on lambda values (the probability of gene gain and loss per unit of time during species evolution) with default parameters, the divergence tree constructed by Xiao, et al. [24] was applied in this analysis.

2.4. Gene Structure Analysis

The exon/intron composition of a gene was estimated using GSD 2.0 (http://gsds.gao-lab.org/index.php, accessed on 14 September 2021) [34]. To search the tandem duplication events, collinearity analysis was conducted using MCScanX (https://github.com/wyp1125/MCScanx, accessed on 14 September 2021) [35], and the location of the lipase gene on the scaffold was determined by TBtools (https://github.com/CJ-Chen/TBtools, accessed on 14 September 2021) [36]. The motif structures were determined by MEME Suite 5.3.2 (http://meme-suite.org/tools/meme, accessed on 14 September 2021) [37].

2.5. Identification of Catalytic Triads in Lipases

The neutral and acid lipases require a catalytic triad consisting of Ser-Asp-His residues to drive the catalytic mechanisms [7]. Sequences of well-recognized canine pancreatic (NP_001003319) and gastric (NP_001003209) were used to search the catalytic residues of neutral and acid lipase protein sequences, respectively. Alignments were conducted by the Clustal Omega program (www.ebi.ac.uk/Tools/msa/clustalo, accessed on 6 September 2021) [38] and edited by the software GeneDoc v2.7.0 (https://genedoc.software.informer.com/download/, accessed on 6 September 2021) [39].

2.6. β9 Loop and Lid Motifs

The presence and length of lids and loops in the insect neutral lipases were determined from sequence alignments with the human pancreatic lipase (HPL) (Figure S1). The β9 loop is contained between residues His204 and His224, and the lid domain is defined between residues Cys238 and Cys262 [40]. It is generally acknowledged that the β9 loop with >15 residues and the lid with at least 18 residues in length is essential for the TAG hydrolytic activity of lipases [13]. Insect acid lipases were examined for the presence of a cap domain by comparison with the human gastric lipase (HGL) (Figure S2). The cap domain occurs between residues Thr184 and Asn308 [41].

2.7. Prediction of Signal Peptide and Subcellular Locations

Their signal peptides were predicted by the online program SignalP-5.0 (http://www.cbs.dtu.dk/services/SignalP/, accessed on 16 September 2021) (Figure S3). The potential subcellular location was predicted by WoLF PSORT (https://wolfpsort.hgc.jp, accessed on 16 September 2021) [42] using the ProtComp v9.0 in the softberry package (http://www.softberry.com/berry.phtml, accessed on 16 September 2021).

2.8. Gene Expression Pattern Predicted by Codon Adaptation Index Analysis

To approximately predict the level of expression of these lipase genes, we estimated the codon adaptation index (CAI) values with a CAIcal server (http://genomes.urv.es/CAIcal/, accessed on 16 September 2021) [43]. This is a quantitative value that indicates how frequently a favored codon is used amongst highly expressed genes, referring to the coherence of coding region synonymous codons with optimal codon usage frequencies [44,45,46]. CAI analysis uses the sequence of a highly expressed gene as a reference to evaluate the degree of codon usage frequency between the target gene and the reference sequence. The CAI value is sequence-length independent, depending only on the amino acid frequency. CAI values range between 0 and 1. It is indicated that the gene is well expressed if the CAI value is higher than 0.5, while it is low expressed if the CAI value is lower than 0.03 [47]. The codon usage table of N. vitripennis, which is closely related to the 12 fig wasps, was used as a reference species codon usage table.

2.9. Protein Structure

To reveal the protein structure of five lipases in fig wasps, a Phyre2 structure prediction server (http://www.sbg.bio.ic.ac.uk/phyre2/, accessed on 20 September 2021) [48] was used to conduct alignment and tertiary structure prediction. Phyre2 was used in the alignment of hidden Markov models for homology-based protein modelling. It also incorporated the ab initio folding simulation into model regions with no detectable homology to known structures. Predicted tertiary structures and related sites were visualized by PyMOL 2.4.1 (https://www.pymol.org/2/, accessed on 20 September 2021).

2.10. Gene Function Prediction

Cytoscape (https://cytoscape.org, accessed on 3 September 2021) is an open-source software project for integrating biomolecular interaction networks with high-throughput expression data and other molecular states into a unified conceptual framework [49,50]. Cytoscape was used to analyze the pathways that the lipases of fig wasps involved.

3. Results

3.1. Identification of Lipases in Fig Wasps

In total, 481 lipase genes were annotated in 12 fig wasps. Except lipase2, all the other five gene families were identified. Total numbers of genes across the five lipase families in the 12 fig wasp genomes varied over more than two folds, from a low of 29 in C. fusciceps and K. gibbosae up to a high of 65 in P. tridentata (Table 1). The total number of lipase genes was significantly higher in NPFWs than that the PFWs (Kruskal Wallis Test, Chi-Square = 8.250, df = 1, p = 0.004). The family distribution across the 12 fig wasps were similar. Neutral lipases were the most abundant, followed by acid lipases (Table 1). All the genomes contained at least one HSL and lipase 3 genes. GDSL lipases range from 0 to 2 members (Table 1).
Table 1

Summary of the lipase genes in 12 fig wasps.

SpeciesAbbreviationNeutralAcidLipase2Lipase3GDSLHSLTotal Number
Non-pollinating fig wasp Apocrypta bakeri Abak2915022149
Philotrypesis tridentata Ptri3230011165
Sycobia sp.2Sbsp2917021150
Sycophila sp.2Spsp2630012160
Sycophaga agraensis Sagr2612010140
Pollinating fig wasp Dolichoris vasculosae Dvas1812011133
Wiebesia pumilae Wpum1810011131
Ceratosolen solmsi Csol1711011131
Ceratosolen fusciceps Cfus1511011129
Eupristina koningsbergeri Ekon1511021231
Platyscapa corneri Pcor1911011133
Kradibia gibbosae Kgib1512010129
Total number 2591820151213481
The high level of variation in lipase gene content among fig wasps was largely due to differences in their complements of neutral and acid lipases, accounting for 84.0–95.4% of the total (Table 1). The NPFWs had significantly more neutral (Kruskal Wallis Test, Chi-Square = 8.280, df = 1, p = 0.004) and acid (Kruskal Wallis Test, Chi-Square = 7.578, df = 1, p = 0.006) lipase genes than the PFWs.

3.2. Gene Family Expansion and Contraction

We used CAFÉ analysis to estimate the expansion and contraction of neutral and acid lipase gene families in the 12 fig wasps (Figure 1). It was estimated that the most recent common ancestor of the Chalcidoidea had approximately 23 neutral lipase genes (Figure 1A). There was a net loss of five neutral lipase genes during the evolution of the PFWs from their common ancestor with Sycobia sp.2. There was a net gain of five neutral lipase genes during the evolution of Pteromalidae (A. bakeri, P. tridentata, N. vitripennis) from its common ancestor with S. agraensis.
Figure 1

The expansion and contraction of lipase gene family. Numbers on each node are the estimated ancestral copy numbers. The names of pollinator fig wasps are indicated with orange and that of non-pollinating fig wasps are indicated with green. (A) neutral lipase, (B) acid lipase. The significant expansion and contraction of lipase gene families were indicated with asterisk (*).

It was estimated that the most recent common ancestor of the Chalcidoidea had approximately 16 acid lipase genes (Figure 1B). There was a net loss of four neutral lipase genes during the evolution of the PFWs from their common ancestor with Sycobia sp.2. There was a net gain of six acid lipase genes during the evolution of Pteromalidae (A. bakeri, P. tridentata, N. vitripennis) from its common ancestor with S. agraensis. Interestingly, A. bakeri had a net loss of seven acid lipase genes, while P. tridentata had a net gain of eight acid lipase genes from their common ancestor. Surprisingly there was a net gain of 14 acid lipase genes during the evolution of Sycophila sp.2.

3.3. Tandem Duplications of Lipase

In the neutral lipases of the 12 fig wasps, there were 33 duplication events located in 29 scaffolds (Figure 2A). The neutral lipase gene clusters included one cluster with six members, two clusters with four members, two clusters with three members, and the other 28 smaller clusters with two members. Each PFW had only one duplication event located in one scaffold, except for D. vasculosae, while each NPFW had at least two duplication events; in particular, Sycobia sp.2 harbored eight duplication events. The tandem duplication was attributed to 10.5–40.6% of the total number of neutral lipases except for Sycobia sp.2, accounting for approximately 69.0%.
Figure 2

Tandem duplication events of neutral (A) and acid (B) lipases occurred in 12 fig wasp species. The pollinator fig wasps are above the black dashed line, and the non-pollinating fig wasps are below the black dashed line. All the lipase gene names are listed close to the scaffolds. The dots beside the names with the same color indicate the same tandem duplication event. The first four letters of each gene name are the abbreviation of each fig wasp species.

In the acid lipase genes, there were 35 duplication events located in 30 scaffolds (Figure 2B). The acid lipase gene clusters included nine clusters with six members, five clusters with five members, four clusters with four members, six clusters with three members and 11 clusters with two members. Each PFW had two duplication events, including eight or nine members totally. The NPFWs contained two to eight duplication events, with the number of members ranging from two to six. Generally, the gene cluster of acid lipase harbored more members than that of neutral lipase. Moreover, the tandem duplication attributed to 58.3–83.3% of the total number of acid lipases. On average, 74.2% of the acid lipases were involved in the tandem duplication events, while this portion was 29.3% for neutral lipases.

3.4. Phylogenetic Analysis

Two phylogenetic trees were constructed using 259 neutral lipases and 182 acid lipases predicted in 12 fig wasps, respectively (Figure 3). The neutral lipases can be divided into 19 clades (Table 2). In clade I, III, IV, VII, VIII, XIII, XIV, XV and XVI, each of the 12 fig wasps had one neutral lipase gene (Figure 3A). Clade II consisted of 11 lipase genes from 11 fig wasps, except for E. koningsbergeri. In clade IX, XI and XII, each of the seven pollinating fig wasps had one neutral lipase gene, while the five NPFWs had more than one neutral lipase gene. In clade X, XVIII and XIX, each of the three pollinating fig wasps had one neutral lipase gene, while the NPFWs had more than one neutral lipase gene. In clade XVII, each of the six PFWs (E. koningsbergeri, P. corneri, K. gibbosae, C. fusciceps, C. solmsi, D. vasculosae, and W. pumilae) had one neutral lipase gene, while each of the NPFWs had more than one neutral lipase gene. The clade V had the least 9 genes. The gene expansion of A. bakeri and P. tridentata mainly occurred in clade XVII, XVIII and XIX. Compared with lipases from other clades, clade XIII, XIV, XV and XVI clustered together, and contained an additional 3′ domain of tandemly repeated sequences of varying length and composition. The lipase of clade XIV had the longest length of introns.
Figure 3

Phylogenetic tree of lipase proteins from 12 fig wasp species. (A) The ML tree depicts the evolutionary relationships among 259 neutral lipase protein sequences from 12 fig wasp species. From the inner to the outside: the first colored strip indicates the number of exons; the second colored strip indicates the length of the beta loop; the third colored strip indicates the length of the lid; the fourth colored strip indicates if the protein has secretion signal. (B) The ML tree depicts the evolutionary relationships among 182 acid lipase protein sequences from 12 fig wasp species. From the inner to the outside: the first colored strip indicates the number of exons; the second colored strip indicates if the protein has a secretion signal. The species names of fig wasps were indicated with different symbols. The background with orange indicates non-pollinating fig wasps and the background with green indicates pollinator fig wasps. The protein sequences for each motif are in supplementary Figure S5.

Table 2

The number of lipases in each clade of phylogenetic trees.

NeutralAcid
CladeNumber of GenesCladeNumber of GenesCladeNumber of GenesCladeNumber of Genes
I12XI14I13XI14
II11XII16II12XII16
III12XIII12III12
IV12XIV12IV11
V9XV12V17
VI16XVI12VI18
VII12XVII22VII12
VIII12XVIII23VIII21
IX13XIX11IX13
X14 X23

Notes: The number of clades in this table is in accordance with that in Figure 3. In the phylogenetic tree of neutral lipases in Figure 3A, there are 19 clades, and the number of neutral lipases in each clade are listed in this table. Likewise, there are 12 clades in the phylogenetic tree of acid lipases in Figure 3B, and the number of acid lipases are listed in this table.

The acid lipases can be divided into 12 clades (Table 2). In clade II, III, V, VI, VII, VIII, IX, XI and XII, each of the seven pollinating fig wasps had one acid lipase gene, and the NPFWs had at least one acid lipase gene (Figure 3B). In clade I, K. gibbosae had two genes, and the other 11 species had one acid lipase gene. Clade IV lacked an acid lipase gene from S. agraensis and W. pumilae, consisting of two genes from D. vasculosae, and the other fig wasp species had one acid lipase gene in this clade. Clade X only contained the acid lipases from NPFWs. The expansion of the acid lipases of P. tridentata and Sycophila sp.2 mainly occurred in clade V, VI, VIII and X. Compared with lipases from other clades, the lipases of clade I, except Kgib_acid_2, contained an additional 5′ domain of the tandemly repeated sequence.

3.5. Sequence Characterization

3.5.1. Incomplete Catalytic Triads in Predicted Lipases

Ten of the neutral lipases did not have the consensus Ser-His-Asp triad, accounting for 3.9% of the total number (Table S2). Four of them lacked His, three of them had Gln, Asn and Ala in the position of His, two of them had Asp and Ala in the position of Ser and the last one had Glu in the position of Asp. Five of the acid lipases had incomplete catalytic triads, accounting for 2.7% of the total number (Table S2). Two of them had Glu in place of Ser, two of them lacked Ser and the last one lacked His. The five acid lipases were only in W. pumilae, Sycophila sp.2 and P. tridentata, and all the other nine fig wasp species contained complete catalytic triads.

3.5.2. Identification of β9 Loop and Lids of Lipases

Two neutral lipases had a β9 loop with fewer than 15 residues, 154 neutral lipases had a β9 loop with exact 15 residues and 103 neutral lipases had a β9 loop with more than 15 residues (Table 3). 93 neutral lipases had lid domains more than 18 residues, while 166 neutral lipases had a lid domain fewer than 18 residues. 81 neutral lipases have both β9 loops greater than 15 residues and lids greater than 18 residues in length. Besides that, 12 neutral lipases have lids greater than 18 residues, while the length of β9 loops were equal to 15 residues. The neutral lipases with longer loops and lids were highly clustered in clade XIII, XIV, XV, XVI, XVIII and XIX in the phylogenetic tree (Figure 3A). Among the ten neutral lipases with incomplete catalytic triads, three of them had a required β9 loop and lid length, while all of the other seven neutral lipases had a shorter lid length.
Table 3

Predicted loop and lid domains of neutral lipases in 12 fig wasps. Only insect lipases with β9 loops greater than 15 and lids greater than 18 residues in length are given which have putative TAG hydrolytic activity.

SpeciesGene Nameβ9 LoopLengthLidLengthNumber
Apocrypta bakeri Abak_neutral_11HTDGSADFADGFGLLKPIGH20CKDVKNSVVVSHLNEDSLDINIAC2411
Abak_neutral_12HTDCSPFISGGLGISQPVAH20CNEGVFNSITLEKGSFFRGIKRFLGC26
Abak_neutral_13HTDGKSIFFLGLPGYGMSQPCGH23CTDLSETTPSLPLTLIREGLEEASRVLVAC30
Abak_neutral_15HTDGGVLGFPIPLGH15CELENVFAMGVGKLINRFVTC21
Abak_neutral_16HTNGRVLSRLGLGLPNPVGH20CILSNKASLWQYLPIPISLISETIC25
Abak_neutral_17HTNGRILRKLGLGLPYPLGH20CLLTKSSIWNYLPLPIESTYRSMVCFYLFIYFVLFVEIQKTIC43
Abak_neutral_18HSNGEQLILGGLGSWQPMGD20CSNLFVGAVSDIIWSSPVEGRSLC24
Abak_neutral_23HTDGAQERNRAFGLYDAIGH20CLSRRIDSQYTYEYAVKLFGHTINTRAC28
Abak_neutral_24HTDGARRRNSAFGILEPIGH20CQSGRRSMPTWGSVINFAFEAYQHIESNGPC31
Abak_neutral_25HTNGQYLKKLGLGLPEPIGH20CALTSFSIPILSIPRETVNKAIC23
Abak_neutral_26HTNARNILLLGLGLPEQLGN20CANIDAKFWDFLLLPINIVKSAIC24
Philotrypesis tridentata Ptri_neutral_10HTDGSVDFADGFGLLKPIGH20CNDVKNSVVVSHLNEDSLDINIAC2415
Ptri_neutral_11HTDGKSIFFLGLPGYGMSQPCGH23CTDLSETTPSLPLTLIREGLEEASRVLVAC30
Ptri_neutral_12HTDCSPFISGGLGISQPVAH20CNEGVFNSITLEKGSFFRGIKRFLGC26
Ptri_neutral_13HTDGGVLGFPIPLGH15CNIANVFAMGVNRIINRFITC21
Ptri_neutral_17HSNGDHFLNGGLGLIEPIGH20CTEVNIPVIDVKARTEPVYKAIC23
Ptri_neutral_18HANADKFLKGGLGLVEPIGH20CTEIKVPLPLVPLRIKTDVAFRAIC25
Ptri_neutral_19HTDTDPLQKGGLGLADPIGH20CSDIQLPYYLPFPIKWLEKRIAKATC26
Ptri_neutral_21HTNGGILKKLRLGLPNPSGD20CILMKSSLWEYLPLPIEKIESTIC24
Ptri_neutral_22HTDGAQKMNSAFGIFEPIGH20CGRTKRTPAIGDVIKKIFKVADHVLNHGSC30
Ptri_neutral_24HSNGEQLILGGLGSWQPMGD20CSNLFVGAVSDIIWSSPVEGRSLC24
Ptri_neutral_26HTDADALYKGGVSLFEPIGH20CSKIQLPDDLPHPIKLLKKLIERAIC26
Ptri_neutral_27HTNVKMYLNLGIGLPDRLGH20CKKINTAFWNFLLLPIHIVEWAIC24
Ptri_neutral_28HTNADHILRLGFGLPDRLGH20CEKINATFWNFLLLPIHIVQAAIC24
Ptri_neutral_29HTNAQSILLAGLGLPDRLGH20CEKIDVKFWDFLMLPVGVIKTAIC24
Ptri_neutral_30HTNAQNILLLGLGLPEQLGD20CAKINPKIWDFLLLPVDIVKSAIC24
Sycobia sp.2Sbsp_neutral_10HTDGSIDFTDGFGLLKPIGH20CRDVKNSVVVSHLNEDNLDIHIAC247
Sbsp_neutral_14HSNGEQLILGGLGSWQPMGD20CSNLFLGAVSDIIWSSAVEGRSLC24
Sbsp_neutral_15HTNGRLLRQLGLGLPFPIGH20CVVKKSSFWKYLPLPFRKIERTLC24
Sbsp_neutral_21HTNGRGLLKLGLGLPNPLGH20CNITRSFIERVLPLPFKTIKETIC24
Sbsp_neutral_22HTDGGVLGFPIPLGH15CNIDNILAMGLNKIINRFSES21
Sbsp_neutral_23HTDCSPFISGGLGISQPVAH20CNEGVLNSITLEKGSFFRGIKRFLGC26
Sbsp_neutral_24HTDGKSIFFLGLPGYGMSQPCGH23CTDLSETTPSLPLTLIREGLEEASRVLVAC30
Sycophila sp.2Spsp_neutral_7HTDGSADFADGFGLLKPIGH20CNDVKNSVVVSHLNEDSLDIHIAC2411
Spsp_neutral_11HTNGRVLSKLGLGLPNPVGR20CIESESSFWKYLPMPVKKISETIC24
Spsp_neutral_14HSNGEQLILGGLGSWQPMGD20CSNLFVGAVSDIIWSSPVEGRSLC24
Spsp_neutral_16HTDGGVLGFPVPLGH15CDLGNVIAMGIGSLLNRYVTC21
Spsp_neutral_18HTDCSPFISGGLGISQPVAH20CNEGVFNSITLEKGSFFRGIKRFLGC26
Spsp_neutral_19HTDGKSIFFLGLPGYGMSQPCGH23CTDLSETTPSLPLTLIREGLEEASRVLVAC30
Spsp_neutral_20HTNARSIMLLGFGLPEDLGH20CDDIDASSWGSLAYPKSALTSAIC24
Spsp_neutral_21HTNAKHLFFLGLGLPNQLGY20CLDIDLSLWGFLMLPKDIILESIC24
Spsp_neutral_22HTNGRIWTDLGLGLPQSIGH20CESTDFKIPVLSIPKEAIAKMIC23
Spsp_neutral_24HTDGARTKNGAFGLIKPLGH20CESTNNSRRYLNYLSLFQHALGCTNC26
Spsp_neutral_25HTNSEPEKRMKDNLGTYDPLGH22CDLNKDARSLTYLKEIVETFLADSLRFITRTILKIDATNIILKYLNNIIPGSEERFDLIC60
Sycophaga agraensis Sagr_neutral_9HTDGSIDFADGFGLLKPIGH20CNDVKNSVVVSHLNEDSLDIHIAC249
Sagr_neutral_10HTDGGVLGFPIPLGH15CNIENVLAMGFSKIINRYITC21
Sagr_neutral_12HTNARILAKLGLGLPNPIGH20CTLNVPLWKFLPIPLRKISEMIC23
Sagr_neutral_13HSNGEQLILGGLGSWQPMGD20CSNLFLGAVSDIIWSSPVEGRSLC24
Sagr_neutral_15HTDGKSIFFLGYGMSQPCGH20CTDLSETTPSLPLTLIREGLEEASRVLVAC30
Sagr_neutral_16HTDCSPFISGGLGISQPVAH20CNEGVFNSITLEKGSFFRGIKRFLGC26
Sagr_neutral_17HTNGRHLLQIGLGLPESIGH20CQLKNSLYIPGINLPREAIHKAVC24
Sagr_neutral_18HTNANNLLLLGLGLSEQLGN20CERIDASIWSFLLLPVNIIKEAIC24
Sagr_neutral_19NTNIQNSNELKSLGH15CDDSNFILPQGMGLAKLIEKASC23
Dolichoris vasculosae Dvas_neutral_7HSDGSIDFADGFGLLKPIGH20CNDVKNSVVVSHLNEDSLDIHIAC247
Dvas_neutral_11HTDGGVLGFPIPLGH15CNLENVLAMGISKIINRYITC21
Dvas_neutral_12HSNGEQLILGGLGSWQPMGH20CSNLFVGAVSDIIWASPVEGRSLC24
Dvas_neutral_13HTDCSPFISGGLGISQPVAH20CNEGVFNSITLEKGSLFRGIKRFLGC26
Dvas_neutral_14HTDGKSIFFLGLPGYGMSQPCGH23CTDLSETTPSLPLTLIREGLEEASRVLVAC30
Dvas_neutral_16HTNARNILLLGLGLPDQLGK20CTNINTSFWNFLLLPANIIKEAIC24
Dvas_neutral_18HTDGAISENEAFGLFDSIGH20CGSFLSKRSVPSLLKLLLHAVKNGVC26
Wiebesia pumilae Wpum_neutral_6HSDGSIDFADGFGLLKPIGH20CNDVKNSVVVSHLNEDSLDIHIAC246
Wpum_neutral_10HTDGGVLGFPIPLGH15CNLENVLAMGISKIINRYITC21
Wpum_neutral_11HTNARNILLLGLGLPDQLGQ20CTNINPSFWSFLLLPAKIIKEIIC24
Wpum_neutral_12HTDCSPFISGGLGINQPVAH20CNEGVFNSITLEKGSLFRGIKRFLGC26
Wpum_neutral_13HTDGKSIFFLGYGMSQPCGH20CTDLSETTPSLPLTLIREGLEEASRVLVAC30
Wpum_neutral_14HSNGEQLILGGLGSWQPMGH20CSNLFVGAVSDIIWSNPVEGRSLC24
Ceratosolen solmsi Csol_neutral_7HSDGSIDFADGFGLLKPIGH20CNDVKNSVVVSHLNEDSLDIHIAC24
Csol_neutral_9HSNGEQLILGGLGSWQPMGD20CSNLFVGAVSDIIWSSPVEGRSLC246
Csol_neutral_11HTDGKSIFFLGLPGYGMSQPCGH23CTDLSETTPSLPLTLIREGLEEASRVLVAC30
Csol_neutral_12HTDCSPFISGGLGISQPVAH20CNEGVFNSITLEKGSLFRGIKRFLGC26
Csol_neutral_13HTDGGVLGFPIPLGH15CNLENRESTICSSHVSVTC19
Csol_neutral_15HTDGALSQNEAFGLYDPIGH20CGFLASQKSVPSLLKLLVHAMENGIC26
Ceratosolen fusciceps Cfus_neutral_6HTDGSVDFADGFGLLKPIGH20CKDVKNSVVVSHLNEDSLDIEIAC245
Cfus_neutral_8HTDCSPFISGGLGINQPVAH20CNEGVFNSITLEKGSLFRGIKRFLGC26
Cfus_neutral_9HTDGKSIFFLGLPGYGMSQPCGH23CTDLSETTPSLPLTLIREGLEEASRVLVAC30
Cfus_neutral_12HTDGGVLGFPIPLGH15CNLENVLAMGIGKIINRYITC21
Cfus_neutral_13HTNGEQLILGGLGSWQPMGD20CSNLFVGAVSDIIWSSPVEGRSLC24
Eupristina koningsbergeri Ekon_neutral_5HSDGSVDFSDGFGLLKPMGH20CNDVKNSVVVSHLNENSLDIHIAC245
Ekon_neutral_9HSNGEQLILGGLGSWQPMGH20CSNLFVGAVSDIIWSNPVEGRSLC24
Ekon_neutral_10HTDGGVLGFPIPLGH15CDFENVLSMGISKIINRYITC21
Ekon_neutral_11HTDGKSIFFLGLPGYGMSQPCGH23CTDLSETTPSLPLTLIREGLEEASRVLVAC30
Ekon_neutral_12HTDCSPFISGGLGISQAVAH20CNEGVFNSITLEKGSFFRGIKRFLGC26
Platyscapa corneri Pcor_neutral_5HSDGSIDFADGFGLLKPIGH20CNDVKNSVVVSHLNEDSLDIQIAC247
Pcor_neutral_10HTDCSPFISGGLGISQPVAH20CNEGVFNSITLEKGSLFRGIKRFLGC26
Pcor_neutral_11HTDGKSIFFLGLPGYGMSQPCGH23CTDLSETTPSLPLTLIREGLEEASRVLVAC30
Pcor_neutral_12HSNGEQLILGGLGSWQPMGH20CSNLFVGAVSDIIWSSPVEGRSLC24
Pcor_neutral_13HTNARNILLLGLGLPEKLGM20CKNIDVSFWNFLLLPAKIIKEIIC24
Pcor_neutral_14HTDGGVLGFPIPLGH15CNFENVLAMGISKIINRYITC21
Pcor_neutral_18HTDGAISEDEAFGLLEPIGH20CSLLRRRKRSAESLLKLLVHAIENGAC27
Kradibia gibbosae Kgib_neutral_8HSDGSVDFADGFGLLKPIGH20CNDVKNSVVVSHLNEDSLDIHIAC244
Kgib_neutral_9HTDGKSIFFLGLPGYGMSQPCGH23CTDFGEATPLTLIREGLEEASRVLVAC27
Kgib_neutral_10HTDCSPFISGGLGISQPVAH20CNEGVFNSITLEKGSLFRGIKRFLGC26
Kgib_neutral_13HSNGEQLILGGLGSWQQMGD20CSNLFLGAVSDIIWSSSVEGRSLC24
The acid lipases possess a lid or cap domain that covers the active site. All of the 182 acid lipases examined in fig wasps appeared to possess the primary sequence characteristics of the cap domain. The cap domain in human gastric acid lipase was between Thr184 and Asn308. However, Thr was replaced by Phe, Tyr, Ile and Asn, while Asn was replaced by Asp, Pro, Cyc and Lys in some acid lipases of fig wasps.

3.5.3. Secretion Signals

The N-terminal sequences of the majority of the insect neutral and acid lipases conform to the consensus sequence for eukaryotic secretion signals (Figure S3). In total, 30.5% (79/259) of the neutral lipases and 37.9% (113/182) of the acid lipases lacked signal peptides (Figure 3). It was noted that 75% of the acid lipases in S. agraensis lacked the signal peptides, while only 18.2% of the acid lipases in P. corneri lacked the signal peptides. The neutral lipases lacking the signal peptide in each fig wasp species ranged from 19.2% to 46.7%. All the gene members of clade IV in the neutral lipase phylogenetic tree and clade III in the acid lipase phylogenetic tree lacked signal peptides. In other clades, the lipases without signal peptides were scattered across the tree without a consensus pattern. If the lipases without signal peptides are excluded, the number of neutral (Kruskal-Wallis test, Chi-square = 2.981, df = 1, p = 0.084) and acid (Kruskal-Wallis test, Chi-square = 2.753, df = 1, p = 0.097) lipases will have no significant difference anymore between NPFWs and PFWs. The NPFWs had more neutral lipases without signal peptides than PFWs (Kruskal-Wallis test, Chi-square = 8.134, df = 1, p = 0.004). Based on the predication of subcellular locations with ProtCompt software, the majority of acid lipases were secreted extracellularly (79/113), and the other acid lipases were located in endoplasmic reticulum (6), mitochondrial (4), plasma membrane (7), and lysosomal (17). The majority of neutral lipases were secreted (116/180), and the other neutral lipases were located in lysosomal (10), Golgi (8), mitochondrial (17), plasma membrane (22) and endoplasmic reticulum (7).

3.6. Structure Analysis

3.6.1. Exon/Intron Arrangements

To better understand the structural diversity of lipase genes, intron/exon organizational maps were generated from the coding sequences of each lipase gene (Figure 4). The results revealed that the number of exons varied from 1 to 16 and from 2 to 15 for the neutral and acid lipase gene family, respectively (Figure 3). 23.55%, 12.74%, 11.20% and 33.59% of the neutral lipases have four, five, six and seven exons, respectively, occupying 81.08% of the total number (Figure 4A). 24.73% and 55.49% of the acid lipases have seven and eight exons, occupying 80.22% of the total number (Figure 4B). Therefore, seven exons and eight exons were predominately in neutral and acid lipases, respectively. In the phylogenetic tree, the intron/exon arrangement was similar within each clade, while it was different between different clades (Figure 3A). Phylogenetically closely related genes are structurally more similar (Figure S4). The lipases in clade I of the neutral phylogenetic tree harbored only one exon.
Figure 4

Exon/intron structures of neutral (A) and acid (B) lipases in 12 fig wasp species.

3.6.2. Motifs

Identification of conserved protein motifs was conducted, and 20 distinct motifs were loaded (Figure S5). The motifs with catalytic triads almost remain conserved in all the proteins across 12 fig wasp species (Figure 3). The lipases from the same clade habitually exhibited a common motif structure, indicating functional resemblances with these proteins, whereas the divergences in motif compositions was obvious between different clades. It is evident that some motifs are specific to the specific clade.

3.6.3. Tertiary Structures

By combining multiple templates modelling and simplified ab initio folding simulation, we modelled the molecular structures of neutral (Abak_neutral_17) and acid (Abak_acid_2) lipase, using the hydrolases (PDB ID: 1hpl and 1hlg) as the templates (Figure 5). For neutral lipase (Figure 5A), a total of 345 residues have been modelled with 100% confidence, 84% coverage and 32% identity with the template. For acid lipase (Figure 5B), a total of 366 residues have been modelled with 100% confidence, 53% coverage and 39% identity with the template.
Figure 5

3D structures of neutral (A) and acid (B) lipase in fig wasp. α-Helices, β-sheets and loops are shown in magenta, yellow and light blue, respectively. The catalytic triads are highlighted by red sticks and zoomed in. In neutral lipase (A), the β9 loop was highlighted by green, and the lid was highlighted by cyan. In acid lipase (B), the cap domain was highlighted by cyan.

3.7. Expression Profiles and Function Prediction

There was no low-expression gene in GDSL (0.316–0.48), HSL (0.313–0.637) and lipase3 (0.41–0.71) (Table S3). The CAI values of 259 neutral lipase genes ranged from 0.278 to 0.823, among which 3.47% (9/259) and 25.87% (67/259) of the total neutral lipase genes had low and high expression, respectively. The CAI values of 182 acid lipase genes ranged from 0.29 to 0.68, among which 2.20% (4/182) and 10.44% (19/182) of the total acid lipase genes had low and high expression, respectively. Neutral lipases and GDSL were mainly involved in the pathways of steroid biosynthesis (KEGG: 00100), lysosome (KEGG: 04142), cholesterol metabolism (KEGG: 04979), glycerolipid metabolism (KEGG: 00561), pancreatic secretion (KEGG: 04972), fat digestion and absorption (KEGG: 04975) and vitamin digestion and absorption (KEGG: 04975) (Figure 6). Only the lipases in A. bakeri, S. agraensis, Sycobia sp.2 and E. koningsbergeri participated in the pathways of aldosterone synthesis and secretion (KEGG: 04925) (Figure 6). The lipases in NPFWs participated in the pathway of RNA degradation (KEGG: 03018) (Figure 6).
Figure 6

KEGG enrichment of lipase genes in 11 fig wasp species. Only data with a p value after Bonferroni correction of less than 0.05 are shown. The change of color ranging from orange to blue represents the number of lipase genes ranging from large to small.

4. Discussion

In this study, we identified a total of 481 lipase genes in 12 fig wasp species belonging to neutral, acid, lipase3, GDSL and HSL lipase gene families. Lipase2 was not found in fig wasps, which was consistent with the lack of lipase2 in other insects [14]. This is the first investigation of the lipase gene family in fig wasps. Compared with two phylogenetic related N. vitripennis and A. mellifera, we can see the number of lipases in N. vitripennis (62) was close to that of P. tridentata. However, the A. mellifera (26) had the least number of lipases in the reported insects [14]. The expansion and contraction analysis also revealed that A. mellifera as well as all the PFWs had a significant contraction. The A. mellifera feed on pollen and nectar [51,52,53], and the PFWs feed on the endosperm tissue in the galled ovary [54]. Therefore, A. mellifera and the PFWs had a similar feeding regime with a rich though single food source. The contraction of the lipase gene number in PFWs and A. mellifera might be related to the specificity of their diet. This hypothesis definitely needs to be further tested with the lipases identified in more and more insects. The NPFWs had significantly more lipase genes than the PFWs, especially in neutral and acid lipases. We found that the gene number of neutral and acid lipases in the clade of PFWs had significant contractions. The neutral gene family size in PFWs was approximately two-fold more than that in NPFWs. A major determinant of gene family size is gene function [55]. The acid and neutral lipases were mainly involved in lipid metabolic and catabolic process. Specifically the hydrolysis of TAG was primarily performed by acid lipases rather than neutral lipases in the reported insects [13]. More lipases participating in the lipid metabolism produce more energy for NPFWs. Indeed, the adult PFWs live for a much shorter period of time (from a few hours to 2 days) than the adult NPFWs (several days to 2 weeks) [52,53,56]. The NPFWs need more energy to maintain flight. It was found that Panstrongylus megistus switched fuel for sustained flight from carbohydrates to lipids [57], indicating that lipid was crucial for the continuous flight. Therefore, the flight requirements might be an important factor in driving the diversification of the lipases in NPFWs. It was also verified by the KEGG enrichment that more lipases from Sycobia sp.2, P. tridentata and Sycophila sp.2 were involved in the pathways of steroid biosynthesis, lysosome and cholesterol metabolism (Figure 6). Tandem duplications are an essential source of genetic novelty, and their variation in natural populations is expected to influence adaptive walks [58]. Tandem duplication is one of the main and commonly evaluated mechanisms for gene family expansion [59,60]. Tandem gene duplication is one of the most prevalent ways of generating genes with new function [58]. We found abundant tandem duplication events in the neutral and acid lipase gene families in fig wasps. The pattern of tandem duplication between neutral and acid lipases was different. The acid lipases possessed fewer duplication events, while there were more gene members for each event. One tandem duplication event in acid lipases often resulted in more than two genes. Generally, two tandem gene copies produced a tandem duplication event in most of the neutral lipases, especially in the PFWs. It was found that tandem gene duplicates could lead to the overactivity of some genes in Alcohol dehydrogenase, and the expression of tandem gene duplicates was often greater than twofold [61]. Additionally, it was suggested that the relatively large number of lipase genes in the same species could be a trade-off between having sufficient catalytic diversity for rapid dietary uptake and the cost of processing DNA [62]. Therefore, the abundant tandem duplication events of lipase for fig wasps might evolve new functions, except for the lipid metabolism, which needs further studies. None of the neutral lipase sequences in either the dipteran or lepidopteran clades meet the β9 loop and lid criteria expected of TAG lipases [13]. In fig wasps, 31.25% of the neutral lipases met the requirements of the β9 loop and lid that was concentrated in clades XIII, XIV, XV, XVI, XVIII and XIX (Figure 3A). In clade XVII, the β9 loop is longer than 15 residues, while the lid is shorter than 18 residues. Interestingly, the expansion of the neutral lipases was also predominately distributed in clade XVII and XVIII. Most insect species feed on plant tissues, of which phospholipid and galactolipid are the major lipid, rather than the TAG, which may account for the fact that most of the neutral lipases did not meet the criteria for β9 loop and lid. Additionally, the non-catalytic active lipases may fulfill other roles, such as lipid binding and storage [13]. In a previous study, we found that maltase had clear differentiations of gene structures, which led to functional divergence [63]. All the maltase genes had one or eight exons, and all the intronless genes were present in NPFWs. However, the intronless genes of lipases were only found in clade I of the phylogenetic tree of neutral lipases. The exon/intron structures of lipases were highly diverse, with a number of exons ranging from one to 16. In many eukaryotes, introns can increase gene expression without functioning as a binding site for transcription factors [64]. During the development of fig wasps, each stage requires different feeding habitats, diets and digestive enzymes. The diversity of lipases may be due to a requirement for rapid accumulation of dietary lipids. Horne, et al. [13] found that 38% of the neutral lipases and 15% of the acid lipases lacked signal peptides. We found that it was 30.5% and 37.9% for the neutral and acid lipases of fig wasps, respectively. They were widely dispersed across the phylogenetic tree, suggesting quite ancient origins for this character and the potential conservation of function. The great majority of insect neutral and acid lipases were secreted proteins. It was consistent with their subcellular locations that the majority of lipases were predicted to be secreted extracellularly in this study.

5. Conclusions

In a summary, our genome-wide identification of lipase genes contributes to the understanding of digestive enzymes in fig wasps, which is essential to figure out how fig wasps utilize the lipid for their development and mobilization. The lipase gene sequences, structures and properties were characterized in this study. NPFWs possessed significantly more lipases than PFWs, which was related to their discriminative life histories and feeding regimes. The diversity of neutral and acid lipases might be due to a requirement for flight and diet specificity. Our results provided invaluable evidence from the perspective of insect metabolism to understand the obligate mutualism between figs and fig wasps. In the future, more work needs to concern the biochemical characteristics of lipases in insects.
  51 in total

1.  Crystal structure of human gastric lipase and model of lysosomal acid lipase, two lipolytic enzymes of medical interest.

Authors:  A Roussel; S Canaan; M P Egloff; M Rivière; L Dupuis; R Verger; C Cambillau
Journal:  J Biol Chem       Date:  1999-06-11       Impact factor: 5.157

Review 2.  Structure and function of lipases.

Authors:  Z S Derewenda
Journal:  Adv Protein Chem       Date:  1994

Review 3.  Fat metabolism in insects.

Authors:  L E Canavoso; Z E Jouni; K J Karnas; J E Pennington; M A Wells
Journal:  Annu Rev Nutr       Date:  2001       Impact factor: 11.848

Review 4.  The triglyceride lipases of the pancreas.

Authors:  Mark E Lowe
Journal:  J Lipid Res       Date:  2002-12       Impact factor: 5.922

5.  Metabolic pathways for dietary lipids in the midgut of hematophagous Panstrongylus megistus (Hemiptera: Reduviidae).

Authors:  Lilián E Canavoso; Silvia Frede; Edilberto R Rubiolo
Journal:  Insect Biochem Mol Biol       Date:  2004-08       Impact factor: 4.714

Review 6.  Structural basis for the substrate selectivity of pancreatic lipases and some related proteins.

Authors:  F Carrière; C Withers-Martinez; H van Tilbeurgh; A Roussel; C Cambillau; R Verger
Journal:  Biochim Biophys Acta       Date:  1998-11-10

Review 7.  Insect fat body: energy, metabolism, and regulation.

Authors:  Estela L Arrese; Jose L Soulages
Journal:  Annu Rev Entomol       Date:  2010       Impact factor: 19.686

8.  Integrative Genomics Viewer (IGV): high-performance genomics data visualization and exploration.

Authors:  Helga Thorvaldsdóttir; James T Robinson; Jill P Mesirov
Journal:  Brief Bioinform       Date:  2012-04-19       Impact factor: 11.622

9.  GSDS 2.0: an upgraded gene feature visualization server.

Authors:  Bo Hu; Jinpu Jin; An-Yuan Guo; He Zhang; Jingchu Luo; Ge Gao
Journal:  Bioinformatics       Date:  2014-12-10       Impact factor: 6.937

Review 10.  Hormone-sensitive lipase: sixty years later.

Authors:  Emeline Recazens; Etienne Mouisel; Dominique Langin
Journal:  Prog Lipid Res       Date:  2020-12-30       Impact factor: 16.195

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.