Literature DB >> 35498670

Development of a Genome-Edited Tomato With High Ascorbate Content During Later Stage of Fruit Ripening Through Mutation of SlAPX4.

Ju Hui Do1, Seo Young Park1, Se Hee Park1, Hyun Min Kim1, Sang Hoon Ma1, Thanh Dat Mai1, Jae Sung Shim1, Young Hee Joung1.   

Abstract

Ascorbate is an essential antioxidant substance for humans. Due to the lack of ascorbate biosynthetic enzyme, a human must intake ascorbate from the food source. Tomato is one of the most widely consumed fruits, thus elevation of ascorbate content in tomato fruits will improve their nutritional value. Here we characterized Solanum lycopersicum ASCORBATE PEROXIDASE 4 (SlAPX4) as a gene specifically induced during fruit ripening. In tomatoes, ascorbate accumulates in the yellow stage of fruits, then decreases during later stages of fruit ripening. To investigate whether SlAPX is involved in the decrease of ascorbate, the expression of SlAPXs was analyzed during fruit maturation. Among nine SlAPXs, SlAPX4 is the only gene whose expression was induced during fruit ripening. Mutation of SlAPX4 by the CRISPR/Cas9 system increased ascorbate content in ripened tomato fruits, while ascorbate content in leaves was not significantly changed by mutation of SlAPX4. Phenotype analysis revealed that mutation of SlAPX4 did not induce an adverse effect on the growth of tomato plants. Collectively, we suggest that SlAPX4 mediates a decrease of ascorbate content during the later stage of fruit ripening, and mutation of SlAPX4 can be used for the development of genome-edited tomatoes with elevated ascorbate content in fruits.
Copyright © 2022 Do, Park, Park, Kim, Ma, Mai, Shim and Joung.

Entities:  

Keywords:  CRISPR/Cas9; SlAPX; ascorbate; genome editing; tomato

Year:  2022        PMID: 35498670      PMCID: PMC9039661          DOI: 10.3389/fpls.2022.836916

Source DB:  PubMed          Journal:  Front Plant Sci        ISSN: 1664-462X            Impact factor:   5.753


Introduction

Ascorbate (L-ascorbic acid, L-threo-hex-2-enono-1,4-lactone) is one of the essential antioxidant molecules in plants and animals (Locato et al., 2013; Fenech et al., 2019). While many animals and plants can synthesize ascorbate, humans have lost the ability to synthesize ascorbate due to the mutations that occurred on the L-gulono-1,4-lactone oxidase, which is the last committed enzyme of the pathway (Drouin et al., 2011). Thus, humans must intake ascorbate through diets such as fresh vegetables and fruits. Tomato has been the most produced fruit in the world during the last 20 years. The total production of tomato fruits has been 182 million tons in 2018 and the annual production of tomatoes has increased during the last years (FAOSTAT., 2019). Even though the tomato is the most widely consumed fruit in the world, the tomato has been considered a moderate source of ascorbate due to its relatively low ascorbate content (Gest et al., 2013; Mellidou et al., 2021). Therefore, increasing ascorbate concentration in tomato fruits will have a great impact on human nutrition. In plants, ascorbate can be synthesized through four different pathways, namely, the D-mannose/L-galactose pathway, the D-glucose pathway, the myo-inositol pathway, and the D-galacturonate pathway (Wheeler et al., 1998; Ishikawa et al., 2018; Paciolla et al., 2019). Among these four pathways, the D-mannose/L-galactose pathway has been recognized as a major ascorbate biosynthetic pathway in plants (Fenech et al., 2019). D-mannose/L-galactose pathway uses D-fructose-6-phosphate as a precursor for ascorbate production. Specifically, D-fructose-6-phosphate is transformed into D-mannose-1-phosphate by phosphomannose isomerase (PMI) and phosphmannomutase (PMN) (Qian et al., 2007; Maruta et al., 2008). GDP-D-mannose pyrophosphorylase (GMP) transfers guanosine monophosphate into D-mannose-1-phosphate to form GDP-D-mannose (Conklin et al., 1999). Then, GDP-D-mannose-3′,5′-epimerase (GME) converts GDP-D-mannose into GDP-L-galactose (Gilbert et al., 2009). GDP-L-galactose is converted into L-galactono-1,4-lactone by GDP-L-galactose-phosphorylase (GGP), L-galactose-1-phosphate phosphatase (GPP), and L-galactose dehydrogenase (L-GalDH) (Gatzek et al., 2002; Laing et al., 2004; Dowdle et al., 2007). The L-galactono-1,4-lactone is finally converted into ascorbate by L-galactono-1,4-lactone dehydrogenase (GLDH) (Wheeler et al., 2015). On the other hand, there exists an ascorbate degradation pathway in plants (Foyer and Noctor, 2011; Locato et al., 2013). Ascorbate is oxidized into monodehydroascorbate (MDHA) by ascorbate peroxidase (APX) and spontaneously converted into dehydroascorbate (DHA). DHA has then reduced again into ascorbate via dehydroascorbate reductase (DHAR) or degraded via DHA oxidation (Parsons et al., 2011; Caverzan et al., 2012), indicating that oxidation of ascorbate to DHA, which is committed by APX, is required for its degradation in tomato. Increasing ascorbate content in plants can be achieved by either activation of its biosynthesis or inactivation of its degradation. Most of the attempts have been focused on ectopic expression of ascorbate biosynthetic genes in plants (Agius et al., 2003; Bulley et al., 2012; Macknight et al., 2017; Li et al., 2019). For example, heterogeneous expression of GGP significantly increases ascorbate content in potatoes, tomatoes, and strawberries (Bulley et al., 2012). Similarly, overexpression of other ascorbate biosynthetic genes such as GMP, GME, and GPP leads to a higher accumulation of ascorbate in rice plants (Zhang et al., 2015). Recently, it is also reported that pyramiding of transgenic tomato plants simultaneously overexpressing four ascorbate biosynthetic genes (GME, GMP, GGP, and GPP) increased ascorbate content up to 18% in tomato fruits (Li et al., 2019). In addition, activation of ascorbate recycling by overexpression of wheat DHAR increased ascorbate content in tobacco and maize plants (Chen et al., 2003). Even though activation of ascorbate biosynthesis or recycling greatly increases ascorbate content in plants, it often caused developmental defects due to metabolic perturbations (Bulley et al., 2012; Fenech et al., 2019). To minimize unintended effects by ectopic expression of ascorbate metabolic genes on plants development, suppression of ascorbate degradation genes, such as APXs, has been attempted in several plant species (Zhang et al., 2011; Chatzopoulou et al., 2020). Ascorbate peroxidase (APX) plays an important role in protecting plants from oxidative stress conditions produced during normal developmental processes and stress responses through the enzymatic conversion of H2O2 into H2O using ascorbate as an electron donor (Koussevitzky et al., 2008; Guo et al., 2020). Due to its importance for plant development and adaptation to the environment, the downregulation of APX also occasionally caused a negative effect on plants growth (Pnueli et al., 2003; Locato et al., 2013). For example, knockout mutation of Arabidopsis AtAPX1 showed retarded growth and reduced stress tolerance with elevated hydrogen peroxide level (Pnueli et al., 2003). Plants possess multiple APX isozymes. They have localized either mitochondria, chloroplasts, peroxisomes, or cytosol (Shigeoka et al., 2002; Najami et al., 2008; Yin et al., 2019; Tyagi et al., 2020; Li et al., 2021), and SlAPX isozymes showed different kinetic properties such as optimal pH, Km, and Vmax (Marquez et al., 1996; Liu et al., 2019; Wu and Wang, 2019). In addition, their expression levels were differentially regulated in plants. These results imply that each APX might play distinguished functions during plant growth and stress responses. To improve ascorbate content in tomato plants with minimal alteration on plant growth, identification of the SlAPX specifically acting during fruit maturation is crucial. In tomatoes, there exist nine putative SlAPXs containing three cytosolic, two peroxisomal, two chloroplastic, and two uncharacterized APXs (Najami et al., 2008). Here, we aimed to develop tomato plants with elevated ascorbate content in fruits through mutation of the fruit-specific SlAPX by CRISPR/Cas9-mediated mutagenesis. Among nine SlAPXs, SlAPX4 is the only gene showing fruit-specific expression patterns. Thus, we selected SlAPX4 as a target for CRISPR/Cas9-mediated mutagenesis and analyzed the effect of SlAPX4 mutation on ascorbate content, expression of ascorbate metabolic genes, and development of tomato plants.

Materials and Methods

Plant Growth Conditions

Tomato seeds (Solanum lycopersicum cv. Micro-Tom) used in this study were kindly provided by prof. Sanghyeob Lee in the Sejong University in Korea. Tomato seeds were sown on a Murashige–Skoog (MS) solid medium [4.4 g/l of MS salt (Duchefa, Netherlands), 30 g/l of sucrose (Sigma-Aldrich, USA), and 0.5 g/l of 2-(N-morpholino) ethanesulfonic acid (MES) (Duchefa, Netherlands), pH 5.7] and incubated in a growth room with the light-dark cycle of 16 h light/8 h dark at 22 to 24°C for gene expression analysis and agrobacterium-mediated transformation. For growing tomato plants until fruit ripening stage, tomato seeds (S. lycopersicum cv. Micro-Tom) were sown on a soil pot supplemented with a complex fertilizer Green coat (DHC, Japan) and incubated in a growth room with the light-dark cycle of 16 h light/8 h dark at 22 to 24°C with 65% of relative humidity until maturity. Plants were fully watered at 2-day intervals. Each pot contained one tomato plant and the pots were randomly distributed in the growth room. An 8-week-old tomato plants were used for gene expression analysis and ascorbate quantification in leaves. A 10-week-old tomato plants were used for phenotypic analysis. For analyzing the expression level of ascorbate metabolic genes and ascorbate content in fruits, three fruits per plant from three independent plants were collected at the stage of mature green, breaking, yellowing, and red ripening.

Plasmid Construction

To target the SlAPX4 coding region for CRISPR/Cas9-mediated mutagenesis, four independent single-guide RNAs (sgRNAs) were cloned into the pAGM4723 vector using the Golden gate system as previously described (Engler et al., 2009). The SlAPX4-specific sgRNAs were amplified with a forward primer (sgRNA1; 5′-TGTGGTCTCAATTTTTGGAAATCGACGTTTGATGTTTTAGAGCTAGAAATAGCAAG-3′, sgRNA2; 5′-TGTGGTCTCAATTAAGCAGTTGAAAAATGTAAGGTTTTAGAGCTAGAAATAGCAAG-3′, sgRNA3; 5′-TGTGGTCTCAATTGTTAAGAATTTTTTACATGAGTTTTAGAGCTAGAAATAGCAAG-3′, and sgRNA4; 5′-TGTGGTCTCAATTGATGTCAAAACCAAAACTGGGTTTTAGAGCTAGAAATAGCAAG-3′) and a reverse primer (CRISPR Universal, 5′-TGTGGTCTCAAGCGTAATGCCAACTTTGTAC-3′) using the pICH86966 plasmid as a template. The PCR products and U6 promoter of pICSL01009 plasmids were cloned into the pICH47751 plasmid through BasI (NEB, USA) restriction site. The pICH47751 harboring sgRNA under the control of the U6 promoter, pICH47732_NPTII, and pICH47742_35S:Cas9 plasmids were digested with BpiI (Thermo Scientific, USA), and integrated into pAGM4723 vector using T4 Ligase (NEB, USA). The resultant pAGM4723 harboring SlAPX4-specific sgRNA was used for transient expression analysis and agrobacterium-mediated transformation.

Transient Expression in Tomato Plants

The four plasmids harboring different sgRNAs were transformed into Agrobacterium tumefaciens strain GV3101. The transformed GV3101 were incubated in yeast extract peptone (YEP) liquid media [10 g/l of yeast extract (Sigma-Aldrich, USA), 10 g/l of peptone (Sigma-Aldrich, USA), and 5 g/l of NaCl (Sigma-Aldrich, USA), pH 7.2] supplemented with 50 mg/l rifampicin (Duchefa, Netherlands) and 50 mg/l kanamycin (Biosesang, Korea) for overnight at 28°C. In total, 1 ml of overnight culture was transferred into 20 ml fresh YEP media supplemented with 50 mg/l rifampicin and 50 mg/l kanamycin and incubated for 16 h at 28°C. The bacterial solution was centrifuged at 3,500 rpm for 20 min, and the resultant bacterial pellet was resuspended in 10 mM MgCl2 (Sigma-Aldrich, USA) solution supplemented with 200 μM acetosyringone (Sigma-Aldrich, USA) (final OD600 = 0.8–0.9) and incubated at room temperature for 3 h. The bacterial solution was infiltrated into tomato cotyledons using a needless syringe. The ~50 infiltrated cotyledons were harvested 5 days after infiltration for genomic DNA extraction and further PCR analysis. The efficiency of four sgRNAs was evaluated by sequencing analysis of TA-cloned PCR products.

Agrobacterium-Mediated Tomato Transformation

The final construct harboring SlAPX4-specific sgRNA and SpCas9 was transformed into A. tumefaciens strain LBA4404 for agrobacterium-mediated transformation. The agrobacterium harboring the plasmids were incubated in YEP liquid media containing 50 mg/l rifampicin and 50 mg/l kanamycin overnight at 28°C. A total of 2 ml of the overnight culture solution was transferred into 3 ml of YEP media supplemented with 50 mg/l rifampicin and 50 mg/l kanamycin and incubated at 28°C until final OD600 was between 0.7 and 0.8. The solution was centrifuged at 3,100 rpm for 20 min and the resultant pellet was resuspended in half strength of MS liquid media (2.2 g/l of MS salt, 20 g/l of sucrose, and 0.5 g/l of MES, pH 5.7) containing 200 μM acetosyringone for 4 h. The Agrobacterium solution was then cocultivated with tomato cotyledons for 10 min. After cocultivation, tomato cotyledons were placed upside down on coculture medium (4.4 g/l of MS salt, 30 g/l of sucrose, 8 g/l of plant agar, 0.1 mg/l of indole-3-acetic acid (IAA), 2 mg/l of zeatin, and 200 μM acetosyringone, pH 5.2) and incubated in the dark for 2 days. Then the tomato cotyledons were transferred into shoot induction medium (4.4 g/l of MS salt, 30 g/l of sucrose, 8 g/l of plant agar, 0.1 mg/l of IAA, 2 mg/l of zeatin, 50 mg/l of kanamycin, and 250 mg/l of cefotaxime, pH 6.0) and incubated until the shoot has appeared. After complete formation of the shoot, the callus was incubated on root induction medium (4.4 g/l of MS salt, 15 g/l of sucrose, 8 g/l of plant agar, 2 mg/l of indolebutyric acid, 50 mg/l of kanamycin, and 250 mg/l of cefotaxime, pH 6.0). The regenerated seedlings with shoots and roots were then transferred into the soil for further growth.

Analysis of Mutation Pattern in Transgenic Plants

To analyze the mutation patterns, the SlAPX4 genomic region targeted by a sgRNA was amplified by PCR using the gene-specific primers (Supplementary Table S1) with genomic DNAs extracted from leaves of non-transgenic and transgenic plants. Plant genomic DNA preparation was carried out as follows. A total of 500 mg of tomato leaves were homogenized by a mortar and a pestle with liquid N2. The ground sample was resuspended with plant genomic DNA extraction buffer [50 mM Tris-Cl (pH 7.6), 17 mM sodium dodecyl sulfate, 100 mM NaCl, 50 mM ethylenediaminetetraacetic acid (pH 7.6), 1% β-mercaptoethanol, and 42 mg/l RNase A] and incubated at 55°C for 10 min. A total of 500 μl of phenol: chloroform: isoamyl alcohol (25:24:1) was added into the extract and centrifuged at 13,000 rpm at 4°C for 15 min. The supernatant was transferred into a new microcentrifuge tube and one volume of isopropanol was added to the solution. The mixture was centrifuged at 13,000 rpm at 4°C for 10 min. The resultant pellet obtained after centrifugation was dissolved in 50 μl of sterilized distilled water and used as a template for a PCR reaction. PCR conditions were as follows: 95°C for 10 min and 40 cycles of 95°C for 30 s, 54°C for 30 s, and 72°C for 1 min. PCR products were then purified using the QIAquick PCR Purification Kit (Qiagen, Germany) and used for further direct sequencing, targeted deep sequencing, and cloning into the pGEM-T Easy vector (Promega, USA).

Ribonucleic Acid Isolation and Quantitative Real-Time PCR Analysis

Total RNA was extracted from leaves using an RNeasy Plant Mini Kit (Qiagen, Germany) according to the manufacturer's instruction. A total of 1 μg of total RNA was treated with an RNase-free DNase I (Qiagen, Germany), and used for first-strand synthesis reactions using the QuantiTect Reverse Transcription Kit (Qiagen, Germany) according to the manufacturer's instruction. The products were used for quantification of target transcripts through quantitative real-time PCR (qRT-PCR) analysis with gene-specific primers. The tomato SlACTIN (SlACT, Solyc03g078400) was used as an internal control for normalization. Gene expression and ascorbate content were analyzed from three biological replicates. The primer information used for qRT-PCR gene expression is given in Supplementary Table S1.

Ascorbate Quantification

Endogenous ascorbate content was quantified using the Ascorbic Acid Assay Kit (Abcam, UK) in fruits and high-performance liquid chromatography (HPLC) analysis in leaves. For ascorbate quantification in fruits, 40 mg of samples were rinsed with ice-cold phosphate-buffered saline (PBS) pH 7.4. The rinsed samples were homogenized with 400 μl of ddH2O using TissueLyzer II (Qiagen, Germany). The crude extract was centrifuged at 13,000 rpm at 4°C for 5 min, and the supernatant was used for ascorbate quantification assay. Further analysis and quantification of ascorbate were performed according to manufacturer's instruction. Endogenous ascorbate content in leaves was determined by an HPLC analysis. A total of 0.01 g of plant powder ground with liquid nitrogen was homogenized in 3 ml of 5% meto-phosphate acid (MPA) (Sigma-Aldrich, USA). The homogenate was centrifuged at 13,000 rpm at 4°C for 10 min. The supernatant was filtered using a syringe filter (0.45 um, Biofact, Korea). The flow-through was incubated with 2 mg of dithiothreitol (DTT) in the dark for 25 min. Separation was achieved by isocratic elution with 0.1% trifluoroacetic acid (TFA) (pH 1.88). A total of 10 μl of the reaction mixture was injected into a Gemini C18 column (150 mm ×4.6 mm, particle size 5 μm; Phenomenex, USA) and flowed at a rate of 1 ml/min for 10 min. The column temperature was maintained at 30°C and the autosampler temperature was maintained at 8°C. Ascorbate was detected with photodiode array (PDA) at 244 nm. Quantification of ascorbate was performed using LabSolutions CS software (Shimadzu, Japan). The amount of ascorbate was determined from three biological replicates using the standard curve and normalized to the mass of fresh plant tissue.

Phenotype and Agronomic Trait Analysis

Ten mutant plants per line were used for phenotypic analysis of slapx4 mutants. The height was measured from the bottom of the pot to the top of the plant. The number of buds, fruits, and seeds per was counted from each individual plant (n = 10).

Statistics

The statistical significance of gene expression and metabolite content between Micro-Tom wild-type (WT) plants and slapx4 mutant plants with one-way ANOVA test using GraphPad Prism version 8.0.1 (https://www.graphpad.com/scientific-software/prism/). Three biological replicates were used for gene expression and ascorbate quantification. Ten independent tomato plants were used for phenotypic analysis (plant height, flower number, fruit number, and seed number).

Results

Identification of the Fruit-Specific SlAPX in Tomato

To determine temporal regulation of ascorbate accumulation in tomato plants, we monitored changes in ascorbate content during fruit maturation. Ascorbate content was lower in the mature green (MG) and breaking (BK) stage than yellowing (YE) and red-ripening (RR) stages of tomato fruits (Figure 1A). The ascorbate content peaked in the YE stage then decreased in the RR stage. These results indicated that ascorbate is accumulated during the early stage of fruit maturation then decreased during the later stage of fruit maturation. To explain the observed changes through transcriptional regulation of the ascorbate metabolic pathway, we first analyzed the expression pattern of genes that are involved in ascorbate biosynthesis in tomatoes (Supplementary Figure S1). Gene expression analysis revealed that ascorbate biosynthetic genes (SlGMP, SlGLDH, and SlGME2), except SlGME1, showed the highest expression level in leaves. During fruit maturation, SlGMP and SlGLDH were highly expressed in mature green and breaking stages of fruit development, then the expression level was decreased in yellowing and red ripening stages of fruit development (Supplementary Figure S1). Expression of SlGME1 was lower in the red ripening stage than other stages of fruit. The expression level of ascorbate recycling genes (SlDHAR1, SlDHAR2, and SlMDHAR) was higher in the early stage of fruit maturation than the later stage of fruit maturation (Supplementary Figure S1). We then checked the expression pattern of SlAPX genes during fruit maturation (Figure 1B and Supplementary Figure S2). Among the nine SlAPX genes, four SlAPXs (SlAPX1, 2, 3, and 4) were mainly expressed in tomato plants (Sato et al., 2012) (Supplementary Figure S2). SlAPX1, 2, and 3 were expressed in several tomato tissues, namely, leaves, roots, flowers, and fruits, while SlAPX4 was predominantly expressed in fruits (Figure 1B and Supplementary Figure S2). Expression of SlAPX1, 2, and 3 was generally higher during the early stage of fruit ripening (Figure 1B) while SlAPX4 expression was gradually upregulated during fruit ripening (Figure 1B). Based on these data, we chose SlAPX4 as a target of mutagenesis for fruit-specific accumulation of ascorbate in tomatoes.
Figure 1

Regulation of ascorbate accumulation during fruit development. (A) Change of ascorbate content during tomato fruit ripening. Ascorbate content (nmol per gram fresh weight) was determined from fruits at the indicated developmental stages. (B) The relative expression level of SlAPXs during fruit ripening. SlACT (Soly03g078400) was used as an internal control for normalization. Three tomato fruits from three individual plants at the indicated developmental stages were pooled for ascorbate quantification and gene expression analysis. Data represent the mean value + SD of three biological replicates. A significant difference was indicated with different letters above the bars (one-way ANOVA test). FW, fresh weight; MG, mature green; BK, breaking; YE, yellowing; RR, red ripening; LF, leaves.

Regulation of ascorbate accumulation during fruit development. (A) Change of ascorbate content during tomato fruit ripening. Ascorbate content (nmol per gram fresh weight) was determined from fruits at the indicated developmental stages. (B) The relative expression level of SlAPXs during fruit ripening. SlACT (Soly03g078400) was used as an internal control for normalization. Three tomato fruits from three individual plants at the indicated developmental stages were pooled for ascorbate quantification and gene expression analysis. Data represent the mean value + SD of three biological replicates. A significant difference was indicated with different letters above the bars (one-way ANOVA test). FW, fresh weight; MG, mature green; BK, breaking; YE, yellowing; RR, red ripening; LF, leaves.

Generation of CRISPR/Cas9-Mediated slapx4 Mutants

Since SlAPX4 is the only gene, whose expression is upregulated during the later stage of fruit ripening, mutation of SlAPX4 might slow down the decrease of ascorbate content during the later stage of fruit ripening. To address the possibility, we generated slapx4 mutant plants by applying clustered regularly interspaced short palindromic repeats (CRIPSR)/CRISPR-associated protein 9 (Cas9) system in tomatoes. To screen a sgRNA that effectively induces mutation on the SlAPX4 gene, we generated four plant expression vectors that encode independent single guide RNAs (sgRNAs) targeting the exon region of SlAPX4. The expression vectors were infiltrated into tomato cotyledons to determine the efficiency of each sgRNAs. The mutation efficiency of each sgRNA was determined by sequencing the genomic region targeted by a sgRNA. Among the tested four independent sgRNAs, the sgRNA4 that targets the first exon of SlAPX4 showed the highest mutation efficiency (Table 1). Thus, the plant expression vector harboring SpCas9 and sgRNA4 was introduced into tomato plants to generate slapx4 mutant plants. A total of 16 T0 plants (CRISPR/Cas9) were selected based on antibiotic resistance and PCR verification of NPTII and Cas9 genes (Figure 2A). Among the 16 T0 plants, four plants contained mutation on the SlAPX4 genomic region targeted by sgRNA4. Specifically, one heteroallelic mutant (CRISPR/Cas9 #1, T insertion/ C deletion), one monoallelic mutant (CRISPR/Cas9 #11, T insertion), and two mosaic mutants (CRISPR/Cas9 #7 and #12) were identified by sequencing analysis (Figure 2B and Supplementary Figure S3). Amino acid analysis revealed that either T insertion or C deletion caused a loss of multiple catalytic residues and cation-ligand residues with early termination (Table 2). Thus, CRISPR/Cas9 #1 and CRISPR/Cas9 #11 T0 plants were further propagated into the T1 stage, and three biallelic homozygous SLAPX4 mutant plants with T base insertion (SLAPX4 #1-T_ins and #11-T_ins) or C base deletion (SLAPX4 #1-C_del) were selected for further analysis (Figure 2C).
Table 1

Mutation efficiency of sgRNAs targeting SlAPX4.

sgRNA Sequence Total sequenced colonies (number) Colonies with mutation on 3 bp upstream from PAM site (number) Mutation efficiency (%)*
sgRNA1 TTTGGAAATCGACGTTTGAT CGG 44200
sgRNA2 AAGCAGTTGAAAAATGTAAG AGG 27300
sgRNA3 GTTAAGAATTTTTTACATGA TGG 54820.36
sgRNA4 GATGTCAAAACCAAAACTGG TGG 56150.89

Mutation efficiency of sgRNAs determined by sequencing plasmids containing PCR fragments of genomic regions targeted by single-guide RNA (sgRNA). *Mutation efficiency= number of colonies with mutation on 3 bp upstream from PAM site/number of total sequenced colonies. Bold, sgRNA target site; underlined, PAM site.

Figure 2

Generation of SLAPX4 mutant plants. (A) Validation of transgenic plants using NPTII and Cas9-specific PCR reactions. (B) Sequencing analysis of SlAPX4 locus targeted by a single-guide RNA (sgRNA). Genomic DNA extracted from the T0 stage of CRISPR transgenic tomato plants was used for amplification of the SlAPX4 genomic region targeted by a sgRNA through PCR reactions. The PCR products were then applied for targeted deep sequencing analysis. (C) A representative chromatograph of edited alleles in the T1 stage of SLAPX4 mutant plants was shown with the mutated target region. Bold, sgRNA target site; blue, base insertion; underlined, PAM site.

Table 2

Amino acid sequence analysis of the target site in slapx4 mutant plants.

Line Genotype Amino acid sequence
WTWTMVKCYPTVSEEYQKAVEKCKRKLRGLIAEKNCAPIMLRLAWHSAGTYDVKTKTGGPFGTIRHPNELKHGANNGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPDIPFHPGRQDKTEPPPEGRLPDATKGSDHLREVFGHMGLSDKDIVALSGGHTLGRCHKERSGFEGAWTNNPLIFDNSYFKELLSGEKEGLLQLPSDKALLEDPVFRPLVEKYAADEDAFFADYAEAHLKLSELGFADAE
slapx4 #1 T insT insertionMVKCYPTVSEEYQKAVEKCKRKLRGLIAEKNCAPIMLRLAWHSAGTYDVKTKTWWSIWNNQAPE*
slapx4 #1 C delC deletionMVKCYPTVSEEYQKAVEKCKRKLRGLIAEKNCAPIMLRLAWHSAGTYDVKTKMVVHLEQSGTRMNLNMELTMVLILLFDFWSRSRNSSQSYPTLTFISWLE*
slapx4 #11 T insT insertionMVKCYPTVSEEYQKAVEKCKRKLRGLIAEKNCAPIMLRLAWHSAGTYDVKTKTWWSIWNNQAPE*

WT, wild-type; asterisk, stop codon; Bold with underlined, mutated regions; Red, catalytic residues (Najami et al., .

Mutation efficiency of sgRNAs targeting SlAPX4. Mutation efficiency of sgRNAs determined by sequencing plasmids containing PCR fragments of genomic regions targeted by single-guide RNA (sgRNA). *Mutation efficiency= number of colonies with mutation on 3 bp upstream from PAM site/number of total sequenced colonies. Bold, sgRNA target site; underlined, PAM site. Amino acid sequence analysis of the target site in slapx4 mutant plants. WT, wild-type; asterisk, stop codon; Bold with underlined, mutated regions; Red, catalytic residues (Najami et al., . Generation of SLAPX4 mutant plants. (A) Validation of transgenic plants using NPTII and Cas9-specific PCR reactions. (B) Sequencing analysis of SlAPX4 locus targeted by a single-guide RNA (sgRNA). Genomic DNA extracted from the T0 stage of CRISPR transgenic tomato plants was used for amplification of the SlAPX4 genomic region targeted by a sgRNA through PCR reactions. The PCR products were then applied for targeted deep sequencing analysis. (C) A representative chromatograph of edited alleles in the T1 stage of SLAPX4 mutant plants was shown with the mutated target region. Bold, sgRNA target site; blue, base insertion; underlined, PAM site.

Accumulation of Ascorbate in slapx4 Mutant Plants

To investigate the effects of SlAPX4 mutation on ascorbate accumulation in tomato plants, we analyzed ascorbate content in leaves and fruits of slapx4 mutant plants (Figure 3). No significant difference was detected on ascorbate content in leaves between WT and slapx4 mutant plants (Figure 3A). On the other hand, compared with WT control plants, all the selected slapx4 mutant plants possessing either insertion or deletion mutation on SlAPX4 accumulated significantly higher levels of ascorbate in fruits (Figure 3B). To investigate the possibility that the change of ascorbate content in slapx4 mutant plants alters ascorbate metabolic gene expression, we analyzed the expression pattern of four ascorbate biosynthetic genes (SlGMP, SlGLDH, SlGME, and SlGME2) and three ascorbate recycling genes (SlDHAR1, SlDHAR2, and SlMDHAR) in leaves and fruits of slapx4 mutant plants. The expression level of ascorbate biosynthesis and recycling genes in both leaves and fruits was similar between WT and slapx4 mutant plants (Figures 4A,B). We then checked the expression pattern of SlAPXs in WT and slapx4 mutant plants. Similar to ascorbate biosynthetic genes, the expression of SlAPX1, 2, and 3 was similar between WT and slapx4 mutant plants (Figure 4C and Supplementary Figure S4). On the other hand, compared with WT plants, SlAPX4 expression was significantly reduced in slapx4 mutant plants (Figure 4C and Supplementary Figure S4).
Figure 3

Determination of ascorbate content in SLAPX4 mutant plants. (A,B) Wild-type (WT) and SLAPX4 mutant plants containing biallelic mutation (T base insertion; SLAPX4 #1 T ins and #11 T ins, C base deletion; SLAPX4 #1 C del) were grown in the soil. The plants were used for quantification of ascorbate content (nmol per fresh weight) in leaves (A) and red-ripening fruits (B). Leaves and fruits from three independent plants were pooled for ascorbate quantification. Data represent the mean value + SD of three biological replicates. A significant difference was shown with different letters above the bars (one-way ANOVA test). FW, fresh weight.

Figure 4

Expression pattern of ascorbate metabolic genes in SLAPX4 mutant plants. (A,B) Relative expression levels of ascorbate metabolic genes in leaves (A) and fruits (B) of wild-type (WT) and SLAPX4 mutant plants (SLAPX4 #1 T ins, #1 C del, and #11 T ins). (C) The relative expression of SlAPXs in WT and SLAPX4 mutant plants during fruit maturation. Leaves or fruits from three individual tomato plants at the indicated stages of development were pooled for gene expression analysis. SlACT (Soly03g078400) was used as an internal control for normalization. Data represent the mean value + SD of three biological replicates. A significant difference was shown with different letters above the bars for (A) (one-way ANOVA test). Significant difference between WT and SLAPX4 mutant plants was shown by asterisks for (B) (Student's t-test, *p < 0.05, **p < 0.001, and ***p < 0.0001). LF, leaves; MG, mature green; BK, breaking; YE, yellowing; RR, red ripening.

Determination of ascorbate content in SLAPX4 mutant plants. (A,B) Wild-type (WT) and SLAPX4 mutant plants containing biallelic mutation (T base insertion; SLAPX4 #1 T ins and #11 T ins, C base deletion; SLAPX4 #1 C del) were grown in the soil. The plants were used for quantification of ascorbate content (nmol per fresh weight) in leaves (A) and red-ripening fruits (B). Leaves and fruits from three independent plants were pooled for ascorbate quantification. Data represent the mean value + SD of three biological replicates. A significant difference was shown with different letters above the bars (one-way ANOVA test). FW, fresh weight. Expression pattern of ascorbate metabolic genes in SLAPX4 mutant plants. (A,B) Relative expression levels of ascorbate metabolic genes in leaves (A) and fruits (B) of wild-type (WT) and SLAPX4 mutant plants (SLAPX4 #1 T ins, #1 C del, and #11 T ins). (C) The relative expression of SlAPXs in WT and SLAPX4 mutant plants during fruit maturation. Leaves or fruits from three individual tomato plants at the indicated stages of development were pooled for gene expression analysis. SlACT (Soly03g078400) was used as an internal control for normalization. Data represent the mean value + SD of three biological replicates. A significant difference was shown with different letters above the bars for (A) (one-way ANOVA test). Significant difference between WT and SLAPX4 mutant plants was shown by asterisks for (B) (Student's t-test, *p < 0.05, **p < 0.001, and ***p < 0.0001). LF, leaves; MG, mature green; BK, breaking; YE, yellowing; RR, red ripening.

Phenotype Analysis of slapx4 Mutant Plants

To investigate the potential effects of SlAPX4 mutation on plant growth, we monitored the developmental phenotypes of slapx4 mutants whose red ripening fruit showed higher ascorbate content (Figure 5). Overall, slapx4 mutant plants did not show growth defects compared with WT control plants (Figure 5A). Total plant height determined at the breaking stage was similar between WT and two of three slapx4 mutant plants (slapx4 #1 C_del and #11 T_Ins) (Figure 5B). The number of flower buds was not significantly different between WT and slapx4 mutant plants (Figure 5C). In addition, the fruit of WT and slapx4 mutant plants showed similar morphology (Supplementary Figure S5). On the other hand, two of three slapx4 mutant plants (slapx4 #1 C_del and #11 T_Ins) produced more fruits (Figure 5D), and slapx4 #1 C-del plants had a higher number of seeds than WT control plants (Figure 5E).
Figure 5

Phenotypic analysis of SLAPX4 mutant plants. (A–E) Wild-type (WT) and SLAPX4 mutant plants (SLAPX4 #1 T ins, #1 C del, and #11 T ins) were grown on the soil until maturity. (A) The phenotype of the representative plants was visualized by taking a picture at the mature green stage. Same WT plants were used for three independent pictures. Plant height (B), flower bud number (C), fruit number (D), and seed number (E) per plant were measured from ten independent plants. Data represent the mean value + SD (n = 10). A significant difference was shown with different letters above the bars (one-way ANOVA test).

Phenotypic analysis of SLAPX4 mutant plants. (A–E) Wild-type (WT) and SLAPX4 mutant plants (SLAPX4 #1 T ins, #1 C del, and #11 T ins) were grown on the soil until maturity. (A) The phenotype of the representative plants was visualized by taking a picture at the mature green stage. Same WT plants were used for three independent pictures. Plant height (B), flower bud number (C), fruit number (D), and seed number (E) per plant were measured from ten independent plants. Data represent the mean value + SD (n = 10). A significant difference was shown with different letters above the bars (one-way ANOVA test).

Discussion

Tomatoes have relatively low ascorbate content compared with other fruits, such as strawberry and grape (Beecher, 1998). Based on its importance as a human diet and its high raw intake, an increase of ascorbate content in tomato fruits will have far-reaching effects from a nutritional point of view. Here we have suggested the strategy to develop tomatoes with elevated ascorbate content through targeted mutagenesis of fruit-specific SlAPX4 using the CRISPR/Cas9 system. Ascorbate content analysis in tomato plants revealed that ascorbate levels increase during the early stages of fruit ripening and decrease during the later stage of fruit ripening (Figure 1A). Similar accumulation patterns were observed in various tomato cultivars originated from different continents (Abushita et al., 1997; Mellidou et al., 2012; Sacco et al., 2019), suggesting that developmental regulation of ascorbate content is well-conserved in many tomato cultivars. Ascorbate pool in fruits is known to be closely correlated with the oxidative status of tomato fruits (Imai et al., 2009; Li et al., 2010; Lima-Silva et al., 2012). The increase of ascorbate content would be beneficial to maintain redox balance during fruit development and ripening through the effective removal of reactive oxygen species (Jimenez et al., 2002; Gapper et al., 2013). However, little is known how ascorbate content increases during tomato fruit ripening. Gene expression analysis showed that expression of ascorbate biosynthetic genes was generally downregulated during fruit maturation (Supplementary Figure S1). These results suggest that accumulation of ascorbate during the early stage of fruit maturation could be accomplished by other mechanisms rather than transcriptional regulation of biosynthetic pathway (Imai et al., 2009; Li et al., 2010). One possible explanation for the phenomenon is the source to sink allocation of ascorbate in plants. It is predicted that translocation of ascorbate from leaves to developing fruits, rather than de-novo synthesis, provides an ascorbate pool in fruits at the early stage of fruit ripening (Badejo et al., 2012). It has also been suggested that enhanced rates of ascorbate recycling increased ascorbate content during fruit ripening (Mellidou et al., 2012). Another potential mechanism related to ascorbate accumulation during fruit ripening is a transcriptional regulation of SlAPX genes. We found that four SlAPXs (SlAPX1, 2, 3, and 4) among nine SlAPXs were mainly expressed in tomato plants (Figure 1B and Supplementary Figure S2). Expression of SlAPX1, 2, and 3 was gradually reduced during fruit ripening, while SlAPX4 expression was induced during fruit ripening in tomato plants (Figure 1B). These temporal expressions of SlAPXs might be contributed to shaping ascorbate accumulation during fruit ripening. Mutation of ascorbate peroxidase is a promising strategy for increasing ascorbate content in plants. It has been reported that the tomato cultivar with elaborated ascorbate content showed reduced expression of ascorbate peroxidase (Di Matteo et al., 2010). However, due to its importance for detoxification of hydrogen peroxide with ascorbate (Caverzan et al., 2012), precise functional characterization of ascorbate peroxidase is necessary to minimize potential negative effects caused by the mutation of APX on plant development. Expression characteristics of SlAPX4 suggested it as an attractive target for developing genome-edited tomatoes with elevated ascorbate content in fruits. Unlike other SlAPX genes, SlAPX4 was predominantly expressed in fruits than other tissues such as leaves, roots, and flowers (Figure 1B and Supplementary Figure S2). In addition, SlAPX4 is the only gene whose expression was strongly expressed during the later stage of fruit ripening. On the other hand, other SlAPXs (SlAPX1, SlAPX2, and SlAPX3) were predominantly expressed during the early stage of fruit development (Figure 1B and Supplementary Figure S2). These results suggest that SlAPX4 could be related to the decrease of ascorbate content during the later stage of fruit ripening. Ascorbate content analysis revealed that the mutation of SlAPX4 significantly increased ascorbate content up to 2-fold in red ripening fruits (Figure 3B). Similar to our result, it has been reported that suppression of mitochondrial APX expression increases ascorbate content in plants due to lower degradation of ascorbate (Zhang et al., 2011; Chatzopoulou et al., 2020). However, suppression of APX expression often caused abnormal growth patterns (Pnueli et al., 2003; Chatzopoulou et al., 2020). These growth alterations could be caused by disruption of the ascorbate metabolic pathway during plant development. Gene expression analysis revealed that the expression level of ascorbate metabolic genes in slapx4 mutant plants was similar to that of WT control plants in leaves (Figure 4A). In addition, the leaf ascorbate content was not significantly affected by the SlAPX4 mutation (Figure 3A). Moreover, phenotype analysis of slapx4 mutant plants revealed that all the generated slapx4 mutant plants grew normally without growth retardation (Figure 5). These results suggest that SlAPX4 is mainly involved in ascorbate metabolism during fruit maturation. Interestingly, slapx4 mutant plants produced slightly more flowers and fruits compared with WT control plants (Figures 5C,D). A similar result was obtained from tomato plants with elevated ascorbate by suppression of ascorbate oxidase (Abdelgawad et al., 2019). These observed growth changes support the idea that the increase of ascorbate content affects plant development through alteration of hormonal signal transduction (Lima-Silva et al., 2012; Akram et al., 2017). Even though the increase of ascorbate content in fruits is beneficial for human nutrition, the excessive increase of ascorbate content causes developmental defects in fruit shape and seed production (Bulley et al., 2012). Overexpression of the ascorbate biosynthetic gene increases metabolic flux to ascorbate biosynthesis, resulting in the decrease of metabolites required for cell wall biosynthesis (Dumville and Fry, 2003; Fenech et al., 2019). Our data showed that fruit shape and number of seeds of slapx4 mutant plants were similar to those of wild type plants (Figure 5E), suggesting that targeted mutagenesis of specific ascorbate degradation pathway would be less destructive than ectopic activation of the biosynthetic pathway in plants. In conclusion, the data presented here suggest that SlAPX4 is a valuable candidate gene to engineer tomato plants for increasing ascorbate content in mature fruits without growth defects.

Data Availability Statement

The datasets presented in this study can be found in online repositories. The names of the repository/repositories and accession number(s) can be found in the article/Supplementary Material.

Author Contributions

JHD and YHJ planned and designed all the aspects of the study. JHD and SYP generated gene editing vectors and tomato transgenic plants. JHD, SYP, SHP, HMK, TDM, and SHM participated in the phenotypical analysis of the plant. JHD, JSS, and YHJ performed the data interpretation and wrote the manuscript. All authors contributed to the article and approved the submitted version of the manuscript.

Funding

This study was supported by a grant from the New Breeding Technologies Development Program (Project No. PJ01487401 and PJ01654401) through the Rural Development Administration (RDA) and the National Research Foundation of Korea (NRF) grant funded by the Korean Government (MSIT) (NRF-2021R1F1A1060339 to JSS).

Conflict of Interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

Publisher's Note

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.
  50 in total

1.  Molecular characterization of ascorbate peroxidase (APX) and APX-related (APX-R) genes in Triticum aestivum L.

Authors:  Shivi Tyagi; Praveen Chandra Verma; Kashmir Singh; Santosh Kumar Upadhyay
Journal:  Genomics       Date:  2020-07-15       Impact factor: 5.736

2.  Chloroplast thylakoid ascorbate peroxidase PtotAPX plays a key role in chloroplast development by decreasing hydrogen peroxide in Populus tomentosa.

Authors:  Conghui Li; Yadi Liu; Xiatong Liu; Keith Ka Ki Mai; Jiaxin Li; Xiaorui Guo; Chong Zhang; Hui Li; Byung-Ho Kang; Inhwan Hwang; Hai Lu
Journal:  J Exp Bot       Date:  2021-05-28       Impact factor: 6.992

3.  A highly specific L-galactose-1-phosphate phosphatase on the path to ascorbate biosynthesis.

Authors:  William A Laing; Sean Bulley; Michele Wright; Janine Cooney; Dwayne Jensen; Di Barraclough; Elspeth MacRae
Journal:  Proc Natl Acad Sci U S A       Date:  2004-11-18       Impact factor: 11.205

4.  Silencing of ascorbate oxidase results in reduced growth, altered ascorbic acid levels and ripening pattern in melon fruit.

Authors:  Fani Chatzopoulou; Maite Sanmartin; Ifigeneia Mellidou; Irini Pateraki; Athanasios Koukounaras; Georgia Tanou; Mary S Kalamaki; Sonja Veljović-Jovanović; Tijana Cvetić Antić; Stefanos Kostas; Pavlos Tsouvaltzis; Rebecca Grumet; Angelos K Kanellis
Journal:  Plant Physiol Biochem       Date:  2020-08-27       Impact factor: 4.270

5.  Growth suppression, altered stomatal responses, and augmented induction of heat shock proteins in cytosolic ascorbate peroxidase (Apx1)-deficient Arabidopsis plants.

Authors:  Lilach Pnueli; Hongjian Liang; Mira Rozenberg; Ron Mittler
Journal:  Plant J       Date:  2003-04       Impact factor: 6.417

Review 6.  Ascorbate as seen through plant evolution: the rise of a successful molecule?

Authors:  Noé Gest; Hélène Gautier; Rebecca Stevens
Journal:  J Exp Bot       Date:  2012-10-29       Impact factor: 6.992

7.  Engineering increased vitamin C levels in plants by overexpression of a D-galacturonic acid reductase.

Authors:  Fernanda Agius; Rocío González-Lamothe; José L Caballero; Juan Muñoz-Blanco; Miguel A Botella; Victoriano Valpuesta
Journal:  Nat Biotechnol       Date:  2003-01-13       Impact factor: 54.908

8.  The tomato genome sequence provides insights into fleshy fruit evolution.

Authors: 
Journal:  Nature       Date:  2012-05-30       Impact factor: 49.962

9.  Cytosolic Ascorbate Peroxidases Plays a Critical Role in Photosynthesis by Modulating Reactive Oxygen Species Level in Stomatal Guard Cell.

Authors:  Kai Guo; Zhonghua Li; Hanxue Tian; Xueqiong Du; Zhen Liu; Hui Huang; Pengcheng Wang; Zhengxiu Ye; Xianlong Zhang; Lili Tu
Journal:  Front Plant Sci       Date:  2020-05-07       Impact factor: 5.753

10.  Evolution of alternative biosynthetic pathways for vitamin C following plastid acquisition in photosynthetic eukaryotes.

Authors:  Glen Wheeler; Takahiro Ishikawa; Varissa Pornsaksit; Nicholas Smirnoff
Journal:  Elife       Date:  2015-03-13       Impact factor: 8.713

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.