Literature DB >> 35157735

SARS-CoV-2-specific T cells generated for adoptive immunotherapy are capable of recognizing multiple SARS-CoV-2 variants.

Archana Panikkar1, Katie E Lineburg1, Jyothy Raju1, Keng Yih Chew2, George R Ambalathingal1, Sweera Rehan1, Srividhya Swaminathan1,3, Pauline Crooks1, Laetitia Le Texier1, Leone Beagley1, Shannon Best1, Matthew Solomon1, Katherine K Matthews1, Sriganesh Srihari1, Michelle A Neller1, Kirsty R Short2,4, Rajiv Khanna1,3, Corey Smith1,3.   

Abstract

Adoptive T-cell immunotherapy has provided promising results in the treatment of viral complications in humans, particularly in the context of immunocompromised patients who have exhausted all other clinical options. The capacity to expand T cells from healthy immune individuals is providing a new approach to anti-viral immunotherapy, offering rapid off-the-shelf treatment with tailor-made human leukocyte antigen (HLA)-matched T cells. While most of this research has focused on the treatment of latent viral infections, emerging evidence that SARS-CoV-2-specific T cells play an important role in protection against COVID-19 suggests that the transfer of HLA-matched allogeneic off-the-shelf virus-specific T cells could provide a treatment option for patients with active COVID-19 or at risk of developing COVID-19. We initially screened 60 convalescent individuals and based on HLA typing and T-cell response profile, 12 individuals were selected for the development of a SARS-CoV-2-specific T-cell bank. We demonstrate that these T cells are specific for up to four SARS-CoV-2 antigens presented by a broad range of both HLA class I and class II alleles. These T cells show consistent functional and phenotypic properties, display cytotoxic potential against HLA-matched targets and can recognize HLA-matched cells infected with different SARS-CoV-2 variants. These observations demonstrate a robust approach for the production of SARS-CoV-2-specific T cells and provide the impetus for the development of a T-cell repository for clinical assessment.

Entities:  

Mesh:

Substances:

Year:  2022        PMID: 35157735      PMCID: PMC8880869          DOI: 10.1371/journal.ppat.1010339

Source DB:  PubMed          Journal:  PLoS Pathog        ISSN: 1553-7366            Impact factor:   6.823


Introduction

T-cell immunotherapy is providing a paradigm shift in treatment options for patients with lethal infectious complications [1]. Research over the past three decades has demonstrated the great potential for the treatment of viral complications, particularly those that arise in immunocompromised individuals [2-4]. More recent studies have also shown the potential of T-cell immunotherapy in the treatment of non-viral infectious complications [5]. While early anti-viral T-cell immunotherapy work was pioneered through the use of autologous or hematopoietic stem cell transplant donor peripheral blood mononuclear cells (PBMC) as a source of T cells, more recent approaches have transitioned to the use of cryopreserved T-cell repositories generated from PBMC from allogeneic healthy donors that have defined specificity to the pathogen of choice [6-8]. The advantage of this approach is the ability to rapidly administer T cells within days of diagnosis rather than the 2–4 weeks that is typically required to generate an autologous therapy. Donors can be specifically selected to provide desirable features, including CD4+ and CD8+ T cells capable of recognizing multiple viral antigens in order to minimize the risk of antigenic variant escape, and diverse human leukocyte antigen (HLA) coverage to allow the provision of T cells to a genetically diverse population. The association of COVID-19 severity with age and other co-morbidities is a clear indication of greater risk to individuals with an increased level of immune compromise [9]. There is discordance between the efficient induction of T-cell immunity in patients who efficiently resolve COVID-19 and the T-cell dysfunction observed in patients with severe COVID-19. This discordance demonstrates the important role T cells likely play in disease control [10-13]. Whilst vaccination will be effective in a large percentage of the population [14,15], at-risk cohorts with compromised immunity (e.g. hematopoietic stem cell and organ transplant recipients) are less likely to generate effective immune responses. Multiple recent studies have demonstrated reduced vaccine-induced immunity in transplant recipients [16-20]. It is therefore likely that additional immunotherapeutic options will be needed for treatment. Based on our extensive experience with the administration of T cells to treat viral diseases in humans [3,21], and our recent characterization of critical immunological determinants in SARS-CoV-2 [22], we have developed a strategy to generate an allogeneic off-the-shelf T-cell repository from SARS-CoV-2-convalescent blood donors. Here we demonstrate that a small cohort of donors can be used to generate functionally potent SARS-CoV-2-specific T cells capable of recognizing multiple antigens and with broad HLA coverage across both HLA class I and class II alleles. Furthermore, we demonstrate that the T cell epitopes targeted in this approach are conserved and capable of recognizing cells infected with multiple variants of SARS-CoV-2.

Results

SARS-CoV-2-specific T cells can be readily generated from recovered individuals

To select potential donors for T cell immunotherapy, we assessed SARS-CoV-2 specific T cell responses from a cohort of sixty SARS-CoV-2-convalescent individuals recruited between 1 and 4 months after diagnosis, as described previously. The majority of these donors generated CD4+ T cells responses against the spike (S), nucleocapsid (N) and membrane (M) proteins of SARS-CoV-2, while CD8+ T-cell responses were directed against N, S and the ORF3a protein (Fig 1). Based on these analyses, we selected 12 participants who generated both CD4+ and CD8+ T-cell responses against multiple SARS-CoV-2 antigens, and who provided broad HLA coverage across common haplotypes in the population (Table 1). PBMC from these donors were stimulated with overlapping peptide pools from the four immunodominant antigens (N, S, M and ORF3a) and were then cultured for 2 weeks in the presence of IL-2 in G-Rex culture vessels. T-cell expansion and phenotype were monitored using a TBNK multi-test kit and cells were maintained at a density of 2 × 106 cells/cm2. At the end of the expansion period, T cells were assessed for a series of functional attributes (Fig 1).
Fig 1

Schematic representation of donor selection and generation of SARS-CoV-2-specific T cells for T-cell therapy.

Donors for T-cell expansion were selected from a cohort of 60 SARS-CoV-2-convalescent individuals whose cells had been screened for reactivity to SARS-CoV-2 antigens using an intracellular cytokine assay. Venn diagrams represent the number of donors generating a combination of antigen-specific responses by CD4+ or CD8+ T cells. Donors selected for T-cell expansion showed a minimum of three antigen-specific responses in CD4+ and/or CD8+ T cells. PBMC from each donor were stimulated with a single mixture of N, S, M and ORF3a overlapping peptide pools then cultured in G-Rex culture vessels for 2 weeks in the presence of IL-2. Cultured T cells were then assessed for a range of standard T-cell attributes.

Table 1

HLA types of the SARS-CoV-2-convalescent participants included in the study.

Participant CodeAgeSexABCDRB1DPB1DQB1DQA1
Q-00352M01:0125:0108:0135:0104:0107:0103:0104:0104:0102:0103:0103:0305:01
Q-00430F02:0103:0107:0244:0205:0107:0207:0115:0104:0104:0202:0206:0201:0202:01
Q-00533M02:0111:0115:0135:0103:0404:0101:0104:0104:0104:0203:0205:0101:0103:01
Q-00648M02:0124:0207:0218:0107:0107:0204:0107:0102:0120:0102:0203:0102:0103:03
Q-01271F02:0103:0144:0251:0101:0205:0101:0104:0103:0104:0203:0105:0101:0103:03
Q-01461F03:0129:0207:0244:0307:0216:0107:0115:0104:0102:0206:0201:0202:01
Q-02639F01:0130:0240:0149:0103:0407:0111:0113:0202:0104:0103:0106:0401:0205:05
Q-02931F02:0131:0107:0240:0103:0407:0211:0115:0104:0114:0103:006:0201:0205:05
Q-03161M02:0129:0215:0144:0303:0416:0104:0107:0103:01105:0102:0203:0102:0103:03
Q-04159M24:0233:0114:0240:0103:0408:0201:0204:0404:0106:0103:0205:0101:0103:01
Q-05623M01:0137:0157:0106:0208:0115:0104:0104:0206:0201:0204:01
Q-05852F02:0511:0135:0149:0104:0107:0101:0201:0302:0104:0205:0101:01
Q-00849F02:0103:0107:0244:0207:0207:0404:0415:0101:0104:0103:0206:0201:0203:01
Q-02457F01:0103:0107:0208:0107:0107:0203:0115:0103:0104:0102:0106:0201:0205:01
Q-002 (THI-COV-002)54F02:0132:0115:0144:0203:0305:0104:0111:0104:0104:0203:0103:0203:0105:05
Q-020 (THI-COV-003)59M24:0231:0107:0235:0204:0107:0211:0415:0104:0103:0106:0201:0205:05

Schematic representation of donor selection and generation of SARS-CoV-2-specific T cells for T-cell therapy.

Donors for T-cell expansion were selected from a cohort of 60 SARS-CoV-2-convalescent individuals whose cells had been screened for reactivity to SARS-CoV-2 antigens using an intracellular cytokine assay. Venn diagrams represent the number of donors generating a combination of antigen-specific responses by CD4+ or CD8+ T cells. Donors selected for T-cell expansion showed a minimum of three antigen-specific responses in CD4+ and/or CD8+ T cells. PBMC from each donor were stimulated with a single mixture of N, S, M and ORF3a overlapping peptide pools then cultured in G-Rex culture vessels for 2 weeks in the presence of IL-2. Cultured T cells were then assessed for a range of standard T-cell attributes. All cultures demonstrated cell expansion over the 14-day period with a median 18.4-fold expansion (range: 2.6–33.1 fold) (Fig 2A). Cultures were dominated by CD3+CD4+ T cells (median: 85.8%; range 68.6–93.4%), with the majority of the remaining cells being CD3+CD8+ T cells (median: 8.6%; range 2.6–27.9%) (Fig 2B). To assess the T-cell specificity, cultured cells were recalled with the overlapping SARS-CoV-2 peptide pools separately and assessed for cytokine production using a multiparametric intracellular cytokine assay (S1 and S2 Figs). Due to the size of the S protein, two separate pools were used for recall (S-1 and S-2). All cultures exhibited a CD4+ T-cell response (>1% above background) against the N, M and S proteins, whereas only five demonstrated a response against ORF3a (Fig 2C). While all cultures showed a CD8+ T cell response (>1% above background) against at least one antigen, these responses were more focused than CD4+ T-cell responses (Fig 2D). The CD8+ T-cell responses were dominated by N-specific T cells (response in 11/12 cultures) and ORF3a-specific T cells (9/12 cultures). CD8+ T cell responses to S (8/12 cultures) and M (5/12 cultures) were less frequent. To assess if responses to SARS-CoV-2 antigens could be generated from unexposed individuals, we selected ten unexposed volunteers and stimulated their PBMC with the overlapping peptide sets. No antigen-specific responses could be detected in this cohort (S3 Fig).
Fig 2

Expansion of SARS-CoV-2-specific T cells from SARS-CoV-2-convalescent individuals.

PBMC from 12 individuals who had cleared SARS-CoV-2 infection were stimulated with overlapping peptide pools corresponding to the ORF3a, N, M and S antigens of SARS-CoV-2, then cultured for 2 weeks in the presence of IL-2 (A) CD45+ cell yield was determined using Trucount tubes during the course of T-cell culture. Data represent fold expansion of T cells from each individual, relative to the total number of CD45+ cells at the start of the culture period. (B) The phenotypic characteristics of the cultured T cells were assessed using standard TBNK analysis. Data represent the proportion of CD3+CD4+ and CD3+CD8+ T cells at the time of cell harvest. Cultured T cells were stimulated with the ORF3a, N, M and S (S-1 and S-2) overlapping peptide pools, then assessed for IFN-γ production using an intracellular cytokine assay. (C) Data represent the frequency of antigen-specific CD4+ T cells in response to each overlapping peptide pool, following subtraction of the background response in the no-peptide control. (D) Data represent the frequency of antigen-specific CD8+ T cells in response to each overlapping peptide pool, following subtraction of the background response in the no-peptide control. The response to the S protein was determined by combining the responses to the S-1 and S-2 pools. (E) Calendar plots represent the proportion of the total antigen-specific CD4+ T cells from each participant that produced each effector function. (F) Calendar plots represent the proportion of the total antigen-specific CD8+ T cells from each participant that produced each effector function. (G) HEK293 cells and (H) a human fibroblast cell line (F#62) were seeded in an E-plate overnight, then pulsed with the ORF3a, N, M and S peptide pools separately. T cells from Q-029, Q-003 and Q-041 were added to the corresponding HLA-matched targets at a 1:1 effector-to-target ratio. The proliferative index of the cells was acquired using the RTCA system for 72 hours. Cytolysis of the target cell lines with and without antigen was calculated based on the RTCA system specification. Data represent the mean deviation of cytolysis from three replicates for Q-029 T-cell lysis of HEK293 cells (G) and Q-026 T-cell lysis of F#62 fibroblasts.

Expansion of SARS-CoV-2-specific T cells from SARS-CoV-2-convalescent individuals.

PBMC from 12 individuals who had cleared SARS-CoV-2 infection were stimulated with overlapping peptide pools corresponding to the ORF3a, N, M and S antigens of SARS-CoV-2, then cultured for 2 weeks in the presence of IL-2 (A) CD45+ cell yield was determined using Trucount tubes during the course of T-cell culture. Data represent fold expansion of T cells from each individual, relative to the total number of CD45+ cells at the start of the culture period. (B) The phenotypic characteristics of the cultured T cells were assessed using standard TBNK analysis. Data represent the proportion of CD3+CD4+ and CD3+CD8+ T cells at the time of cell harvest. Cultured T cells were stimulated with the ORF3a, N, M and S (S-1 and S-2) overlapping peptide pools, then assessed for IFN-γ production using an intracellular cytokine assay. (C) Data represent the frequency of antigen-specific CD4+ T cells in response to each overlapping peptide pool, following subtraction of the background response in the no-peptide control. (D) Data represent the frequency of antigen-specific CD8+ T cells in response to each overlapping peptide pool, following subtraction of the background response in the no-peptide control. The response to the S protein was determined by combining the responses to the S-1 and S-2 pools. (E) Calendar plots represent the proportion of the total antigen-specific CD4+ T cells from each participant that produced each effector function. (F) Calendar plots represent the proportion of the total antigen-specific CD8+ T cells from each participant that produced each effector function. (G) HEK293 cells and (H) a human fibroblast cell line (F#62) were seeded in an E-plate overnight, then pulsed with the ORF3a, N, M and S peptide pools separately. T cells from Q-029, Q-003 and Q-041 were added to the corresponding HLA-matched targets at a 1:1 effector-to-target ratio. The proliferative index of the cells was acquired using the RTCA system for 72 hours. Cytolysis of the target cell lines with and without antigen was calculated based on the RTCA system specification. Data represent the mean deviation of cytolysis from three replicates for Q-029 T-cell lysis of HEK293 cells (G) and Q-026 T-cell lysis of F#62 fibroblasts. CD4+ and CD8+ T cells displayed a consistent polyfunctional profile, irrespective of the antigen specificity. CD4+ T cells had consistent expression of TNF, with the majority also expressing IFN-γ, and a high proportion were triple positive for the expression of IFN-γ, TNF and IL-2 (Fig 2E). However, as is evident for most virus-specific T-cell populations, CD4+ T cells displayed little evidence of degranulation (CD107a). Conversely, the majority of SARS-CoV-2-specific CD8+ T cells degranulated and produced IFN-γ and TNF (Fig 2F). A median of 22% (range: 8.8–49.3%) of specific CD8+ T cells produced all four cytokines. These observations are consistent with our recent findings in T cells generated for adoptive cellular therapy in other settings of human viral disease [3]. To demonstrate that SARS-CoV-2-specific T cells display cytotoxic potential against HLA-matched targets, we performed a real-time killing assay using the xCELLigence platform. Target cells, HEK293 (A*02:01, A*03:01, B*07:02, B*08:01, C*07:02, DRB1*15:01, DQB1*06:02) and F#62 (A*02:01, B*40:01, B*44, C*03, C*07), were adhered to xCELLigence plates overnight then pulsed with single-antigen overlapping peptide pools or left unpulsed. HLA-matched SARS-CoV-2-specific T cells were added to the target cells and killing was assessed over a 24 hour period. Two T-cell cultures were assessed, and both showed evidence of target-specific killing associated with antigen specificity of the culture. T cells from participant Q-029 killed HEK293 cells pulsed with N and S (Fig 2G), while participant Q-026’s T cells induced lysis of the F#62 primary human fibroblast cell line pulsed with peptides from N, M and S antigens (Fig 2H). These observations demonstrate that SARS-CoV-2-specific T cells display functional characteristics typically associated with other in vitro-expanded antigen-specific T-cell therapy products. To assess the profile of SARS-CoV-2-specific T cells, we employed an antibody panel designed to assess phenotypic (CD27, CD28, CD45RA and CD57), transcriptional (T-bet and Eomes) and functional (granzyme B and perforin) properties. The markers were selected to define T cells with an effector profile characterized by high expression of granzyme B, perforin, T-bet and Eomes, evidence of senescence using CD57, and presence of co-stimulatory markers CD27 and CD28. To define antigen-specific T cells, expanded T cells were stimulated with peptides from ORF3a, N, M or S antigen, then assessed for the expression of TNF (S4 Fig). TNF-expressing T cells from positive cultures were concatenated into a single file and t-SNE analysis employed to define distinct populations of T cells (Fig 3A). This analysis revealed four distinct populations, including an effector CD8+ T-cell population (population 1) co-expressing T-bet, Eomes, granzyme B, perforin and CD27, and three distinct populations of CD4+ T cells that all expressed CD28, but displayed differential expression of Eomes, T-bet and CD57. Deconvolution of the samples revealed that while ORF3a- and N-specific T-cell populations contained both effector CD8+ T cells and CD4+ T cells, M- and S-specific T-cell populations were consistently dominated by CD4+ Eomeslo T-bet+ CD28+ T cells (population 4). The M- and S-specific T cells also included two lower-frequency populations, which were likely to be poorly differentiated (population 2, CD4+ CD28+) and terminally differentiated (population 3, CD4+ Eomeslo T-bet+ CD28+ CD57+) CD4+ T cells (Fig 3B).
Fig 3

Phenotypic profile of SARS-CoV-2-specific T cells.

SARS-CoV-2 peptide pool-stimulated T cells from responding donors (>1% IFN-γ+) were assessed for expression of TNF. TNF-expressing T cells were given a sample number, concatenated into a single file and t-SNE analysis performed. (A) Dot plot represents the gating strategy used to define four distinct T-cell populations following t-SNE analysis. Histograms represent marker expression in each of the four populations. (B) Samples were separated based on sample ID and the proportion of antigen-specific T cells in each population was determined. Data represent the proportion of T cells in each population following stimulation with ORF3a, N, M and S.

Phenotypic profile of SARS-CoV-2-specific T cells.

SARS-CoV-2 peptide pool-stimulated T cells from responding donors (>1% IFN-γ+) were assessed for expression of TNF. TNF-expressing T cells were given a sample number, concatenated into a single file and t-SNE analysis performed. (A) Dot plot represents the gating strategy used to define four distinct T-cell populations following t-SNE analysis. Histograms represent marker expression in each of the four populations. (B) Samples were separated based on sample ID and the proportion of antigen-specific T cells in each population was determined. Data represent the proportion of T cells in each population following stimulation with ORF3a, N, M and S.

Broad HLA restriction of SARS-CoV-2-specific T cells

A critical aspect of any allogeneic T-cell bank is the ability to provide broad HLA coverage to allow administration to a diverse cross-section of the population. To define the HLA class I restriction of the SARS-CoV-2-specific T cells, we took advantage of a library of HLA-deficient K562 cells transfected with single HLA class I alleles (S1 Table). To define HLA class II restriction, we used a combination of HLA-deficient T2 cells transfected with HLA-DR alleles and Epstein–Barr virus-transformed lymphoblastoid cell lines (EBV-LCL) matched for single HLA-DR alleles with the T cells. Untransfected K562/T2 cells or HLA-mismatched EBV-LCL were used as controls. The target cells were pulsed with the overlapping peptide pools and used as antigen-presenting cells to HLA-matched SARS-CoV-2-specific T cells, and an intracellular IFN-γ assay was used to detect activation of CD4+ or CD8+ T cells. Representative analysis of IFN-γ production from a single donor’s T cells is shown in Fig 4. This donor (Q-003) demonstrated HLA class I-restricted T cells via HLA-A*01:01 (ORF3a) and HLA-B*35:01 (N), with no presentation by HLA class I-deficient cells (Fig 4A). HLA class II restriction of N-specific CD4+ T cells was via HLA-DRB1*04:01, while the S-specific CD4+ T cells were restricted via both HLA-DRB1*03:01 and HLA-DRB1*04:01 (Fig 4B). The M-specific response in this donor did not reach the 1% above background threshold. A summary of the HLA restrictions detected in all T cells is provided in Fig 4C and S2 Table. From the 12 donors, we were able to identify HLA class I-restricted T cells recognizing 7 alleles, and HLA class II-restricted T cells recognizing 13 alleles, including the highly conserved DRB3*02:02 allele. HLA coverage analysis using the Immune Epitope Database (IEDB; www.iedb.org) revealed that these T cells could potentially provide 77.63% HLA class I coverage, 87.34% HLA class II coverage and a combined coverage of 97.15% worldwide (Fig 4D). Similarly, in a cohort of 60 SARS-CoV-2-convalescent individuals and 82 unexposed healthy individuals recruited in Australia, our T cells would potentially provide 100% and 97.6% coverage respectively. These observations demonstrate the potential of a small number of T-cell products to provide broad HLA coverage.
Fig 4

HLA restriction of SARS-CoV-2-specific T cells.

SARS-CoV-2-specific T cells were exposed to HLA-matched and mismatched target cell lines (K562, PHA-blasts, T2 cells or EBV-LCL) pulsed with ORF3a, N, M and S overlapping peptide sets. T cells were assessed for activation by IFN-γ production. (A) Representative data from an HLA-restriction analysis of N- and ORF3a-specific CD8+ T cells from a single donor (Q-003). Left panels represent T cells cultured with K562, middle panels represent T cells cultured with K562-A0101 and right panels T cell cultured with K562-B3501. (B) Representative HLA-restriction analysis of N-, M- and S-specific CD4+ T cells from a single donor (Q-003). Left panels represent T cells cultured with T2, middle panels represent T cells cultured with T2-DR4 and right panels T cell cultured with T2-DR3. (C) Data represent the HLA restrictions of functional T cells detected in each culture. Responses were considered positive if >1% of CD4+ T cells or CD8+ T cells were IFN-γ+ following subtraction of the control. Blue boxes represent positive HLA class I restrictions. Red boxes represent positive HLA class II restrictions. (D) Based upon the HLA restrictions detected in the HLA-restriction assays, HLA coverage was determined using the IEDB database (www.iedb.org), using our full cohort of convalescent individuals (n = 60) and a cohort of unexposed individuals recruited in Queensland, Australia (n = 82).

HLA restriction of SARS-CoV-2-specific T cells.

SARS-CoV-2-specific T cells were exposed to HLA-matched and mismatched target cell lines (K562, PHA-blasts, T2 cells or EBV-LCL) pulsed with ORF3a, N, M and S overlapping peptide sets. T cells were assessed for activation by IFN-γ production. (A) Representative data from an HLA-restriction analysis of N- and ORF3a-specific CD8+ T cells from a single donor (Q-003). Left panels represent T cells cultured with K562, middle panels represent T cells cultured with K562-A0101 and right panels T cell cultured with K562-B3501. (B) Representative HLA-restriction analysis of N-, M- and S-specific CD4+ T cells from a single donor (Q-003). Left panels represent T cells cultured with T2, middle panels represent T cells cultured with T2-DR4 and right panels T cell cultured with T2-DR3. (C) Data represent the HLA restrictions of functional T cells detected in each culture. Responses were considered positive if >1% of CD4+ T cells or CD8+ T cells were IFN-γ+ following subtraction of the control. Blue boxes represent positive HLA class I restrictions. Red boxes represent positive HLA class II restrictions. (D) Based upon the HLA restrictions detected in the HLA-restriction assays, HLA coverage was determined using the IEDB database (www.iedb.org), using our full cohort of convalescent individuals (n = 60) and a cohort of unexposed individuals recruited in Queensland, Australia (n = 82).

Conservation of SARS-CoV-2 epitopes and T-cell recognition of cells infected with multiple variants of SARS-CoV-2

With the continual emergence of novel variants of concern, the efficacy of cellular therapy could be impacted by changes in epitope sequences. To compare epitope sequences, where possible we determined the immunodominant epitopes that corresponded with the HLA restrictions in each of the expanded T-cell populations (S5 Fig). These T-cell epitope sequences were then compared across the variants of concern (Table 2). We noted a high level of conservation in these determinants, including in the recently emerged Omicron variant. Of the 22 epitopes defined in our study, no evidence of mutation was evident in the Alpha, Beta, Gamma or Delta strains. This is consistent with previous studies on T-cell epitopes in SARS-CoV-2. We noted amino acid changes in three epitopes in the Omicron strain, suggesting the potential for escape from our T cells if patients are exposed to Omicron. While it is not yet clear if these changes render T cells less efficient, they suggest that a polyclonal approach targeting multiple antigens and epitopes will provide the most effective T-cell immunotherapy strategy against emerging variants.
Table 2

Conservation of SARS-CoV-2 epitopes in variants of concerns.

D641GAlphaBetaGammaDeltaOmicron
FTSDYYQLY (FTS)FTSDYYQLYFTSDYYQLYFTSDYYQLYFTSDYYQLYFTSDYYQLY
YFTSDYYQLY (YFT)YFTSDYYQLYYFTSDYYQLYYFTSDYYQLYYFTSDYYQLYYFTSDYYQLY
RIRGGDGKM (RIR)RIRGGDGKMRIRGGDGKMRIRGGDGKMRIRGGDGKMRIRGGDGKM
SPRWYFYYL (SPR)SPRWYFYYLSPRWYFYYLSPRWYFYYLSPRWYFYYLSPRWYFYYL
KPRQKRTAT (KPR)KPRQKRTATKPRQKRTATKPRQKRTATKPRQKRTATKPRQKRTAT
MEVTPSGTWL (MEV)MEVTPSGTWLMEVTPSGTWLMEVTPSGTWLMEVTPSGTWLMEVTPSGTWL
TPSGTWLTY (TPS)TPSGTWLTYTPSGTWLTYTPSGTWLTYTPSGTWLTYTPSGTWLTY
YLQPRTFLL (YLQ)YLQPRTFLLYLQPRTFLLYLQPRTFLLYLQPRTFLLYLQPRTFLL
YFPLQSYGF (YFP)YFPLQSYGFYFPLQSYGFYFPLQSYGFYFPLQSYGFYFPLRSYSF
NFRVQPTESIVRFPN (NFR)NFRVQPTESIVRFPNNFRVQPTESIVRFPNNFRVQPTESIVRFPNNFRVQPTESIVRFPNNFRVQPTESIVRFPN
GIIWVATEGALNTPK (GII)GIIWVATEGALNTPKGIIWVATEGALNTPKGIIWVATEGALNTPKGIIWVATEGALNTPKGIIWVATEGALNTPK
NCTFEYVSQPFLMDL (NCT)NCTFEYVSQPFLMDLNCTFEYVSQPFLMDLNCTFEYVSQPFLMDLNCTFEYVSQPFLMDLNCTFEYVSQPFLMDL
SKRSFIEDLLFNKVT (SKR)SKRSFIEDLLFNKVTSKRSFIEDLLFNKVTSKRSFIEDLLFNKVTSKRSFIEDLLFNKVTSKRSFIEDLLFNKVT
LTDEMIAQYTSALLA (LTD)LTDEMIAQYTSALLALTDEMIAQYTSALLALTDEMIAQYTSALLALTDEMIAQYTSALLALTDEMIAQYTSALLA
MIAQYTSALLAGTIT (MIA)MIAQYTSALLAGTITMIAQYTSALLAGTITMIAQYTSALLAGTITMIAQYTSALLAGTITMIAQYTSALLAGTIT
CSNLLLQYGSFCTQL (CSN)CSNLLLQYGSFCTQLCSNLLLQYGSFCTQLCSNLLLQYGSFCTQLCSNLLLQYGSFCTQLCSNLLLQYGSFCTQL
AALALLLLDRLNQLE (AAL)AALALLLLDRLNQLEAALALLLLDRLNQLEAALALLLLDRLNQLEAALALLLLDRLNQLEAALALLLLDRLNQLE
LLQYGSFCTQLNRAL (LLQ)LLQYGSFCTQLNRALLLQYGSFCTQLNRALLLQYGSFCTQLNRALLLQYGSFCTQLNRALLLQYGSFCTQLKRAL
GYYRRATRRIRGGDG (GYY)GYYRRATRRIRGGDGGYYRRATRRIRGGDGGYYRRATRRIRGGDGGYYRRATRRIRGGDGGYYRRATRRIRGGDG
LRGHLRIAGHHLGRC (LRG)LRGHLRIAGHHLGRCLRGHLRIAGHHLGRCLRGHLRIAGHHLGRCLRGHLRIAGHHLGRCLRGHLRIAGHHLGRC
TLVKQLSSNFGAISS (TLV)TLVKQLSSNFGAISSTLVKQLSSNFGAISSTLVKQLSSNFGAISSTLVKQLSSNFGAISSTLVKQLSSKFGAISS
AVYRINWITGGIAIA (AVY)AVYRINWITGGIAIAAVYRINWITGGIAIAAVYRINWITGGIAIAAVYRINWITGGIATAAVYRINWITGGIAIA
To determine if in vitro-expanded T cells could recognize different variants of SARS-CoV-2, we infected HEK293-ACE2/TMPRSS2 cells (A*02:01, B*07:02, DRB1*15:01) with serial dilutions of the D614G, Alpha and Beta variants. Two hours after infection, HLA-matched SARS-CoV-2-specific T cells from Q-029 (which included A*02:01-, B*07:02- and DRB1*15:01-restricted virus-specific T cells) were added to the infected and mock-infected cells and incubated for 48 hours. Supernatant was harvested and assessed for IFN-γ production by ELISA. We detected IFN-γ secretion following incubation of the Q-029 T cells with all three viral variants (Fig 5), while no IFN-γ was detected following co-culture with the mock-infected cells. These observations are consistent with our in vitro killing assessment of Q-029 T cells, using peptide-pulsed HEK293 cells as targets, and suggest that the recognition of conserved epitopes by SARS-CoV-2-specific T cells has the potential to provide a second line of defense against viral escape from the humoral immune response.
Fig 5

Recognition of multiple SARS-CoV-2 variants by T cells generated for adoptive therapy.

HEK293T cells expressing ACE2 and TMPRSS2 were infected in duplicate with serial dilutions of the D614G, Alpha and Beta SARS-CoV-2 variants. Two hours after infection, T cells generated from donor Q-029 were added to duplicate wells containing infected and mock-infected HEK293 cells at a ratio of 10:1. Cells were incubated for 48 hours and then supernatants were assessed for IFN-γ using a standard ELISA. IFN-γ concentration was interpolated from a standard curve using sigmoidal nonlinear regression in GraphPad Prism.

Recognition of multiple SARS-CoV-2 variants by T cells generated for adoptive therapy.

HEK293T cells expressing ACE2 and TMPRSS2 were infected in duplicate with serial dilutions of the D614G, Alpha and Beta SARS-CoV-2 variants. Two hours after infection, T cells generated from donor Q-029 were added to duplicate wells containing infected and mock-infected HEK293 cells at a ratio of 10:1. Cells were incubated for 48 hours and then supernatants were assessed for IFN-γ using a standard ELISA. IFN-γ concentration was interpolated from a standard curve using sigmoidal nonlinear regression in GraphPad Prism.

Generation of clinical-grade SARS-CoV-2-specific T cells

Our preclinical observations demonstrated that we had developed a robust approach to generate SARS-CoV-2-specific T cells across a broad range of HLA types. To refine our approach for clinical manufacture, we custom-designed two peptide pools based upon T-cell epitopes defined from our larger cohort of 60 volunteers. The first pool contains 32 peptides of 8–11 amino acids in length that encode a panel of defined CD8+ T cell epitopes from SARS-CoV-2 antigens (S3 Table), while the second contains 52 peptides of 15 amino acids in length that encode CD4+ T cell epitopes (S4 Table). Following validation that the peptide pools could expand both SARS-CoV-2-specific CD4+ and CD8+ T cells in the laboratory from convalescent donor blood samples collected 12 months after infection (S6 Fig), we generated two clinical-grade lots of SARS-CoV-2-specific T cells (THI-COV-002 and THI-COV-003) under Good Manufacturing Practice conditions at Q-Gen Cell Therapeutics. T cells were expanded following stimulation with the SARS-CoV-2 CD4+ and CD8+ peptide pools, and assessed for cell yield, phenotype and viability using standard TBNK analysis every 3–4 days. T cells were assessed for antigen specificity and cryopreserved (110 vials at 4 × 107 cells/vial) after 14 days in culture. Both cell products displayed similar cell expansion kinetics (Fig 6A), with a mean 40-fold expansion after 14 days. Similarly to our earlier analyses (Fig 2B), THI-COV-002 and THI-COV-003 were dominated by CD4+ T cells, with lower frequencies of CD8+ T cells in each product (Fig 6B). While SARS-CoV-2-specific CD4+ and CD8+ T cells are capable of generating multiple cytokines (Fig 6C), SARS-CoV-2-specific CD4+ T cells in both products (Fig 6D and 6E) displayed preferential production of TNF and limited degranulation, whereas CD8+ T cells displayed a consistent polyfunctional profile characterized by equivalent production of TNF, IFN-γ and CD107a. CD8+ T cells in THI-COV-002 preferentially recognized the HLA-A*02:01-restricted YLQ (S-encoded) and LLY (ORF3A-encoded) epitopes, while CD8+ T cells in THI-COV-003 were dominated by T cells recognizing the HLA-B*07:02-restricted SPR (N-encoded) epitope. These observations demonstrate the feasible translation of SARS-CoV-2-specific T cell expansion for clinical manufacture.
Fig 6

Clinical-grade manufacture of SARS-CoV-2-specific T cells.

Two SARS-CoV-2-convalescent volunteers donated 400 mL of blood via venesection. PBMC were isolated from the blood and cryopreserved. Cryopreserved PBMC were thawed and stimulated with the custom-designed SARS-CoV-2 CD4 and CD8 peptide pools, then cultured for 14 days in the presence of IL-2 to generate T cell products THI-COV-002 and THI-COV-003. On day 14, cells were cryopreserved for future clinical use. Cultured cells were counted and phenotyped on days 7, 11 and 14 using a standard TBNK assessment. (A) Data represent the number of viable CD45+ cells at each time point. (B) Data represent the proportion of CD3+, CD3+CD8+ and CD3+CD4+ T cells at each time point. On the day of harvest, a polyfunctional intracellular cytokine assay was performed to assess specificity towards the CD4 and CD8 peptide pools and HLA class I-matched CD8+ T cell epitopes. (C) Data represent t-SNE analysis of concatenated CD4+ and CD8+ T cells from triplicate samples stimulated with CD4 or CD8 peptide pools, overlaid with the expression of CD107a, IFN-γ, TNF or IL-2. (D) Data represent the proportion of CD4+ T cells producing cytokines in response to the CD4 peptide pool or CD8+ T cells producing cytokines in response to the CD8 peptide pool or individual HLA-matched peptide epitopes. Error bars represent standard deviation from triplicate cultures.

Clinical-grade manufacture of SARS-CoV-2-specific T cells.

Two SARS-CoV-2-convalescent volunteers donated 400 mL of blood via venesection. PBMC were isolated from the blood and cryopreserved. Cryopreserved PBMC were thawed and stimulated with the custom-designed SARS-CoV-2 CD4 and CD8 peptide pools, then cultured for 14 days in the presence of IL-2 to generate T cell products THI-COV-002 and THI-COV-003. On day 14, cells were cryopreserved for future clinical use. Cultured cells were counted and phenotyped on days 7, 11 and 14 using a standard TBNK assessment. (A) Data represent the number of viable CD45+ cells at each time point. (B) Data represent the proportion of CD3+, CD3+CD8+ and CD3+CD4+ T cells at each time point. On the day of harvest, a polyfunctional intracellular cytokine assay was performed to assess specificity towards the CD4 and CD8 peptide pools and HLA class I-matched CD8+ T cell epitopes. (C) Data represent t-SNE analysis of concatenated CD4+ and CD8+ T cells from triplicate samples stimulated with CD4 or CD8 peptide pools, overlaid with the expression of CD107a, IFN-γ, TNF or IL-2. (D) Data represent the proportion of CD4+ T cells producing cytokines in response to the CD4 peptide pool or CD8+ T cells producing cytokines in response to the CD8 peptide pool or individual HLA-matched peptide epitopes. Error bars represent standard deviation from triplicate cultures.

Discussion

Emerging evidence suggests that T cells play an important role in the prevention of COVID-19 [10,12,13]. Adoptive cellular immunotherapy with SARS-CoV-2-specific T cells may provide an effective mechanism to control COVID-19. In this study, we have demonstrated a robust approach to the generation of SARS-CoV-2-specific T cells from convalescent individuals. Importantly, we have shown that these T cells display consistent functional properties that are typical of human virus-specific T cells [3,23,24]. We also extend on recent observations [25,26], demonstrating that a small cohort of volunteers can provide greater than 95% worldwide population coverage and that these T cells are capable of recognizing cells infected with multiple viral variants. These observations provide optimism that SARS-CoV-2-specific T cell products will be therapeutically beneficial, irrespective of the infecting strain. Ongoing vaccination programs will have a profound impact upon the incidence of COVID-19 in the next few years [14,15]. However, it is not clear if vaccination will prevent the continued worldwide transmission of SARS-CoV-2, and it is likely that some individuals, particularly immunocompromised patients and the elderly, will remain susceptible to COVID-19 [27,28]. Considering the ineffectiveness of current anti-viral therapies and the potential for immune escape from antibody-based immunotherapies due to the development of novel mutations [29,30], other therapeutic options are needed. T cells that target more conserved regions of SARS-CoV-2 offer some advantages over sera and monoclonal antibodies and are currently being investigated by a number of groups as a potential therapeutic option for COVID-19 [26]. Virus-specific T-cell immunotherapies, which are currently in phase II and III studies, have emerged as an effective means to treat virus-associated complications, particularly against persistent viruses in transplant patients with compromised immunity [2,4]. While there is less evidence for their efficacy in humans against respiratory viruses, for which clinical trials have been limited to adenoviral infections [31], studies in mice have shown that adoptive therapy with CD8+ and/or CD4+ T cells can efficiently control respiratory infections, including in models of SARS-CoV-1 [32-34]. One limitation associated with the broad application of anti-viral T-cell immunotherapy is the time required to generate autologous T cells, which would likely preclude their use in settings of acute respiratory infections that induce disease rapidly. However, recent success in the application of HLA-matched, off-the-shelf, banked T cells for the treatment of a number of viral complications suggests that a similar strategy could be used in the setting of COVID-19 [8,31,35]. Our observations that T cells can be generated from a small cohort of convalescent individuals to cover a large percentage of the population suggest that the manufacture of a similar repository of SARS-CoV-2-specific T cells is feasible. Other groups have also developed approaches for a T-cell immunotherapy approach to COVID-19 [36-38], with the first case report of a heart transplant patient who received SARS-CoV-2 specific T cell therapy recently published [39]. This study shows clear evidence of immunodominant hierarchies in SARS-CoV-2-specific CD8+ T cells. The immunodominant hierarchies have the potential to impact the therapeutic benefit in a portion of future recipients. While we saw immunodominance of T cells restricted via HLA-B*07:02, HLA-B*35:01, HLA-B*40:01 and HLA-A*29:01, we noted a generally poor anti-SARS-CoV-2 response via HLA-A*02:01. This is consistent with recent reports on HLA-A*02:01-restricted T cell responses in COVID-19 patients [40]. Similarly, we saw only limited reactivity through HLA-A*24:02, a common allele worldwide, and did not identify responses via other common HLA class I alleles, including HLA-A*03:01 and HLA-A*11:01. These observations are likely a consequence of bias in the ethnicity and HLA types of our donor cohort and suggest that broadening the HLA class I coverage of our T-cell bank will require assessment of T-cell responses in a more HLA class I-diverse cohort of convalescent individuals. In contrast, we saw less evidence of this bias in the CD4+ T-cell response, and were able to demonstrate broader HLA class II restriction, particularly against alleles that are dominant worldwide. The role that adoptive T-cell immunotherapy will play as a treatment option for COVID-19 remains to be determined. However, our observations demonstrate a robust approach for the generation of HLA-diverse SARS-CoV-2-specific T cells from convalescent individuals, providing the impetus for the production of clinical-grade material and further assessment in clinical trials.

Materials and methods

Ethics statement

This study was performed according to the principles of the Declaration of Helsinki. Ethics approval to undertake the research was obtained from the QIMR Berghofer Medical Research Institute Human Research Ethics Committee. Written informed consent was obtained from all participants.

Study participants

The inclusion criteria for the study were that participants were over the age of 18, had been clinically diagnosed by PCR with SARS-CoV-2 infection, and had subsequently been released from isolation following resolution of symptomatic infection. A total of 60 participants were assessed in this study. Blood samples were collected from all participants and peripheral blood mononuclear cells (PBMC) were isolated and cryopreserved. HLA typing was performed on each donated sample. The HLA types of study participants are provided in Table 1.

Expansion of SARS-CoV-2-specific T cells

Cryopreserved PBMC were rapidly thawed, then one-third incubated with peptide pools containing 15-mer peptides with 11 amino acid overlap corresponding to ORF3a (PM-WCPV-APA3-1), nucleocapsid (N; PM-WCPV-NCAP-1), membrane (M, PM-WCPV-VME-1) and spike (S, PM-WCPV-S-1) protein sequences from SARS-CoV-2 (JPT Technologies). For clinical-grade manufacture, two custom peptide pools containing defined CD8+ and CD4+ T cell epitopes (Mimotopes) were used. PBMC were washed, then mixed with the remaining cognate PBMC and seeded at a density of between 2 and 3 × 106 cells/cm2 in G-Rex 6-well culture plates (Wilson Wolf). Cells were grown in RPMI supplemented with 5% human AB serum at 37°C/6.5% CO2/95% relative humidity. Recombinant IL-2 (120 IU/mL) was added on day 3 and supplemented every 2–3 days thereafter. On days 7 and 11, cultured cells were phenotyped and enumerated using the Multitest 6-Color TBNK Reagent (BD Biosciences), and divided into wells at a density between 2 and 3 × 106 cells/cm2. On day 14, T cells were harvested, phenotyped and enumerated using the Multitest 6-Color TBNK Reagent and assessed for antigen specificity using intracellular cytokine analysis as outlined below. The remaining cells were cryopreserved in culture media with 10% dimethyl sulfoxide (WAK-Chemie Medical). Clinical-grade manufacture was performed under GMP conditions at Q-Gen Cell Therapeutics.

Intracellular cytokine assay

Cultured T cells were stimulated separately with the SARS-CoV-2 overlapping peptide pools and incubated for 4 hours at 37°C in the presence of GolgiPlug, GolgiStop and anti-CD107a-FITC (BD Biosciences). Following stimulation, cells were washed and stained with anti-CD8-PerCP-Cy5.5 (eBioscience), anti-CD4-Pacific Blue (BD Biosciences) and live/dead fixable near-IR dead cell stain (Life Technologies) for 30 minutes at 4°C before being fixed and permeabilized with Fixation/Permeabilization solution (BD Biosciences). After 20 minutes of fixation, cells were washed in BD Perm/Wash buffer (BD Biosciences) and stained with anti-IFN-γ-Alexa Fluor 700, anti-IL-2-PE and anti-TNF-APC (all from BD Biosciences) for a further 30 minutes at 4°C. Finally, cells were washed again and acquired using a BD LSRFortessa with FACSDiva software. Post-acquisition analysis, including t-distributed stochastic neighbor embedding (t-SNE), was performed using FlowJo software (TreeStar). Cytokine detection levels identified in the no-peptide control condition were subtracted from the corresponding test conditions to account for non-specific, spontaneous cytokine production. T cells were deemed reactive to an antigen if >1% of CD4+ or CD8+ T cells produced IFN-γ after subtraction of background.

Phenotypic analysis of T cells

Cultured T cells were stimulated separately with the SARS-CoV-2 overlapping peptide pools, corresponding to ORF3a, N, M and S proteins from SARS-CoV-2, and incubated at 37°C for 4 hours in the presence of GolgiPlug. Following stimulation, cells were washed and stained with anti-CD8-BV786, anti-CD4-PE-Cy7, anti-CD27-PE/Dazzle 594, anti-CD28-BV480 (BD Biosciences), anti-CD57-BV605, anti-CD45RA-FITC (BD Biosciences) and live/dead fixable near-IR dead cell stain (Life Technologies) for 30 minutes at 4°C before being fixed and permeabilized with TF Fix/Perm buffer (BD Pharmingen). After 1 hour of fixation, cells were washed in TF Perm/Wash buffer (BD Pharmingen) and stained with anti-TNF-APC (BD Biosciences), anti-Tbet-PE (eBioscience), anti-Eomes-PerCP-eFluor 710 (eBioscience), anti-Granzyme B-AF700 (BD Biosciences) and anti-Perforin-BV421 (Biolegend) for a further 30 minutes. Finally, cells were washed again and acquired using a BD LSRFortessa with FACSDiva software. Post-acquisition analysis was performed using FlowJo software (TreeStar). Gating analysis for the detection of antigen-specific TNF-producing cells is outlined in S1 Fig. TNF-producing cells from positive assays were then concatenated and t-SNE analysis was performed using the following parameters (Eomes, T-bet, CD27, CD28, CD57, granzyme B and perforin).

HLA-restriction assay

Cryopreserved T cells were thawed in RPMI containing 10% fetal bovine serum and recombinant IL-2 (120 IU/mL), and incubated overnight at 37°C prior to use. Target cell lines, including single HLA-transfected K562 and T2 cells, and EBV-LCL (S1 Table), were thawed and incubated overnight in RPMI containing 10% fetal bovine serum. Target cells were incubated with individual SARS-CoV-2 overlapping peptide pools for 1 hour at 37°C, then washed to remove excess peptide. T cells were incubated with either HLA-matched peptide-pulsed or unpulsed target cells at a ratio of 10:1 for 4 hours in the presence of GolgiPlug. Peptide-pulsed and unpulsed HLA-deficient K562 or T2 cells, or HLA-mismatched EBV-LCL, were used as controls. Following stimulation, cells were washed and stained with anti-CD8-PerCP-Cy5.5 (eBioscience), anti-CD3-APC anti-CD4-FITC and live/dead fixable near-IR dead cell stain for 30 minutes at 4°C before being fixed and permeabilized with BD Fixation/Permeabilization solution (BD Biosciences). After 20 minutes of fixation, cells were washed in BD Perm/Wash buffer (BD Biosciences) and stained with anti-IFN-γ-PE for a further 30 minutes. Cells were washed again and acquired using a BD LSRFortessa with FACSDiva software. Post-acquisition analysis was performed using FlowJo software (TreeStar). Cytokine detection levels identified in the no-peptide control condition were subtracted from the corresponding test conditions to account for non-specific, spontaneous cytokine production. T cells were deemed restricted via an HLA molecule if >1% of CD4+ or CD8+ T cells produced IFN-γ after subtraction of background.

Real-time T-cell killing assay

The xCELLigence RTCA MP Instrument (ACEA Biosciences) method was used to measure the cytotoxic potential of SARS-CoV-2-specific cells. Targets were seeded at a density of 5 × 104 (HEK293) or 1 × 104 (IFN-γ-activated primary fibroblast F#62) cells per well of the E-plate in RPMI containing 10% fetal bovine serum. The plates were kept in the incubator for 30 minutes and then transferred to the instrument inside a 37°C incubator. Data were collected at 30-minute intervals for the entirety of the assay. Following overnight incubation, target cells were pulsed with 1 μg/mL of one individual SARS-CoV-2 overlapping peptide antigen, then incubated for 1 hour at 37°C. Cells were washed to remove excess peptide, followed by the addition of T cells at an effector:target ratio of 5:1. The E-plates were kept in the laminar flow cabinet for 30 minutes before being transferred to the RTCA instrument. Data acquisition was resumed, and the cell index value was measured for 24 hours.

Recognition of HEK293-ACE2 cells infected with multiple isolates of SARS-CoV-2

HEK-293T that stably express ACE2 and TMPRSS2 were kindly provided by Dr Giuseppe Baliatreri [41]. Cells were infected with serial dilutions of a D614G variant, hCoV-19/Australia/QLDID935/2020 (QLD935; GISAID accession EPI_ISL_436097), an alpha variant, hCoV-19/Australia/ QLD1517/2020 (QLS1517; GISAID accession EPI_ISL_944644), or a beta variant, hCoV-19/Australia/QLD1520/2020 (QLD1520; GISAID accession EPI_ISL_968081), or were mock infected. SARS-CoV-2 isolates were kindly provided by Queensland Health Forensic and Scientific Services. All work with infectious SARS-CoV-2 was performed under BSL3 conditions. Two hours later, in vitro-expanded SARS-CoV-2-specific T cells were added at a responder to stimulator ratio of 10:1. Cells were co-incubated for 48 hours, then supernatant harvested. The concentration of released IFN-γ was determined using the IFN-γ (human) AlphaLISA Detection Kit (PerkinElmer, Waltham, MA) as per manufacturer’s instructions. IFN-γ concentration was interpolated from a standard curve using sigmoidal nonlinear regression in GraphPad Prism. 8.2.1 (San Diego, CA).

Statistical analysis

GraphPad Prism 8.2.1 (San Diego, CA) was used to perform statistical analysis.

Representative analysis of cytokine production by SARS-CoV-2-specific CD4+ T cells.

(TIF) Click here for additional data file.

Representative analysis of cytokine production by SARS-CoV-2 specific CD8+ T cells.

(TIF) Click here for additional data file.

Expansion of SARS-CoV-2 specific T cells in SARS-CoV-2-unexposed individuals.

(TIF) Click here for additional data file.

Gating strategy used to identify SARS-CoV-2-specific T cells by TNF expression.

(TIF) Click here for additional data file.

Summary of peptide epitope responses in T cells from convalescent participants.

The three-letter code and antigen for each HLA-restricted epitope is provided, where defined. (TIF) Click here for additional data file.

Laboratory assessment of SARS-CoV-2 CD4 and CD8 peptide pools.

(A) Panels represent ICS analysis of expanded T cells from three donors recalled with and without the custom-designed SARS-CoV-2 peptide pools. (B) Comparison of SARS-CoV-2 specificity following expansion with either the overlapping peptide pools (OPP) or defined CD4 and CD8 peptide pools (Epitopes). (TIF) Click here for additional data file.

Target cells used in the HLA-restriction assay.

(DOCX) Click here for additional data file.

Summary of HLA-restriction analysis.

(DOCX) Click here for additional data file.

SARS-CoV-2 CD8 Peptide Pool.

(DOCX) Click here for additional data file.

SARS-CoV-2 CD4 Peptide Pool.

(DOCX) Click here for additional data file. 17 Dec 2021 Submitted filename: Response to previous submission.docx Click here for additional data file. 27 Jan 2022 Dear Dr. Smith, Thank you very much for submitting your manuscript "SARS-CoV-2-specific T cells generated for adoptive immunotherapy are capable of recognizing multiple SARS-CoV-2 variants" for consideration at PLOS Pathogens. As with all papers reviewed by the journal, your manuscript was reviewed by members of the editorial board and by several independent reviewers. The reviewers appreciated the attention to an important topic. Based on the reviews, we are likely to accept this manuscript for publication, providing that you modify the manuscript according to the review recommendations. The authors addressed the previous reviewers comments and the manuscript is substantially improved. Reviewer 1 has concerns about lack of novelty, but given the ongoing COVID19 pandemic, this work contributes to the wider field of understanding T cell responses to SARS-CoV-2. Please address the comments from Reviewer 1 regarding addition of latest references. Please prepare and submit your revised manuscript within 30 days. If you anticipate any delay, please let us know the expected resubmission date by replying to this email. When you are ready to resubmit, please upload the following: [1] A letter containing a detailed list of your responses to all review comments, and a description of the changes you have made in the manuscript. Please note while forming your response, if your article is accepted, you may have the opportunity to make the peer review history publicly available. The record will include editor decision letters (with reviews) and your responses to reviewer comments. If eligible, we will contact you to opt in or out [2] Two versions of the revised manuscript: one with either highlights or tracked changes denoting where the text has been changed; the other a clean version (uploaded as the manuscript file). Important additional instructions are given below your reviewer comments. Thank you again for your submission to our journal. We hope that our editorial process has been constructive so far, and we welcome your feedback at any time. Please don't hesitate to contact us if you have any questions or comments. Sincerely, Amy L Hartman, PhD Associate Editor PLOS Pathogens Shin-Ru Shih Section Editor PLOS Pathogens Kasturi Haldar Editor-in-Chief PLOS Pathogens ​orcid.org/0000-0001-5065-158X Michael Malim Editor-in-Chief PLOS Pathogens orcid.org/0000-0002-7699-2064 *********************** The authors addressed the previous reviewers comments and the manuscript is substantially improved. Reviewer 1 has concerns about lack of novelty, but given the ongoing COVID19 pandemic, this work contributes to the wider field of understanding T cell responses to SARS-CoV-2. Please address the comments from Reviewer 1 regarding addition of latest references. Reviewer Comments (if any, and for reference): Reviewer's Responses to Questions Part I - Summary Please use this section to discuss strengths/weaknesses of study, novelty/significance, general execution and scholarship. Reviewer #1: The authors present a revised version that is substantially improved from the original submission describing an off-the=-shelf heterologous T cell therapeutic for COVID-19. It is still my opinion that the notion of using heterologous T cell therapy as a viable means to treat COVID-19 is a bit limited in actual practicallity and potential utility. Nevertheless, the authors make a good case for potential, and adequately addressed the issues previously raised by the reviewers. Unfortunately, the study still lacks novelty, and the idea of using heterologous T cells for SARS-CoV-2 is not far off of using this approach for other viruses, and it is a mere incremental advancement to target this current hot viral target. Moreover, others have unfortunatly already published similar papers covering the same idea, diminishing the value of this new report. ********** Part II – Major Issues: Key Experiments Required for Acceptance Please use this section to detail the key new experiments or modifications of existing experiments that should be absolutely required to validate study conclusions. Generally, there should be no more than 3 such required experiments or major modifications for a "Major Revision" recommendation. If more than 3 experiments are necessary to validate the study conclusions, then you are encouraged to recommend "Reject". Reviewer #1: There are a number of papers that have come out in the past year, some of them more recently, that probably should now be acknowledged in the text and and properly cited in the manuscript. I've listed the PMID numbers: PMID: 33718360; PMID: 33905481; PMID: 34910857, PMID: 35003063 ********** Part III – Minor Issues: Editorial and Data Presentation Modifications Please use this section for editorial suggestions as well as relatively minor modifications of existing data that would enhance clarity. Reviewer #1: (No Response) ********** PLOS authors have the option to publish the peer review history of their article (what does this mean?). If published, this will include your full peer review and any attached files. If you choose “no”, your identity will remain anonymous but your review may still be made public. Do you want your identity to be public for this peer review? For information about this choice, including consent withdrawal, please see our Privacy Policy. Reviewer #1: No Figure Files: While revising your submission, please upload your figure files to the Preflight Analysis and Conversion Engine (PACE) digital diagnostic tool, https://pacev2.apexcovantage.com. PACE helps ensure that figures meet PLOS requirements. To use PACE, you must first register as a user. Then, login and navigate to the UPLOAD tab, where you will find detailed instructions on how to use the tool. If you encounter any issues or have any questions when using PACE, please email us at figures@plos.org. Data Requirements: Please note that, as a condition of publication, PLOS' data policy requires that you make available all data used to draw the conclusions outlined in your manuscript. Data must be deposited in an appropriate repository, included within the body of the manuscript, or uploaded as supporting information. This includes all numerical values that were used to generate graphs, histograms etc.. For an example see here: http://www.plosbiology.org/article/info%3Adoi%2F10.1371%2Fjournal.pbio.1001908#s5. Reproducibility: To enhance the reproducibility of your results, we recommend that you deposit your laboratory protocols in protocols.io, where a protocol can be assigned its own identifier (DOI) such that it can be cited independently in the future. Additionally, PLOS ONE offers an option to publish peer-reviewed clinical study protocols. Read more information on sharing protocols at https://plos.org/protocols?utm_medium=editorial-email&utm_source=authorletters&utm_campaign=protocols References: Please review your reference list to ensure that it is complete and correct. If you have cited papers that have been retracted, please include the rationale for doing so in the manuscript text, or remove these references and replace them with relevant current references. Any changes to the reference list should be mentioned in the rebuttal letter that accompanies your revised manuscript. If you need to cite a retracted article, indicate the article’s retracted status in the References list and also include a citation and full reference for the retraction notice. 1 Feb 2022 Submitted filename: Response to previous submission.docx Click here for additional data file. 4 Feb 2022 Dear Dr. Smith, We are pleased to inform you that your manuscript 'SARS-CoV-2-specific T cells generated for adoptive immunotherapy are capable of recognizing multiple SARS-CoV-2 variants' has been provisionally accepted for publication in PLOS Pathogens. Before your manuscript can be formally accepted you will need to complete some formatting changes, which you will receive in a follow up email. A member of our team will be in touch with a set of requests. Please note that your manuscript will not be scheduled for publication until you have made the required changes, so a swift response is appreciated. IMPORTANT: The editorial review process is now complete. PLOS will only permit corrections to spelling, formatting or significant scientific errors from this point onwards. Requests for major changes, or any which affect the scientific understanding of your work, will cause delays to the publication date of your manuscript. Should you, your institution's press office or the journal office choose to press release your paper, you will automatically be opted out of early publication. We ask that you notify us now if you or your institution is planning to press release the article. All press must be co-ordinated with PLOS. Thank you again for supporting Open Access publishing; we are looking forward to publishing your work in PLOS Pathogens. Best regards, Amy L Hartman, PhD Associate Editor PLOS Pathogens Shin-Ru Shih Section Editor PLOS Pathogens Kasturi Haldar Editor-in-Chief PLOS Pathogens ​orcid.org/0000-0001-5065-158X Michael Malim Editor-in-Chief PLOS Pathogens orcid.org/0000-0002-7699-2064 *********************************************************** Reviewer Comments (if any, and for reference): 8 Feb 2022 Dear Dr. Smith, We are delighted to inform you that your manuscript, "SARS-CoV-2-specific T cells generated for adoptive immunotherapy are capable of recognizing multiple SARS-CoV-2 variants," has been formally accepted for publication in PLOS Pathogens. We have now passed your article onto the PLOS Production Department who will complete the rest of the pre-publication process. All authors will receive a confirmation email upon publication. The corresponding author will soon be receiving a typeset proof for review, to ensure errors have not been introduced during production. Please review the PDF proof of your manuscript carefully, as this is the last chance to correct any scientific or type-setting errors. Please note that major changes, or those which affect the scientific understanding of the work, will likely cause delays to the publication date of your manuscript. Note: Proofs for Front Matter articles (Pearls, Reviews, Opinions, etc...) are generated on a different schedule and may not be made available as quickly. Soon after your final files are uploaded, the early version of your manuscript, if you opted to have an early version of your article, will be published online. The date of the early version will be your article's publication date. The final article will be published to the same URL, and all versions of the paper will be accessible to readers. Thank you again for supporting open-access publishing; we are looking forward to publishing your work in PLOS Pathogens. Best regards, Kasturi Haldar Editor-in-Chief PLOS Pathogens ​orcid.org/0000-0001-5065-158X Michael Malim Editor-in-Chief PLOS Pathogens orcid.org/0000-0002-7699-2064
  41 in total

1.  Establishment and Operation of a Third-Party Virus-Specific T Cell Bank within an Allogeneic Stem Cell Transplant Program.

Authors:  Barbara Withers; Leighton Clancy; Jane Burgess; Renee Simms; Rebecca Brown; Kenneth Micklethwaite; Emily Blyth; David Gottlieb
Journal:  Biol Blood Marrow Transplant       Date:  2018-08-29       Impact factor: 5.742

2.  Treatment of Epstein-Barr-virus-positive post-transplantation lymphoproliferative disease with partly HLA-matched allogeneic cytotoxic T cells.

Authors:  Tanzina Haque; Gwen M Wilkie; Clare Taylor; Peter L Amlot; Parvez Murad; Angela Iley; Dilani Dombagoda; Kate M Britton; Anthony J Swerdlow; Dorothy H Crawford
Journal:  Lancet       Date:  2002-08-10       Impact factor: 79.321

3.  Implications of defective immune responses in SARS-CoV-2 vaccinated organ transplant recipients.

Authors:  Peter S Heeger; Christian P Larsen; Dorry L Segev
Journal:  Sci Immunol       Date:  2021-07-01

Review 4.  Virus-specific T-cell banks for 'off the shelf' adoptive therapy of refractory infections.

Authors:  R J O'Reilly; S Prockop; A N Hasan; G Koehne; E Doubrovina
Journal:  Bone Marrow Transplant       Date:  2016-04-04       Impact factor: 5.483

5.  Vaccinated and Convalescent Donor-Derived Severe Acute Respiratory Syndrome Coronavirus 2-Specific T Cells as Adoptive Immunotherapy for High-Risk Coronavirus Disease 2019 Patients.

Authors:  Penelope-Georgia Papayanni; Dimitrios Chasiotis; Kiriakos Koukoulias; Aphrodite Georgakopoulou; Anastasia Iatrou; Eleni Gavriilaki; Chrysavgi Giannaki; Militsa Bitzani; Eleni Geka; Polychronis Tasioudis; Diamantis Chloros; Asimina Fylaktou; Ioannis Kioumis; Maria Triantafyllidou; Sotiria Dimou-Besikli; Georgios Karavalakis; Afroditi K Boutou; Eleni Siotou; Achilles Anagnostopoulos; Anastasia Papadopoulou; Evangelia Yannaki
Journal:  Clin Infect Dis       Date:  2021-12-06       Impact factor: 9.079

6.  Robust T Cell Immunity in Convalescent Individuals with Asymptomatic or Mild COVID-19.

Authors:  Takuya Sekine; André Perez-Potti; Olga Rivera-Ballesteros; Kristoffer Strålin; Jean-Baptiste Gorin; Annika Olsson; Sian Llewellyn-Lacey; Habiba Kamal; Gordana Bogdanovic; Sandra Muschiol; David J Wullimann; Tobias Kammann; Johanna Emgård; Tiphaine Parrot; Elin Folkesson; Olav Rooyackers; Lars I Eriksson; Jan-Inge Henter; Anders Sönnerborg; Tobias Allander; Jan Albert; Morten Nielsen; Jonas Klingström; Sara Gredmark-Russ; Niklas K Björkström; Johan K Sandberg; David A Price; Hans-Gustaf Ljunggren; Soo Aleman; Marcus Buggert
Journal:  Cell       Date:  2020-08-14       Impact factor: 41.582

7.  Efficacy and Safety of the mRNA-1273 SARS-CoV-2 Vaccine.

Authors:  Lindsey R Baden; Hana M El Sahly; Brandon Essink; Karen Kotloff; Sharon Frey; Rick Novak; David Diemert; Stephen A Spector; Nadine Rouphael; C Buddy Creech; John McGettigan; Shishir Khetan; Nathan Segall; Joel Solis; Adam Brosz; Carlos Fierro; Howard Schwartz; Kathleen Neuzil; Larry Corey; Peter Gilbert; Holly Janes; Dean Follmann; Mary Marovich; John Mascola; Laura Polakowski; Julie Ledgerwood; Barney S Graham; Hamilton Bennett; Rolando Pajon; Conor Knightly; Brett Leav; Weiping Deng; Honghong Zhou; Shu Han; Melanie Ivarsson; Jacqueline Miller; Tal Zaks
Journal:  N Engl J Med       Date:  2020-12-30       Impact factor: 91.245

8.  SARS-CoV-2-Specific Memory T Lymphocytes From COVID-19 Convalescent Donors: Identification, Biobanking, and Large-Scale Production for Adoptive Cell Therapy.

Authors:  C Ferreras; B Pascual-Miguel; C Mestre-Durán; A Navarro-Zapata; L Clares-Villa; C Martín-Cortázar; R De Paz; A Marcos; J L Vicario; A Balas; F García-Sánchez; C Eguizabal; C Solano; M Mora-Rillo; B Soria; A Pérez-Martínez
Journal:  Front Cell Dev Biol       Date:  2021-02-25

9.  Antibody cocktail to SARS-CoV-2 spike protein prevents rapid mutational escape seen with individual antibodies.

Authors:  Alina Baum; Benjamin O Fulton; Elzbieta Wloga; Richard Copin; Kristen E Pascal; Vincenzo Russo; Stephanie Giordano; Kathryn Lanza; Nicole Negron; Min Ni; Yi Wei; Gurinder S Atwal; Andrew J Murphy; Neil Stahl; George D Yancopoulos; Christos A Kyratsous
Journal:  Science       Date:  2020-06-15       Impact factor: 47.728

10.  Elevated exhaustion levels and reduced functional diversity of T cells in peripheral blood may predict severe progression in COVID-19 patients.

Authors:  Hong-Yi Zheng; Mi Zhang; Cui-Xian Yang; Nian Zhang; Xi-Cheng Wang; Xin-Ping Yang; Xing-Qi Dong; Yong-Tang Zheng
Journal:  Cell Mol Immunol       Date:  2020-03-17       Impact factor: 11.530

View more
  1 in total

1.  How I treat and prevent COVID-19 in patients with hematologic malignancies and recipients of cellular therapies.

Authors:  Firas El Chaer; Jeffery J Auletta; Roy F Chemaly
Journal:  Blood       Date:  2022-08-18       Impact factor: 25.476

  1 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.