Literature DB >> 35110668

Crystal structure and catalytic mechanism of the MbnBC holoenzyme required for methanobactin biosynthesis.

Chao Dou1, Zhaolin Long1, Shoujie Li1, Dan Zhou1, Ying Jin1, Li Zhang1, Xuan Zhang2, Yanhui Zheng1, Lin Li3, Xiaofeng Zhu1,4, Zheng Liu5, Siyu He1, Weizhu Yan1, Lulu Yang1, Jie Xiong1, Xianghui Fu1, Shiqian Qi1, Haiyan Ren1, She Chen3, Lunzhi Dai1, Binju Wang2, Wei Cheng6.   

Abstract

Methanobactins (Mbns) are a family of copper-binding peptides involved in copper uptake by methanotrophs, and are potential therapeutic agents for treating diseases characterized by disordered copper accumulation. Mbns are produced via modification of MbnA precursor peptides at cysteine residues catalyzed by the core biosynthetic machinery containing MbnB, an iron-dependent enzyme, and MbnC. However, mechanistic details underlying the catalysis of the MbnBC holoenzyme remain unclear. Here, we present crystal structures of MbnABC complexes from two distinct species, revealing that the leader peptide of the substrate MbnA binds MbnC for recruitment of the MbnBC holoenzyme, while the core peptide of MbnA resides in the catalytic cavity created by the MbnB-MbnC interaction which harbors a unique tri-iron cluster. Ligation of the substrate sulfhydryl group to the tri-iron center achieves a dioxygen-dependent reaction for oxazolone-thioamide installation. Structural analysis of the MbnABC complexes together with functional investigation of MbnB variants identified a conserved catalytic aspartate residue as a general base required for MbnBC-mediated MbnA modification. Together, our study reveals the similar architecture and function of MbnBC complexes from different species, demonstrating an evolutionarily conserved catalytic mechanism of the MbnBC holoenzymes.
© 2022. The Author(s).

Entities:  

Mesh:

Substances:

Year:  2022        PMID: 35110668      PMCID: PMC8888699          DOI: 10.1038/s41422-022-00620-2

Source DB:  PubMed          Journal:  Cell Res        ISSN: 1001-0602            Impact factor:   46.297


Introduction

Metals such as copper are critical in maintaining physiological homeostasis in all living organisms,[1] and are specifically involved in catalysis of some essential bacterial proteins.[2-6] While copper is necessary for certain protein activities, it is also employed as an antibacterial agent in multiple industrial and medical fields.[7] In response, bacteria can use copper-chelating compounds such as chalkophores for detoxification. Chalkophore molecules are similar to the iron-binding siderophores involved in bacterial metabolism and detoxification.[8-10] Notably, they have been investigated in clinical trials as potential therapeutic agents for Wilson disease, a genetic disorder that causes excessive copper accumulation in organs such as the liver and brain.[11-14] Methanobactins (Mbns) are chalkophores present specifically in methanotrophs.[15,16] A few Mbns have been characterized[15,17-20] (Supplementary information, Fig. S1a) and found to be ribosomally synthesized and posttranslationally modified peptides (RiPPs).[17,21-23] Mbn molecules are biosynthesized from gene-encoded precursor polypeptides (MbnAs) containing a leader peptide (LP) for biosynthetic machinery recognition and a core peptide (CP) that becomes the mature product after MbnA modification and LP cleavage[21,22] (Supplementary information, Fig. S1b, c). A core biosynthetic machinery containing the MbnBC complex was recently identified in Methylosinus trichosporium (Mt) OB3b.[17] Five gene-encoded cluster groups (I–V) for Mbn biosynthesis have been characterized thus far[23] (Supplementary information, Fig. S1d). Among the known Mbn operons, mbnA is always followed by mbnB and mbnC genes which are responsible for MbnA modification.[17,21] mbnB is predicted to encode a triose phosphate isomerase (TIM),[24] and shows MbnA-modifying activity only in complex with MbnC.[10,17] However, the organization and catalytic mechanism of the MbnBC machinery remains unknown. Here, we determined the crystal structures of MbnBC complexes of Rugamonas rubra (Rr) ATCC 43154 (RrMbnBC, representing Group III) and Vibrio caribbenthicus (Vc) BAA-2122 (VcMbnBC, representing Group V) (Supplementary information, Table S1) bound to RrMbnA and VcMbnA, respectively. The structure of RrMbnABC and VcMbnABC is conserved, containing a unique tri-iron cluster ligated with the cysteine residue of substrate MbnA. Our findings elucidate the mechanism of Mbn catalytic production by the MbnBC holoenzyme.

Results

Reconstitution of MbnABC complexes

To facilitate structural studies of MbnABC, we reconstituted its complexes from different species (Supplementary information, Fig. S1e). Similar to MtMbnABC,[17] the three components of RrMbnABC formed a stable complex when co-expressed in Escherichia coli (Supplementary information, Fig. S2a). The interaction of RrMbnA with RrMbnBC was verified by isothermal titration calorimetry (ITC) (Fig. 1a). Consistently, limited proteolysis showed that RrMbnA binding could enhance RrMbnBC stability (Supplementary information, Fig. S2b). The conjugate bond in the modified MbnA can be detected using a scanning ultraviolet-visible (UV-Vis) spectrophotometer.[17,19] Indeed, RrMbnA could be modified by RrMbnBC in the co-expressed system, and the product displayed absorption peak at ~335 nm, consistent with observations in MtMbnA[17] (Fig. 1b). High-resolution mass spectrometry (MS) indicated that the absorption resulted from modifications on either Cys21 or Cys25 (Fig. 1c). Supporting this finding, a double mutation C21S/C25S completely abolished the absorption at this wavelength (Fig. 1b). Further supporting that RrMbnA was modified, MS data showed decreases of 2 and 4 Daltons in molecular weight of the peptide substrate (Fig. 1c; Supplementary information, Fig. S2c), which are characteristic mass shifts in modified MbnA.[17]
Fig. 1

Reconstitution of MbnABC complexes.

a ITC measurement of the binding affinity between RrMbnA and RrMbnBC. The upper panel shows the original titration traces. b UV-Vis spectra detection of RrMbnA and RrMbnAC21,25S modifications catalyzed by co-expressed RrMbnBC with absorption peaks at ~270 nm and ~335 nm. The amino acid sequence of RrMbnA is indicated, and the potentially modified residues are shown in red. Putative products are shown as chemical structures. Inset, the activities of these proteins are shown by UV absorbance at 335 nm. c Analysis of the modified RrMbnA by electrospray ionization tandem MS (ESI-MS/MS). The mass changes of Cys21 or Cys25 are highlighted in red. d ITC measurement of the binding affinity between VcMbnA and VcMbnBC. e Absorbance of synthetic VcMbnA and variant VcMbnAC18S modified by VcMbnBC. The peak absorbance of the modified VcMbnA is shown at ~270 nm. The amino acid sequence of VcMbnA is indicated, and the potentially modified cysteine is shown in red. Putative product is shown as a chemical structure. Inset, the activities of these proteins are shown by UV absorbance at 270 nm. f Analysis of the modified VcMbnA by ESI-MS/MS. The mass changes of Cys18 are highlighted in red.

Reconstitution of MbnABC complexes.

a ITC measurement of the binding affinity between RrMbnA and RrMbnBC. The upper panel shows the original titration traces. b UV-Vis spectra detection of RrMbnA and RrMbnAC21,25S modifications catalyzed by co-expressed RrMbnBC with absorption peaks at ~270 nm and ~335 nm. The amino acid sequence of RrMbnA is indicated, and the potentially modified residues are shown in red. Putative products are shown as chemical structures. Inset, the activities of these proteins are shown by UV absorbance at 335 nm. c Analysis of the modified RrMbnA by electrospray ionization tandem MS (ESI-MS/MS). The mass changes of Cys21 or Cys25 are highlighted in red. d ITC measurement of the binding affinity between VcMbnA and VcMbnBC. e Absorbance of synthetic VcMbnA and variant VcMbnAC18S modified by VcMbnBC. The peak absorbance of the modified VcMbnA is shown at ~270 nm. The amino acid sequence of VcMbnA is indicated, and the potentially modified cysteine is shown in red. Putative product is shown as a chemical structure. Inset, the activities of these proteins are shown by UV absorbance at 270 nm. f Analysis of the modified VcMbnA by ESI-MS/MS. The mass changes of Cys18 are highlighted in red. The aerobically purified VcMbnBC proteins interacted with VcMbnA as indicated by a pull-down assay and further confirmed by ITC (Fig. 1d; Supplementary information, Fig. S3a). Synthetic VcMbnA notably inhibited trypsin-mediated digestion of MbnBC, indicating that VcMbnA stabilizes the MbnBC complex (Supplementary information, Fig. S3b). Unexpectedly, the modified VcMbnA exhibited a strong absorption peak at ~270 nm (Fig. 1e) and a shoulder absorption in the range of 300–360 nm. However, the expected decreases of 2 and 4 Daltons in the molecular weight of the peptide were detected (Fig. 1f). Additionally, an increase of 14 and a decrease of 30 Daltons in the mass of VcMbnA were also detected with MS (Supplementary information, Fig. S3c). MS analysis further showed that all of the mass shifts occurred at the cysteine residue (Cys18) of VcMbnA, and the VcMbnAC18S mutation completely abrogated absorption in the UV range (Fig. 1e). The modified VcMbnA with absorption at ~270 nm is reminiscent of acid-catalyzed hydrolysis of the oxazolone-thioamide-containing products[20,25-28] (Supplementary information, Fig. S3d). Supporting this hypothesis, the MS data analysis showed that mass shifts +14 and −30 Daltons stemmed from the predicted intermediate and product generated by hydrolysis of the modified VcMbnA, respectively (Supplementary information, Fig. S3c, e). Our results here differ from the previous report[17] likely because our assays were performed using synthetic substrate in vitro. Apart from the absorption at 335 nm, the modified RrMbnA also displayed absorption at ~270 nm (Fig. 1b), and this absorption was promoted by acid-mediated hydrolysis. Supporting the idea that the absorption resulted from a modified RrMbnA, a mass shift of −30 Daltons in the modified RrMbnAC21S/C25S was observed (Supplementary information, Fig. S3f). Importantly, ITC assays showed that Cu2+ bound to the modified RrMbnA and VcMbnA but not to their unmodified forms (Supplementary information, Fig. S4a, b). The characteristic of acid-mediated hydrolysis of modified VcMbnA differs from that of the modified RrMbnA; the latter is similar to that of previously studied Mbns[17] (Supplementary information, Fig. S4c–e). This is likely because the modified VcMbnA was almost hydrolyzed (Supplementary information, Fig. S3c–e). Additionally, the enzymatic activities of anaerobically purified RrMbnBC and VcMbnBC proteins showed no notable improvement compared with those of aerobically purified ones (Supplementary information, Fig. S5a–c).

Overall structures of MbnABCs

To understand the mechanism of how MbnBCs catalyze modification of MbnAs, we finally solved the crystal structures of VcMbnABC and RrMbnABC at resolutions of 2.2 Å and 2.7 Å, respectively. In both structures, the interactions between MbnA, MbnB and MbnC result in the formation of a 1:1:1 tertiary complex, and the overall structures of VcMbnABC and RrMbnABC are nearly identical (Fig. 2a, b; Supplementary information, Fig. S6a and Table S1). MbnB adopts a TIM barrel (α9β8) fold, comprising eight parallel β-sheets surrounded by nine α-helices (Fig. 2c), which resembles the unpublished crystal structure of a protein member of the DUF692 family in Haemophilus somnus (Hs), whose function remains unknown (hereafter named HsMbnB, PDB ID: 3BWW, Supplementary information, Fig. S6b, c). The structure of MbnC is elongated and can be divided into an N-terminal helix domain and a C-terminal β-sheet domain (Fig. 2d). Querying the DALI server[29] failed to identify any structural homologs of MbnC, indicating that the structure represents a novel fold. The overall structures of VcMbnBC and RrMbnBC are very similar (Fig. 2e, root mean square deviations (RMSD) = 1.83 Å). Intriguingly, despite their divergent sequences (Fig. 2f), VcMbnA and RrMbnA assume similar conformations when they interact with VcMbnBC and RrMbnBC, respectively (Fig. 2f).
Fig. 2

Structures of VcMbnABC and RrMbnABC.

a–b Overall structures of MbnABC complexes, VcMbnABC (a), RrMbnABC (b). MbnA, MbnB and MbnC are shown in different colors. The MbnA shown as ball-and-stick models are contoured with a 2Fo-Fc map at 1 σ. c The TIM barrel of VcMbnB (left) and RrMbnB (right). Red dotted circles denote core pores. d The structure of VcMbnC (left) and RrMbnC (right). NTD and CTD are presented as cartoons. e VcMbnBC and RrMbnBC show nearly identical architectures. f The structures of RrMbnA (upper) and VcMbnA (lower), contoured with a 2Fo-Fc map at 1.5 σ. Sequence alignment of RrMbnA and VcMbnA is shown with conserved amino acids highlighted.

Structures of VcMbnABC and RrMbnABC.

a–b Overall structures of MbnABC complexes, VcMbnABC (a), RrMbnABC (b). MbnA, MbnB and MbnC are shown in different colors. The MbnA shown as ball-and-stick models are contoured with a 2Fo-Fc map at 1 σ. c The TIM barrel of VcMbnB (left) and RrMbnB (right). Red dotted circles denote core pores. d The structure of VcMbnC (left) and RrMbnC (right). NTD and CTD are presented as cartoons. e VcMbnBC and RrMbnBC show nearly identical architectures. f The structures of RrMbnA (upper) and VcMbnA (lower), contoured with a 2Fo-Fc map at 1.5 σ. Sequence alignment of RrMbnA and VcMbnA is shown with conserved amino acids highlighted.

Interactions between MbnB and MbnC

The secondary structure of the regions involved in the interaction between MbnB and MbnC are identical in VcMbnABC and RrMbnABC (Supplementary information, Fig. S6a). The N-terminal domain (NTD) of MbnC is sandwiched between two extended loops of MbnB (Supplementary information, Fig. S7a). One extended loop (L1) of MbnB packs against the horizontal helix (α1) of the MbnC NTD, whereas the other extended loop (L2) interacts with α2 and the two crossing α-helices from underneath. These interactions collectively form interface I between MbnB and MbnC. In addition, the hairpin loop between β2 and β3 and the loop linking the NTD and CTD of MbnC contact MbnB at the other side, forming the interface II (Supplementary information, Fig. S7b). Structural-based sequence alignment showed that the amino acids mediating interactions between VcMbnB and VcMbnC are highly conserved in RrMbnBC and other MbnBC complexes (Supplementary information, Fig. S7c). Collectively, our results suggest a conserved mechanism regulating the formation of MbnBC holoenzymes to produce Mbns. To verify the MbnB–MbnC interactions observed in the crystal structures, we generated two VcMbnC mutants by deleting N-terminal residues 1–12 and an internal fragment containing residues 131–136, which mediate interactions within interfaces I and II, respectively. We then tested whether the VcMbnC mutants could still interact with VcMbnB. As expected, VcMbnC131–136 truncation resulted in the insolubility of VcMbnC and VcMbnC△NTD12 truncation abolished interaction with VcMbnB, indicating that the interaction interfaces are critical for the formation of the MbnBC complex (Supplementary information, Fig. S7d). This further supports the essentiality of these two regions in VcMbnB-mediated modification of VcMbnA. Similarly, no RrMbnBC complex could be obtained when equivalent regions of RrMbnC were mutated, as both RrMbnC151–156 and RrMbnC△NTD28 are insoluble (Supplementary information, Fig. S7e). The biochemical data thus confirmed the MbnB–MbnC interaction observed in the structure.

MbnA recognition by the MbnBC complex

MbnA establishes extensive interactions with MbnBC, binding to both MbnC and MbnB and burying a surface area of ~1588 Å2 in VcMbnBC and ~1791 Å2 in RrMbnBC (Supplementary information, Fig. S8). In both complexes, a large majority (~978 Å2 for VcMbnABC and ~979 Å2 for RrMbnABC) of the buried surface is derived from contacts of MbnA with MbnC (Supplementary information, Fig. S8), explaining why MbnC is required for the substrate MbnA to interact with the catalytic subunit MbnB (Fig. 3a). The N-terminal half of the LP interacts predominantly with MbnC, forming an antiparallel β-sheet via three inter-main chain hydrogen bonds (Fig. 3b). Notably, similar binding was observed in the interactions between the RiPP leader peptide and the precursor peptide-recognition element (RRE)[30-33] (Supplementary information, Fig. S9a–f). Structural prediction of MbnABC complexes of other groups with AlphaFold2[34,35] further supports this conserved LP-binding model (Supplementary information, Fig. S9g, h). In VcMbnA, the C-terminal half of the LP (residues 13–16) and the CP (residues 17–23) form a curved structure that docks into the catalytic cavity (Fig. 3c). This presents the only cysteine residue (Cys18) of VcMbnA at the apex of the curve, coordinating with one of the iron ions in the catalytic cavity formed by VcMbnBC (Fig. 3c). A similar curved conformation is formed by the RrMbnA CP in the RrMbnABC complex (Fig. 3c). In contrast to VcMbnA, the C-terminal half of the RrMbnA LP (residues 15–20) forms a short kink, which interacts with the surface loop region of RrMbnB (Supplementary information, Fig. S10a). Formation of the kink allows the second cysteine residue (Cys25) to coordinate to one of the iron ions in the catalytic cavity of RrMbnBC.
Fig. 3

MbnA recognition by MbnBC.

a MbnAs are shown in VcMbnABC (left) and RrMbnABC complexes (right). MbnA, MbnB and MbnC are shown as ball-and-stick, surface and cartoon representations, respectively. Interaction regions between MbnA and MbnBC are highlighted by colored boxes with LP-binding region in gray and CP-binding region in red. b Interaction of LP with MbnCs (left, VcMbnAC; right, RrMbnAC). Conserved residues are labeled and hydrogen bonds are indicated by blue dashed lines. c MbnA CP resides in the catalytic cavity of MbnB (left, VcMbnAB; right, RrMbnAB).

MbnA recognition by MbnBC.

a MbnAs are shown in VcMbnABC (left) and RrMbnABC complexes (right). MbnA, MbnB and MbnC are shown as ball-and-stick, surface and cartoon representations, respectively. Interaction regions between MbnA and MbnBC are highlighted by colored boxes with LP-binding region in gray and CP-binding region in red. b Interaction of LP with MbnCs (left, VcMbnAC; right, RrMbnAC). Conserved residues are labeled and hydrogen bonds are indicated by blue dashed lines. c MbnA CP resides in the catalytic cavity of MbnB (left, VcMbnAB; right, RrMbnAB). Binding assays of VcMbnBC to VcMbnA with either LP or CP deleted indicated that VcMbnA with LP alone displayed weak interaction with VcMbnBC, whereas deletion of LP completely abolished interaction with VcMbnBC. These results show that LP and CP are cooperative in the interaction with VcMbnBC (Fig. 1d; Supplementary information, Fig. S10b). VcMbnAC18S maintains the interaction but compromises VcMbnBC-mediated modification (Fig. 1d; Supplementary information, Fig. S10c). Collectively, our results suggest that MbnA recognition is similar to that of the RiPP leader peptide recognition involved in enzyme processing, although the regioselectivity and promiscuity remain unclear[30-33].

Substrate specificity determinants for the MbnBC holoenzymes

Among the MbnB and MbnC proteins from different species, VcMbnB and VcMbnC are distantly related to those in other species (Supplementary information, Fig. S11a, b). Nonetheless, the structures of VcMbnABC and RrMbnABC are nearly identical (Supplementary information, Fig. S6a), indicating that the MbnBC holoenzyme machinery for MbnA modification is conserved. Structural-based sequence alignment indicated that the MbnA recognition residues are conserved among MbnBC from different groups, particularly from Groups I–IV (Supplementary information, Fig. S11c). This may explain the substrate promiscuity of MbnBCs.[17] Consistent with this hypothesis, our enzymatic assays showed that RrMbnBC was active in modifying MbnAs from Groups I–V (Fig. 4a). Notably, VcMbnA (Group V) could be recognized and modified by RrMbnBC (Fig. 4b, c); mass shifts in the VcMbnAC18 were verified by tandem MS (Fig. 4d; Supplementary information, Fig. S12a, b). However, despite the highly conserved structure, MbnBCs from Group V are specific for Group V MbnAs, as shown previously[17] and further confirmed here (Supplementary information, Fig. S12c). Structural superposition showed that VcMbnA and RrMbnA form a set of conserved interactions with VcMbnBC and RrMbnBC, respectively (Supplementary information, Fig. S9g, h), providing further evidence for promiscuous substrate recognition. Some nonconserved residues of VcMbnB and VcMbnC form severe steric clashes with the kink region of RrMbnA, likely preventing recognition of RrMbnA or other MbnAs by VcMbnBC. Overall, the structural observations suggest that these nonconserved residues are likely to be determinants for the specific selection of VcMbnA by VcMbnBC.
Fig. 4

Promiscuous substrate recognition.

a Activity assay of RrMbnBC with MbnAs from five Mbn groups over 1000 s. MbnAs from Methylosinus trichosporium OB3b (MtMbnA, Group I), Methylocystis sp. SC2 (MsMbnA, Group II), Azospirillum sp. B510 (AsMbnA, Group III), Gluconacetobacter sp. SXCC-1 (GsMbnA, Group IV), and Vibrio caribbenthicus BAA-2122 (VcMbnA, Group V) are used. b ITC measurement of the binding affinity between VcMbnA and RrMbnBC. c UV-Vis spectra detection for the synthetic VcMbnA and VcMbnAC18S modified by RrMbnBC, with the absorption peaks at ~270 nm and ~335 nm. Inset, the activities of these proteins are shown by UV absorbance at ~335 nm. d ESI-MS/MS analysis of the VcMbnA modification catalyzed by RrMbnBC. The mass change of Cys18 is highlighted in red.

Promiscuous substrate recognition.

a Activity assay of RrMbnBC with MbnAs from five Mbn groups over 1000 s. MbnAs from Methylosinus trichosporium OB3b (MtMbnA, Group I), Methylocystis sp. SC2 (MsMbnA, Group II), Azospirillum sp. B510 (AsMbnA, Group III), Gluconacetobacter sp. SXCC-1 (GsMbnA, Group IV), and Vibrio caribbenthicus BAA-2122 (VcMbnA, Group V) are used. b ITC measurement of the binding affinity between VcMbnA and RrMbnBC. c UV-Vis spectra detection for the synthetic VcMbnA and VcMbnAC18S modified by RrMbnBC, with the absorption peaks at ~270 nm and ~335 nm. Inset, the activities of these proteins are shown by UV absorbance at ~335 nm. d ESI-MS/MS analysis of the VcMbnA modification catalyzed by RrMbnBC. The mass change of Cys18 is highlighted in red.

MbnB active site

Strong unoccupied electron densities at the catalytic sites of VcMbnABC and RrMbnABC suggest the existence of three metal ions (Fig. 5a). Supporting this conclusion, metal element analysis of the purified proteins with inductively coupled plasma mass spectrometry (ICP-MS) showed that RrMbnABC and VcMbnBC contain 2.80 ± 0.36 and 2.83 ± 0.19 iron ions per heterotrimer, respectively (Supplementary information, Table S2). Moreover, high spin FeIII ions were detected by electron paramagnetic resonance spectroscopy (EPR) in the protein samples (Supplementary information, Fig. S13a). Importantly, 57Fe-Mössbauer spectroscopy of the anaerobically purified VcMbnBC and RrMbnBC proteins indicated a trinuclear cluster and a 2:1 stoichiometry between FeIII and FeII (Supplementary information, Fig. S13b and Table S3). This conclusion is further supported by quantitative assays of FeIII and FeII in the VcMbnBC and RrMbnBC proteins using 1,10-phenanthroline[36] (Supplementary information, Table S4). Treatment with excess H2O2 almost abrogated the MbnBC-mediated MbnA modification with negligible impact on the stability of the MbnBC complexes (Supplementary information, Fig. S13c, d), supporting an essential role of FeII in the catalytic activity of RrMbnBC and VcMbnBC (Supplementary information, Fig. S13e), similar to what has been observed in MtMbnBC.[17] Thus, three iron ions (Fe1, Fe2, and Fe3) with octahedral coordination were modeled in the densities (Fig. 5b; Supplementary information, Fig. S14a). Detailed analysis of metals in MbnBC proteins is presented in the Supplementary information, Data S1. The divalent ion (Fe1) coordinates to VcMbnAC18 in VcMbnABC and to RrMbnAC25 in RrMbnABC (Fig. 5b; Supplementary information, Fig. S14a), providing direct evidence for cysteine modifications of MbnA by MbnBC. In VcMbnB, the residues coordinating the iron ions are His55, His91, Glu135, Asp165, Asn168, His194, Asp209, and Glu238; this is also the case for equivalent residues in RrMbnB (Fig. 5b; Supplementary information, Fig. S14a). Sequence alignment indicated that the Fe-coordinated residues are highly conserved among the MbnB family members (Supplementary information, Fig. S14b), suggesting that the tri-iron cluster is conserved in this enzyme family. Glu135 in VcMbnB provides a bidentate carboxylate ligand that bridges Fe1 and Fe2 (Fig. 5b; Supplementary information, Fig. S14c). Solvent molecules complete the coordination of Fe2 and Fe3, with one water molecule coupling the two metal ions (Fig. 5b; Supplementary information, Fig. S14d). The L2 loop of VcMbnB harbors the conserved residues Asp209 and His211, which are critical for Fe3 coordination (Supplementary information, Fig. S15a). However, the equivalent loop in the unpublished structure of HsMbnB is completely disordered (Supplementary information, Fig. S15b), which could explain why a di-iron center, but not a tri-iron center, was observed in the structure of HsMbnB (Supplementary information, Fig. S15c).
Fig. 5

MbnB active site.

a Electron density maps of three metal ions contoured with a 2Fo-Fc map at 5 σ in VcMbnB (left) and RrMbnB (right) structures. Fe atoms are colored in cyan (VcMbnB) and brown (RrMbnB). b Interaction networks formed by the tri-iron cluster with surrounding residues in VcMbnB (left) and RrMbnB (right). The six-coordinate Fe1II is highlighted as a cartoon in the middle. O2 occupies a water site for activation. Hydrogen bonds, Fe–S bonds, and Fe–Fe bonds are indicated by blue, yellow and pink dashed lines, respectively. W, water molecule. c In vitro activity of VcMbnBC or mutants to modify the synthetic VcMbnA (left); in vivo activity of RrMbnBC or mutants to modify the co-expressed RrMbnA (right). The relative absorbances at ~270 nm for VcMbnA and ~335 nm for RrMbnA are represented as histograms in the insets.

MbnB active site.

a Electron density maps of three metal ions contoured with a 2Fo-Fc map at 5 σ in VcMbnB (left) and RrMbnB (right) structures. Fe atoms are colored in cyan (VcMbnB) and brown (RrMbnB). b Interaction networks formed by the tri-iron cluster with surrounding residues in VcMbnB (left) and RrMbnB (right). The six-coordinate Fe1II is highlighted as a cartoon in the middle. O2 occupies a water site for activation. Hydrogen bonds, Fe–S bonds, and Fe–Fe bonds are indicated by blue, yellow and pink dashed lines, respectively. W, water molecule. c In vitro activity of VcMbnBC or mutants to modify the synthetic VcMbnA (left); in vivo activity of RrMbnBC or mutants to modify the co-expressed RrMbnA (right). The relative absorbances at ~270 nm for VcMbnA and ~335 nm for RrMbnA are represented as histograms in the insets. Consistent with previous data,[17] single mutations of the Fe-coordinated residues His55, His91, Glu135, Asp165, Asn168, His194, Asp209, and Glu238 in VcMbnB or their equivalents in RrMbnBC and MtMbnBC abolished their MbnA modification activity or impaired MbnB protein level (Fig. 5c; Supplementary information, Fig. S16a–c). These results indicate that the integrity of the tri-iron center is critical for the catalytic activity of MbnBC. Circular dichroism (CD) spectroscopic analyses indicated that loss of activity in these MbnBC mutants was not caused by protein misfolding (Supplementary information, Fig. S16b, c). Similar CD analyses were not performed for VcMbnBC because several mutants were expressed at very low levels (Supplementary information, Fig. S16a).

Catalytic mechanism

VcMbnB Asp240 and the equivalent in RrMbnB, Asp242, are conserved among MbnBs and are located adjacent to the apex of the curved portion of MbnA (Supplementary information, Fig. S14b). The main chain of VcMbnB Asp240 forms an intramolecular hydrogen bond with VcMbnBH211, while the side chain forms a hydrogen bond with the amide nitrogen of VcMbnAG19 (Fig. 6a). Similar interactions are also seen in the structure of RrMbnABC (Fig. 6b). Mutation of VcMbnBD240 to Ala, Glu or Asn had no detectable effect on VcMbnB’s interaction with VcMbnC but slightly impaired VcMbnA recognition by VcMbnBC (Supplementary information, Fig. S17a, b). However, the mutation abrogated enzymatic activity of the VcMbnBC complex (Fig. 6c). These results collectively suggest that VcMbnBD240 likely plays a critical role in catalyzing modification of MbnA. Similar results were observed in equivalent mutants of RrMbnB (Asp242) and MtMbnB (Asp241) (Fig. 6d; Supplementary information, Fig. S17c–g). The exception was RrMbnBD242EC, which retained RrMbnA-binding affinity and catalytic activity. Although this suggests that Glu can mimic the function of Asp242 in RrMbnB, the overall results nonetheless point to a conserved role for the Asp residue, acting as a catalytic base for MbnA modification.
Fig. 6

Catalytic mechanism underlying MbnBC-mediated MbnA modification.

a The structure of VcMbnBD240 interacting with VcMbnBH211 and VcMbnAG19. b The structure of RrMbnBD242 interacting with RrMbnBH211 and RrMbnAG26. c UV-Vis spectrometric analyses of VcMbnA molecules modified by VcMbnBD240C variants (VcMbnBD240AC, VcMbnBD240EC and VcMbnBD240NC). The peak absorbance of VcMbnA is shown at ~270 nm. d UV-Vis spectrometric analyses of RrMbnA molecules modified by co-expressed RrMbnBD242C variants (RrMbnBD242AC, RrMbnBD242EC and RrMbnBD242NC). The peak absorbance of RrMbnA is shown at ~335 nm. e Proposed mechanism for MbnA modification catalyzed by MbnBC. The general base Asp240 of VcMbnB and mass shifts (−2 Da, −4 Da) are indicated. FeII, FeIII and FeIV irons are colored green, brown, and purple, respectively.

Catalytic mechanism underlying MbnBC-mediated MbnA modification.

a The structure of VcMbnBD240 interacting with VcMbnBH211 and VcMbnAG19. b The structure of RrMbnBD242 interacting with RrMbnBH211 and RrMbnAG26. c UV-Vis spectrometric analyses of VcMbnA molecules modified by VcMbnBD240C variants (VcMbnBD240AC, VcMbnBD240EC and VcMbnBD240NC). The peak absorbance of VcMbnA is shown at ~270 nm. d UV-Vis spectrometric analyses of RrMbnA molecules modified by co-expressed RrMbnBD242C variants (RrMbnBD242AC, RrMbnBD242EC and RrMbnBD242NC). The peak absorbance of RrMbnA is shown at ~335 nm. e Proposed mechanism for MbnA modification catalyzed by MbnBC. The general base Asp240 of VcMbnB and mass shifts (−2 Da, −4 Da) are indicated. FeII, FeIII and FeIV irons are colored green, brown, and purple, respectively. The Cys–S–Fe bond of the MbnABC substrate–enzyme complex is reminiscent of the one in isopenicillin N synthase (IPNS), a dioxygen-dependent oxidase that is nonheme iron-dependent. IPNS initially catalyzes formation of the β-lactam ring, and then generates the five-membered thiazolidine ring with the assistance of an oxidized iron (IV)-oxo (ferryl) moiety.[37-44] In addition, previously generated functional data[17] have suggested that MbnBCs are oxygen-activating nonheme tri-iron-dependent enzymes. Based on these prior findings, we propose a plausible mechanism by which MbnBC catalyzes the production of Mbns (Fig. 6e). First, O2 is activated by Fe1II, which is ligated to the substrate cysteine that is to be modified. This yields the superoxo species of Fe1III–O2− (1), which can further perform H atom abstraction (H-abs) from cysteine Cβ-H to generate the Fe1II–hydroperoxo complex (2a). Abstraction of the H atom was confirmed via mass spectroscopy, which showed a decreased mass. It was recently proposed that there are likely three irons in MbnBCs,[17] a hypothesis that is further supported by our data with the clearly observed irons in the MbnABC structure. We identified the valence states of the irons in the MbnB active site via 57Fe-Mössbauer, EPR spectroscopy and biochemical assays. Based on these new spectroscopic and structural data, we speculate that the inner-sphere electron transfer from the ligated thioalkyl radical to the Fe2III or Fe3III site might occur to generate the Fe2II species (2b) or Fe3II species (2c). This step is followed by O–O cleavage of the Fe1–hydroperoxo complex, and the subsequent formation of the β-lactam ring and a FeIV–oxo (ferryl) complex (3). The way in which the third Fe impacts the chemistry of electron transfer requires future investigation. Asp240 subsequently accepts and provides a proton to facilitate formation of a five-member ring intermediate (4) and acts as a general base;[45] this conclusion is supported by structural analysis and a mutagenesis assay. Finally, the FeIV–oxo-mediated dehydrogenation of the intermediate (5) generates the product Mbn (6).

Discussion

In the current study, we report crystal structures of MbnABCs from Mbn Groups III and V. The structures reveal a conserved architecture of MbnBC holoenzymes across groups and elucidate the mechanisms underlying substrate recognition and catalysis (Figs. 2, 6e; Supplementary information, Table S1). These data facilitate the identification of MbnA precursors and establish a framework for engineering TIM-barrel enzymes to produce Mbns. Interaction with MbnC is required for MbnB catalytic activity, indicating that the MbnBC complex acts as a holoenzyme for Mbn generation.[17] The structures of VcMbnBC and RrMbnBC are nearly identical (Fig. 2), although the former is the least conserved among species (Supplementary information, Fig. S11a, b). These data suggest that MbnBCs serve as a highly conserved machinery for catalytic production of Mbns. Indeed, some MbnA residues responsible for its recognition are conserved throughout Groups I–V (Supplementary information, Fig. S9g). Recognition of the N-terminal MbnA LP by MbnC is remarkably similar to that of RiPP precursor peptides by RREs[30-33] (Fig. 3b; Supplementary information, Fig. S9), suggesting that recognition of the N-terminal half of the LP does not involve extensive sequence specificity. Recognition of the C-terminal half of LP and CP is mediated by both MbnB and MbnC, which is likely important for specific selection of MbnAs by cognate MbnBCs. Despite MbnBCs having different specificity for MbnAs from different species, the active sites of MbnBCs, including the tri-iron center and the potential catalytic Asp residue are highly conserved (Figs. 5, 6a; Supplementary information, Fig. S14b), suggesting a conserved mechanism for MbnA modifications. The protein structures presented here show that the cysteine residue to be modified is directly coordinated to the divalent Fe in the tri-iron center (Fig. 5b; Supplementary information, Fig. S14a), although residues surrounding the cysteine are not conserved. RrMbnBC can modify either Cys21 or Cys25 of RrMbnA as indicated by MS data (Fig. 1c; Supplementary information, Fig. S3f), but only Cys25 was found to coordinate to Fe1 in the crystal structure of RrMbnABC (Fig. 3c). This may be a more energetically favorable binding mode for RrMbnA to interact with the catalytic site of RrMbnBC and could therefore be more readily captured by crystallography. In contrast to RrMbnA, only the first cysteine residue Cys21 of MtMbnA was found to be modified although the peptide contains 4 cysteine residues in the CP; the second potential modification on Cys27 that had been reported in a previous study[17] could not be detected. The precise reason for this discrepancy remains unknown, but the distance between the two potential modification sites in MbnAs (Cys21/25 for RrMbnA, Cys21/27 for MtMbnA) may play a role in determining whether the second modification can occur. Interestingly, the two cysteines in RrMbnA that can be modified alternatively have three residues between them, whereas there are five residues between the two cysteine residues in MtMbnA. After modification of the first cysteine residue, the MbnA precursor peptide would dissociate from the MbnBC complex due to limited space of the active site. These results raise an intriguing possibility that other enzymes may be involved for further modifications of MbnAs that have more than one cysteine residues modified. In agreement with this hypothesis, other enzymes such as MbnN, MbnF and MbnD have been suggested to be important for Mbn biosynthesis.[10,17,23] Moreover, although the results of acid hydrolysis, the mass shifts and the Cu2+-binding properties of modified MbnAs are similar to the characteristics of a single oxazolone-thioamide moiety, the absorption features of the modified VcMbnA by VcMbnBC or RrMbnBC are strikingly different (Figs. 1e, 4c), indicating that the catalytic environment of the active site is critical for product formation. A better understanding of the catalytic environment of these enzymes will rationalize the substrate or enzyme engineering to yield stable and simple Mbns for clinical applications.

Materials and methods summary

Peptide information

The VcMbnA peptide (MKNDKKVVVKVKDKEMTCGAFNK) from Vibrio caribbenthicus BAA-2122 and the VcMbnA variants LP (leader peptide, VcMbnA1-16) and CP (core peptide, VcMbnA17-23); the MtMbnA peptide (MTVKIAQKKVLPVIGRAAALCGSCYPCSCM) from Methylosinus trichosporium OB3b; and the RrMbnA peptide (MKIVIVKKVEIQVAGRTGMRCASSCGAKS) from Rugamonas rubra ATCC 43154 were all produced by Zhejiang Ontores Biotechnologies Co., Ltd, China. Peptides used in this study are listed in Supplementary information, Table S5. All peptides were purified to 95% purity except for RrMbnA (< 80% purity), which was too hydrophobic to be purified to the desired purity. All peptides were verified by HPLC and MS. The materials for molecular cloning used in this work were purchased from Vazyme Biotech Co., Ltd (Nanjing, China). All other chemicals were purchased from Sangon Biotech (Shanghai) Co., Ltd (Shanghai, China) unless otherwise noted.

Gene cloning and protein expression

The mbnB and mbnC genes originating from Methylosinus sp. LW4 (Group I), Methylosinus sp. PW1 (Group I), Mt OB3b (Group I), Methylocystis hirsuta CSC1* (Group II), Methylocystis rosea SV79 (Group II), Methylosinus sp. LW3 (Group II), Methylosinus sp. R-45379 (Group II), Pseudomonas extremaustralis DSM17835 (Group III), Rr ATCC 43154 (Group III), Gluconacetobacter sp. SXCC-1 (Group IV), and Vc BAA-2122 (Group V) were all synthesized by GENEWIZ (Hangzhou, China) and codon-optimized for expression in E. coli. The pET-Duet-1 vector was used for co-expression of MbnB (non-tagged) and MbnC (N-terminally His-tagged) to generate MbnBC complexes. The mbnC genes were subcloned into the CDS-1 region of the vector between the BamHI and HindIII restriction sites in frame with an N-terminal His6 tag. The mbnB genes were inserted into CDS-2 using the NdeI and XhoI restriction sites with a stop codon at the end of mbnB sequence; this vector was designated mbnBC_pET-Duet-1. Proteins prepared for crystallization, Mössbauer spectroscopy, EPR, activity assays, CD assays, MbnA binding affinity assays, and ICP-MS were all produced from the mbnBC_pET-Duet-1 construct. In addition, point mutations in MbnBC were introduced using quick-change PCR or overlap PCR with mbnBC_pET-Duet-1 as a template and primers containing the desired base mutations. For the deletion constructs, the truncated sequences were subcloned into the pET-Duet-1 vector as described for the mbnBC_pET-Duet-1 construct. The mbnAs from different species were separately constructed by overlap extension PCR using three pairs of primers (codon optimized and synthesized by Tsingke Biotechnology, China) and then cloned into a modified pET28b* vector between the XbaI and XhoI restriction sites (mbnA-pET28b*). The resulting mbnA-pET28b* construct contains a C-terminal His6 tag. To express RrMbnA with no tag, the stop codon TAA was introduced into the third forward primer of RrMbnA used for PCR amplification, and the sequence was subcloned into the pET28b* vector as described for the mbnA-pET28b* construct. All the constructs were verified by Sanger sequencing and are summarized in Supplementary information, Table S6. The primers used in this study are listed in Supplementary information, Table S7. The mbnBC-pET-Duet-1 and mbnA-pET28b* plasmids were transformed or co-transformed into E. coli BL21 (DE3) cells. LB medium supplemented with 0.25 mM ferrous ammonium sulfate and appropriate antibiotics was used for expression. Cultures were grown at 37 °C and 220 rpm to a final OD600 of 0.6, and protein expression was induced by adding isopropyl β-D-thiogalactopyranoside (IPTG) to a final concentration of 200 μM and incubating at 16 °C for 16 h.

Preparation of 57Fe-rich and selenomethionine-derived proteins

The mbnBC-pET-Duet-1 plasmids were transformed into E. coli BL21 (DE3) cells. For Mössbauer spectroscopy, minimal nutrient M9 medium (the recipe for M9 is provided in Supplementary information, Table S8) supplemented with 57Fe (anaerobically dissolved under heat in hydrochloric acid) was used instead of LB medium to enhance the loading of 57Fe in the protein and avoid the introduction of additional 56Fe. For phase determination of the VcMbnBC crystal structure, selenomethionine (Se-Met)-substituted proteins were expressed in M9 medium supplemented with Se-Met and 0.25 mM ferrous ammonium sulfate. Protein expression was induced by adding IPTG to a final concentration of 200 μM and incubating at 16 °C for 16 h. All the reconstituted MbnBC and MbnABC proteins in this study are summarized in Supplementary information, Table S9.

Aerobic and anaerobic protein purification

During aerobic purification, cell pellets were harvested by centrifugation at 4000 rpm at 4 °C and resuspended in buffer A (25 mM HEPES, pH 8.0, 200 mM NaCl). The cells were disrupted using a French press (AH-1500, ATS, China). After cell lysis, the lysate was centrifuged at 18,000 rpm for 30 min to remove the unlysed cells and insoluble material. Then the supernatant was applied to a nickel affinity column (Ni-NTA; GE Healthcare, Little Chalfont, UK). Buffer A mixed with a gradient of imidazole (5, 10, and 15 mM) was used to wash the column, and the protein was eluted with buffer A containing 250 mM imidazole. The eluted protein was concentrated using Amicon Ultra-15 concentrators (MilliporeSigma, Darmstadt, Germany) with the appropriate molecular weight cutoffs (3 kDa for co-expressed MbnAs, 10–30 kDa for MbnBC). Anion exchange chromatography (Source Q; GE Healthcare, Sweden) was then used for further purification. The peak fractions were injected into size exclusion chromatography columns (Superdex200 Increase 10/30 GL; GE Healthcare, Sweden) equilibrated with buffer B containing 100 mM NaCl and 25 mM HEPES (pH 8.0). The purity of MbnB and MbnBC was assessed using sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE), and the proteins were flash-frozen with liquid nitrogen for subsequent crystallization and biochemical analysis. Se-Met-substituted proteins were expressed in M9 medium supplemented with Se-Met and purified just as described for the native proteins. All MbnB, MbnBC, and MbnABC mutations (Supplementary information, Table S6) were produced using the procedure mentioned above. During the anaerobic purification of MbnBC, all buffers used were oxygen-free and all purification steps were performed in an anaerobic glove box (UN-750S, DELLIX, China) maintained at < 0.1 ppm oxygen. Cell pellets were harvested by centrifugation at 4000 rpm at 4 °C and resuspended in Buffer A (25 mM HEPES, pH 8.0, 200 mM NaCl). The cells were cooled in an ice bath and disrupted by an ultrasonic cell disruptor (Scientz-IID, Ningbo Scientz Biotechnology, China) at 20% output power, with 9-s pulses for a total of 30 min of sonic disruption. The lysate was centrifuged at 18,000 rpm for 30 min to remove the precipitates. Then the supernatant was applied to a nickel affinity column equilibrated with cooled buffer A. Buffer A mixed with a gradient of imidazole (as mentioned above) was used to wash the column, and the protein was eluted with buffer A containing 250 mM imidazole. Protein concentration and buffer replacement were performed using Amicon Ultra-15 concentrators (Millipore Sigma, Darmstadt, Germany) with the appropriate molecular weight cutoffs (3 kDa for co-expressed MbnAs, 10–30 kDa for MbnBC). Then, the concentrated proteins were injected into size exclusion chromatography columns (Superdex200 Increase 10/30 GL; GE Healthcare, Sweden) equilibrated with buffer B containing 100 mM NaCl and 25 mM HEPES (pH 8.0). The purities of MbnB and MbnBC were assessed by SDS-PAGE. Finally, the anaerobically prepared proteins were stored in a threaded tube with a rubber ring to avoid contamination by oxygen from the air and flash frozen for further assays.

Crystallization

The purified VcMbnBC and RrMbnABC (RrMbnBC co-expressed with RrMbnA) proteins were concentrated to 10 mg/mL and 15 mg/mL for crystallization, respectively. A crystallization screening assay was carried out using five classic screening kits, namely Index, Crystal, SaltRX, WizardI/II/III/IV, and PEG/ION. VcMbnBC incubated with synthesized VcMbnA at 4 °C for 2–3 h (molar ratio = 1:8) was used for the screening assays. Crystals of VcMbnABC grew to suitable sizes for X-ray diffraction within two weeks. To determine the phases of these complex structures, we purified Se-Met-substituted VcMbnBC, and the protein was incubated with synthesized VcMbnA for crystallization, The Se-derived VcMbnABC complex was crystallized under the same conditions as the native protein. Crystals of VcMbnABC were obtained with 2% Tacsimate (pH 7.0), 0.1 M HEPES (pH 7.5) and 20% PEG 3350, then flash-frozen in liquid nitrogen with an additional 12% glycerol added as a cryoprotectant during X-ray diffraction. Crystals of RrMbnABC were obtained after four days of incubation in a screening buffer containing 10% PEG 20000 and 100 mM MES (pH 6.5).

Data collection and structure determination

X-ray diffraction datasets of Se-derived VcMbnBC protein in complex with VcMbnA and the RrMbnABC complex were collected at the BL18U1 beamline end station of the Shanghai Synchrotron Radiation Facility at a wavelength of 0.9789 Å. All diffraction pictures collected were processed using the XDS data processing package or the HKL3000 package. The phase of the VcMbnABC complex was determined using the single-wavelength anomalous dispersion (SAD) method using the Se-Met-labeled MbnBC protein. The Se-Met sites were searched for and identified using the HySS module in the Phenix package, and density modification was performed using Resolve. An initial model was automatically built by Resolve in the phenix autobuild tool and then refined using phenix refinement. The final model was determined after being repeatedly manually built in COOT[46] and refined in Phenix.[47] The RrMbnABC structure was determined by molecular replacement (Molrep, Phenix) using the VcMbnBC complex structure as a searching model, manually built in COOT, and refined by Phenix. The statistics for X-ray diffraction data collection and refinement are listed in Supplementary information, Table S1.

Limited proteolysis assay

The limited proteolysis assay allows the characterization of the increase in stability of wild-type proteins upon binding to their substrates. The VcMbnBC and RrMbnBC proteins used in this assay were all adjusted to an equal molar concentration of about 20 µM. The RrMbnBC or VcMbnBC complex, by itself or after incubation with the corresponding MbnA peptide for 1 h at 4 °C, was digested by trypsin. After 30 min of incubation on ice, the proteolyzed products were analyzed by SDS-PAGE and visualized by Coomassie blue staining.

Fe content determination

ICP-MS

ICP-MS measurements were carried out on the 7900 ICP-MS Agilent system (Agilent Technologies Inc., CA, USA). The MtMbnBC, RrMbnBC, RrMbnABC, and VcMbnBC proteins were mixed with 8 mL nitric acid for 15 min to predigest them. The supernatant was then loaded into the ICP-MS instrument for analysis of the Fe, Ni, Co, and Cu contents. Data are shown in Supplementary information, Table S2.

EPR

For EPR analysis, ~120 μL aliquots of anaerobically and aerobically prepared VcMbnBC (400 μM), RrMbnBC (400 μM), and MtMbnBC (300 μM) were transferred into EPR tubes in an anaerobic glove box maintained at < 0.1 ppm oxygen, and the nozzles of the EPR tubes were all sealed with plasticine to avoid oxygen contamination. The samples were then frozen in liquid nitrogen for analysis. The continuous-wave EPR (CW-EPR) spectrum was acquired on a Bruker Elexsys E580 spectrometer with a super-high sensitivity probe head (ω = 9.36 GHz). Data were acquired under a helium flow cryostat at 5 K, and the temperature was controlled by an ESR900 Oxford instrument. The experimental parameters were set as follows: microwave frequency 9.376 GHz (5 K), microwave power 2.37 mW, 4 G modulation amplitude, and 30 ms time constant and conversion time.

Mössbauer spectroscopy

For Mössbauer analysis, ~45 mg of aerobically purified, 57Fe-enriched, and lyophilized RrMbnBC and VcMbnBC were transferred into a Mössbauer cup and frozen by placing the cup on an aluminum block precooled with liquid nitrogen. All the sample preparation steps were conducted in an anaerobic glove box maintained at < 0.1 ppm oxygen. The 57Fe Mössbauer spectra were measured using a conventional Mössbauer spectrometer (Topologic Systems, Kanagawa, Japan) in transmission mode with a 57Co/Rh γ-ray source. The samples were tightly sealed with silicon grease in an acrylic holder, and the spectra were calibrated using α-Fe foil as a reference at room temperature. Simulation of the Mössbauer spectra was carried out using the WMOSS spectral analysis software (www.wmoss.org; Seeco Research, Edina, MN). Mössbauer simulation parameters of the tri-iron cluster of VcMbnBC and RrMbnBC are shown in Supplementary information, Table S3.

1,10-phenanthroline assay

The relative concentrations of FeII and total Fe were measured using the standard 1,10-phenanthroline method[36] in which 1,10-phenanthroline forms a stable complex with FeII that absorbs light at 510 nm. For sample preparation, the proteins (aerobically or anaerobically purified MtMbnBC, RrMbnBC, RrMbnABC, and VcMbnBC) were adjusted to 1 mg/mL, then digested by trypsin at a mass ratio of 1:1 for 2 h at room temperature; proteolysis of the proteins allows exposure of the iron to the solution for detection. For FeII determination, 20 μL of 1 M sodium ethanoate solution and 150 μL of 5 mM 1,10-phenanthroline solution were mixed with 250 μL of protein–trypsin mixture sample and water (up to a final volume of 1 mL), then incubated for 10 min until detection. For total Fe determination, an additional 10 μL of 1.5 M hydroxylamine hydrochloride was introduced to reduce the FeIII to FeII, and the remaining steps for iron content determination were the same as those for FeII. Finally, the absorbance at 510 nm was acquired by a UV-Vis and Vis instrument (Ultrospec 2100 pro, Biochrom, UK) using a quartz cuvette. For generating the standard curve, a standard solution of 0.100 g/dm3 FeII (Fe (NH4)2(SO4)2·6H2O) was prepared and the iron contents of 0, 10, 20, 30, 40, and 50 μL of the standard solution were determined following the total Fe determination method. The processed data are summarized in Supplementary information, Table S4.

Pull-down assay for the MbnBC and MbnABC complexes

The mbnBC-pET-Duet-1 construct, which results in the co-expression of His6-MbnC and MbnB without a tag, and mbnA-pET-28b* were used for the pull-down assay. The MbnBC complex was applied to a nickel affinity column; the MbnB protein could be pulled down by His6-MbnC. The constructs for the tri-iron binding site mutations of MbnB and mutations of the MbnB and MbnC interface were designed using a strategy similar to that used for the wild-type mbnBC-pET-Duet-1 construct. For reconstitution of the VcMbnABC complex, the VcMbnBC complex was incubated with synthetic VcMbnA in vitro, and then purified by a nickel column. For reconstitution of RrMbnABC and other MbnABC complexes, the mbnBC-pET-Duet-1 and mbnA-pET28b* constructs were co-transformed into E. coli BL21 (DE3) for co-expression, then protein purification was performed as described above.

Far-ultraviolet CD

Far-ultraviolet CD spectra for the wild-type RrMbnBC and MtMbnBC proteins and the RrMbnBC and MtMbnBC mutants were captured between 190 and 260 nm using a Chirascan plus spectropolarimeter (Applied Photophysics, England) at 15 °C. Proteins were thawed in solvent (10 mM Tris-HCl, pH 8.0). The concentrations of proteins were all maintained at 10 µM.

UV-Vis spectroscopy for MbnA activity assays (standard and stopped-flow absorption spectroscopy)

Standard UV-Vis spectra detection was performed on a UV-Vis and Vis instrument (Ultrospec 2100 pro, Biochrom, UK) at room temperature. MtMbnBC and RrMbnBC proteins were adjusted to 5 mg/mL (nearly 100 μM), and VcMbnBC was adjusted to a concentration of 1 mg/mL (nearly 20 μM). The corresponding substrates, VcMbnA, RrMbnA, MtMbnA, and their variants (Supplementary information, Table S5), were dissolved in distilled water and diluted to a working concentration of 5 mM with buffer B. The reaction was initiated when 100 μL MbnBC proteins and 5 μL MbnA peptides were applied to the reaction system, and the reaction was diluted up to 1 mL with buffer B. The mixture was then added into a quartz cuvette and recorded at 20-s intervals for a total of 50 reads at room temperature. For assays using anaerobically prepared MbnBC proteins, the measurements were immediately recorded by adding the anaerobically prepared MbnBC into the reaction system, with peptides pre-mixed in the quartz cuvette. The buffer B used in the assay was O2-saturated at room temperature. For the stopped-flow UV-Vis spectroscopic analysis, 10 μM MtMbnBC or RrMbnBC or 2 μM VcMbnBC was incubated with 250 μM MbnA peptides at room temperature for 1 h, followed by detection on a UV-Vis and Vis instrument (Nanodrop One, Thermo Scientific, MA). Data were processed by Graphpad Prism version 8.3.

MbnBC activity assay followed by H2O2 treatment

H2O2 was first incubated with proteins (VcMbnBC, MtMbnBC, and RrMbnBC) for 5 min and the proteins were further purified by size exclusion chromatography. The H2O2-treated MbnBC complexes were then used for the activity assay.

ITC measurements of MbnA binding affinity

MbnBC and the mutant proteins were all purified using the two-step standard method described above. The purified proteins were adjusted to 1 mg/mL and stored in 25 mM HEPES (pH 8.0) and 100 mM NaCl for ITC measurement. The MbnAs were dissolved and diluted to a working concentration of 2 mM in distilled water. ITC experiments were performed on a Nano ITC (Nano ITC-Low Volume; TA instrument, USA). Settings for the MbnA binding assay were optimized as follows: the titration assay was performed at 16 °C by injecting 2.5 μL MbnA peptide into a full cell containing 190 μL MbnBC or mutant MbnBC proteins every 120 s for a total of 20 injections, and the stirrer syringe stirring speed was set at 250 rpm. For measurement of Cu2+ binding affinity with modified MbnAs, all modified MbnAs were extracted from the enzyme mixtures by size exclusion chromatography except for modified RrMbnA, which was isolated from the co-expressed RrMbnABC complex (the filtrate of 30-kDa centrifugal ultrafiltration tubes). The BCA kit purchased from Suo Laibao Biotechnology Co., Ltd (Beijing, China) was used for determining the concentrations of MbnAs; ~0.2 mM Cu2+ was titrated into 0.01 mM modified MbnAs for the ITC measurement, and the synthesized unmodified MbnAs were used as controls in the assay. The raw titration datasets were processed using the one-site binding mode of the NanoAnalyze Data Analysis software version 3.8.0.

MS analysis

To prepare the samples for MS analysis, the wild-type proteins RrMbnBC and VcMbnBC were separately incubated with synthetic VcMbnA, respectively, to generate the modified VcMbnA products accordingly. The product was applied to an analytic size exclusion chromatography column (Superdex200 Increase 10/300 GL; GE Healthcare, Sweden) to separate the modified MbnAs from the reaction system. Specifically, modified RrMbnA was isolated from the co-expressed RrMbnABC complex as described for ITC sample preparation (the filtrate of 30-kDa centrifugal ultrafiltration tubes). Then, the fractions containing the modified MbnAs were collected and freeze-dried. Lyophilized powder was dissolved in 0.1% formic acid H2O and applied to a C18 ZipTip micro-chromatography desalination column (Millipore, Massachusetts, USA) to remove the existing salts, following the manufacturer’s instructions. The MS assay was performed on an Orbitrap Fusion Lumos mass spectrometer (ThermoFisher Scientific, San Jose, CA, USA) equipped with a nano-ESI ion source providing high-energy collision dissociation (HCD), collision-induced dissociation (CID), and electron-transfer dissociation (ETD) fragmentation analysis. The peptides were separated by an analytical capillary column (100 μm × 15 cm) packed with 3 μm spherical C18 reversed phase material (Dr. Masch GmbH, Germany). An EASY-nLC 1200 (ThermoFisher Scientific, USA) was used to generate the following HPLC gradient: 0%–65% B over 50 min, 50%–80% B over 5 min, and 80% B for 2 min (A = 0.1% formic acid, 99.9% H2O; B = 80% acetonitrile, 20% H2O, 0.1% formic acid). The mass spectrometer was operated in data-dependent mode with one MS scan followed by HCD MS/MS scans and ETHCD (electron-transfer/higher-energy collision dissociation) for each cycle in 3 s at top speed. The original data were analyzed using Thermo Xcalibur QualBrowser and the Thermo Proteome Discoverer 2.5.0.400.

Hybrid cluster-continuum methodology

The transformation of oxazolone/thioamide product in water solution was investigated with hybrid cluster-continuum (HCC) model calculations.[48] This model has previously been used to study chemical reactions in aqueous solutions, such as hydration and hydrolysis reactions,[49-52] yielding thermodynamic properties and mechanistic results comparable to those obtained from more advanced ab initio molecular dynamics (MD) simulations.[53] All of the HCC calculations were performed with the Gaussian 16 software package.[54] The geometries of all of the transition states, reactants, and intermediates involved in the reaction were fully optimized using a hydrated cluster in conjunction with the Solvation Model Based on Density (SMD) continuum solvation model[55] at the level of B3LYP/6-31 G(d) theory. Harmonic frequency calculations were performed using the equilibrium geometries to confirm the existence of first-order saddle points and local minima on the potential energy surfaces and to estimate the zero-point energies, as well as the thermal and entropic corrections. The connections between the stable structures and the transition states were ascertained by analyzing the corresponding imaginary frequency modes, as well as by limited intrinsic reaction coordinate (IRC) calculations. The relative energies of the B3LYP/6-31 G(d)-optimized structures were further refined by single-point calculations at the B3LYP/6-311 + +G(d,p) level. Supplementary Figure S1 Supplementary Figure S2 Supplementary Figure S3 Supplementary Figure S4 Supplementary Figure S5 Supplementary Figure S6 Supplementary Figure S7 Supplementary Figure S8 Supplementary Figure S9 Supplementary Figure S10 Supplementary Figure S11 Supplementary Figure S12 Supplementary Figure S13 Supplementary Figure S14 Supplementary Figure S15 Supplementary Figure S16 Supplementary Figure S17 Supplementary Table S1 Supplementary Table S2 Supplementary Table S3 Supplementary Table S4 Supplementary Table S5 Supplementary Table S6 Supplementary Table S7 Supplementary Table S8 Supplementary Table S9
  44 in total

Review 1.  Copper in microbial pathogenesis: meddling with the metal.

Authors:  Marie I Samanovic; Chen Ding; Dennis J Thiele; K Heran Darwin
Journal:  Cell Host Microbe       Date:  2012-02-16       Impact factor: 21.023

Review 2.  Metalloproteomes: a bioinformatic approach.

Authors:  Claudia Andreini; Ivano Bertini; Antonio Rosato
Journal:  Acc Chem Res       Date:  2009-10-20       Impact factor: 22.384

3.  A microbial peptide to rescue severe and fulminant Wilson disease?

Authors:  Serge Erlinger
Journal:  Clin Res Hepatol Gastroenterol       Date:  2016-10-12       Impact factor: 2.947

Review 4.  Chalkophores.

Authors:  Grace E Kenney; Amy C Rosenzweig
Journal:  Annu Rev Biochem       Date:  2018-04-18       Impact factor: 23.643

5.  Nutrient metal sequestration by calprotectin inhibits bacterial superoxide defense, enhancing neutrophil killing of Staphylococcus aureus.

Authors:  Thomas E Kehl-Fie; Seth Chitayat; M Indriati Hood; Steven Damo; Nicole Restrepo; Carlos Garcia; Kim A Munro; Walter J Chazin; Eric P Skaar
Journal:  Cell Host Microbe       Date:  2011-08-18       Impact factor: 21.023

6.  Iron enzyme ribulose-5-phosphate 3-epimerase in Escherichia coli is rapidly damaged by hydrogen peroxide but can be protected by manganese.

Authors:  Jason M Sobota; James A Imlay
Journal:  Proc Natl Acad Sci U S A       Date:  2011-03-14       Impact factor: 11.205

7.  The alternative aerobic ribonucleotide reductase of Escherichia coli, NrdEF, is a manganese-dependent enzyme that enables cell replication during periods of iron starvation.

Authors:  Julia E Martin; James A Imlay
Journal:  Mol Microbiol       Date:  2011-03-07       Impact factor: 3.501

Review 8.  Iron and microbial infection.

Authors:  Ulrich E Schaible; Stefan H E Kaufmann
Journal:  Nat Rev Microbiol       Date:  2004-12       Impact factor: 60.633

9.  The biogenic methanobactin is an effective chelator for copper in a rat model for Wilson disease.

Authors:  Karl H Summer; Josef Lichtmannegger; Nathan Bandow; Don W Choi; Alan A DiSpirito; Bernhard Michalke
Journal:  J Trace Elem Med Biol       Date:  2011-01-15       Impact factor: 3.849

10.  Manganese import is a key element of the OxyR response to hydrogen peroxide in Escherichia coli.

Authors:  Adil Anjem; Shery Varghese; James A Imlay
Journal:  Mol Microbiol       Date:  2009-04-21       Impact factor: 3.501

View more
  4 in total

1.  Substrate Recognition by the Peptidyl-(S)-2-mercaptoglycine Synthase TglHI during 3-Thiaglutamate Biosynthesis.

Authors:  Martin I McLaughlin; Yue Yu; Wilfred A van der Donk
Journal:  ACS Chem Biol       Date:  2022-04-01       Impact factor: 4.634

2.  Comprehensive multiomics analysis of cuproptosis-related gene characteristics in hepatocellular carcinoma.

Authors:  Jie Fu; Sixue Wang; Zhenghao Li; Wei Qin; Qing Tong; Chun Liu; Zicheng Wang; Zhiqiang Liu; Xundi Xu
Journal:  Front Genet       Date:  2022-09-06       Impact factor: 4.772

3.  Mechanistic Studies on Dehydration in Class V Lanthipeptides.

Authors:  Haoqian Liang; Isaiah J Lopez; Marina Sánchez-Hidalgo; Olga Genilloud; Wilfred A van der Donk
Journal:  ACS Chem Biol       Date:  2022-08-31       Impact factor: 4.634

4.  A mixed-valent Fe(II)Fe(III) species converts cysteine to an oxazolone/thioamide pair in methanobactin biosynthesis.

Authors:  Yun Ji Park; Richard J Jodts; Jeffrey W Slater; Reyvin M Reyes; Valerie J Winton; Rana A Montaser; Paul M Thomas; William B Dowdle; Anahi Ruiz; Neil L Kelleher; J Martin Bollinger; Carsten Krebs; Brian M Hoffman; Amy C Rosenzweig
Journal:  Proc Natl Acad Sci U S A       Date:  2022-03-23       Impact factor: 12.779

  4 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.