Literature DB >> 35102894

Crystal structure of a hypothetical protein from Giardia lamblia.

Dylan K Beard1, Seonna Bristol1, Kayla Cosby1, Amber Davis1, Courtney Manning1, Lionel Perry1, Lauren Snapp1, Arian Toy1, Kayla Wheeler1, Jeremy Young1, Bart Staker2, Tracy L Arakaki3, Jan Abendroth2, Sandhya Subrahamanian2, Thomas E Edwards2, Peter J Myler4, Oluwatoyin A Asojo1.   

Abstract

Giardiasis is the most prevalent diarrheal disease globally and affects humans and animals. It is a significant problem in developing countries, the number one cause of travelers' diarrhea and affects children and immunocompromised individuals, especially HIV-infected individuals. Giardiasis is treated with antibiotics (tinidazole and metronidazole) that are also used for other infections such as trichomoniasis. The ongoing search for new therapeutics for giardiasis includes characterizing the structure and function of proteins from the causative protozoan Giardia lamblia. These proteins include hypothetical proteins that share 30% sequence identity or less with proteins of known structure. Here, the atomic resolution structure of a 15.6 kDa protein was determined by molecular replacement. The structure has the two-layer αβ-sandwich topology observed in the prototypical endoribonucleases L-PSPs (liver perchloric acid-soluble proteins) with conserved allosteric active sites containing small molecules from the crystallization solution. This article is an educational collaboration between Hampton University and the Seattle Structural Genomics Center for Infectious Disease. open access.

Entities:  

Keywords:  SSGCID; giardiasis; infectious diseases; structural genomics; travelers' diarrhea; undergraduate education and training

Mesh:

Substances:

Year:  2022        PMID: 35102894      PMCID: PMC8805217          DOI: 10.1107/S2053230X21013595

Source DB:  PubMed          Journal:  Acta Crystallogr F Struct Biol Commun        ISSN: 2053-230X            Impact factor:   1.056


Introduction

The flagellated protozoa Giardia lamblia is the most commonly identified intestinal parasite globally, causing giardiasis, otherwise known as travelers’ diarrhea (Daniels et al., 2015 ▸; Escobedo et al., 2015 ▸). Giardiasis is a zoonotic infection, and Giardia species have been isolated from the stools of vertebrates, including mammals, amphibians and birds (Thompson, 2013 ▸). Giardia is an endemic neglected tropical disease, and outbreaks of giardiasis from contaminated water or food sources are common in developing countries because of poor sanitation (McIntyre et al., 2014 ▸). It only takes ∼10 Giardia cysts to cause infection, and in developed countries giardiasis is more common among children and hospital patients, especially immunocompromised individuals and institutionalized patients (Huang & White, 2006 ▸). The current standard treatment for giardiasis is antibiotic therapy using tinidazole and metronidazole (Lobovská & Nohýnková, 2003 ▸). Characterizing the structures and functions of G. lamblia proteins is the first step towards identifying new therapeutics for giardiasis. G. lamblia is one of the organisms selected by the Seattle Structural Genomics Center for Infectious Disease (SSGCID) for high-throughput structural studies, and hypothetical proteins have been identified with limited sequence similarity to proteins of known function. One of these hypothetical proteins is a 141-amino-acid protein (UniProt ID A8BD71, XP_001707732.1). This protein shares over 30% sequence identity and 50% coverage with only two unique proteins in the Protein Data Bank. One of these proteins is a putative endonuclease from Entamoeba histolytica (PDB entries 3mqw, 3m1x and 3m4s; 36% sequence identity and 56% coverage; Seattle Structural Genomics Center for Infectious Disease, unpublished work). The other comprises the amino-terminal residues 13–121 of Saccharomyces cerevisiae mitochondrial matrix protein Mmf1 (PDB entry 3quw), with 30% sequence identity and 77% coverage (Pu et al., 2011 ▸). A BLAST search against all redundant Giardia sequences reveals three proteins that share appreciable sequence similarity with this hypo­thetical protein: EFO62390.1, the hypothetical protein GLP15_656 from G. lamblia P15, EET01624.1, the hypo­thetical protein GL50581_1093 from G. intestinalis ATCC 50581, and ESU43034.1, a putative YjgF/YER057c/UK114 family protein from G. intestinalis (Fig. 1 ▸). Here, we present the atomic resolution crystal structure of this hypothetical protein as a first step towards clarifying its possible functions.
Figure 1

Structural and primary-sequence alignment of the hypothetical protein from G. lamblia (GilaA.00312.a) with EFO62390.1, the hypothetical protein GLP15_656 from G. lamblia P15, EET01624.1, the hypothetical protein GL50581_1093 from G. intestinalis ATCC 50581, and ESU43034.1, a putative YjgF/YER057c/UK114 family protein from G. intestinalis. The secondary-structure elements shown are α-helices (α), 310-helices (η), β-strands (β) and β-turns (TT). Identical residues are shown in white on a red background and conserved residues are shown in red. This figure was generated using ESPript (Gouet et al., 1999 ▸, 2003 ▸).

Materials and methods

Macromolecule production

The protein was cloned, expressed and purified following standard protocols of the Seattle Structural Genomics Center for Infectious Disease (SSGCID; Bryan et al., 2011 ▸; Choi et al., 2011 ▸; Serbzhinskiy et al., 2015 ▸). Briefly, genomic DNA from G. lamblia GL50803_14299 was provided by Dr Ethan Merritt, University of Washington. DNA encoding amino acids 1–141 (UniProt A8BD71) of G. lamblia GL50803_14299 was PCR-amplified from genomic DNA using the primers shown in Table 1 ▸. The PCR product was cloned into expression vector pAVA0421 (Choi et al., 2011 ▸) by ligation-independent cloning (LIC; Aslanidis & de Jong, 1990 ▸). The final expression vector includes a cleavable 6×His fusion tag followed by the human rhinovirus 3C protease-cleavage sequence (MAHHHHHHMGTLEAQTQGPGS-ORF). The underlined glutamine (Q) and glycine (G) residues denote the 3C cleavage site. Plasmid DNA was transformed into chemically competent Escherichia coli BL21(DE3)R3 Rosetta cells. The cells were tested for expression and 2 l of culture was grown using auto-induction medium (Studier, 2005 ▸) in a LEX Bioreactor (Epiphyte Three Inc.). The expression clone was assigned the SSGCID target identifier GilaA.00312.a.
Table 1

Macromolecule-production information

Source organism Giardia lamblia GL50803_14299
DNA sourceGenomic DNA from Dr Ethan A. Merritt, University of Washington
Forward primer GGGTCCTGGTTCGATGTTGACGGACTATCGCATCCG
Reverse primer CTTGTTCGTGCTGTTTATTATACGAGGATGGTCCAGCAATCG
Cloning vectorpAVA0421
Expression vectorpAVA0421
Expression host E. coli BL21(DE3)R3 Rosetta
Complete amino-acid sequence of the construct produced MAHHHHHHMGTLEAQTQGPGSMIYGILSKNLGMPTPTFLVCPDVVKFENVGQIAVVNGMVYLGGSVGIDKSGTLHKGLEEQTRQTFDNIRKCLEYANSGLDYIVSLNIFLSTSLSDSEEARFNELYREVFCVPATRPCRCCVRAQLQEGLLVEVVNVVAAQK
Amino-acid sequence after 3C protease cleavage GPGSMIYGILSKNLGMPTPTFLVCPDVVKFENVGQIAVVNGMVYLGGSVGIDKSGTLHKGLEEQTRQTFDNIRKCLEYANSGLDYIVSLNIFLSTSLSDSEEARFNELYREVFCVPATRPCRCCVRAQLQEGLLVEVVNVVAAQK
Both the expression clone and purified protein are available at https://www.ssgcid.org/available-materials/. The recombinant protein was purified using a four-step protocol consisting of an Ni2+-affinity chromatography (IMAC) step, cleavage of the N-terminal histidine tag with 3C protease, reverse capture with a second Ni2+-affinity chromatography column and size-exclusion chromatography (SEC). All chromatography runs were performed on an ÄKTA­purifier 10 (GE) using automated IMAC and SEC programs according to previously described procedures (Bryan et al., 2011 ▸). The final SEC was performed on a HiLoad 26/600 Superdex 75 column (GE Healthcare) using a mobile phase consisting of 500 mM NaCl, 25 mM HEPES, 5% glycerol, 0.025% azide, 2 mM DTT pH 7.0. Peak fractions were pooled and analyzed using SDS–PAGE. The peak fractions were concentrated to 30.5 mg ml−1 using an Amicon purification system (Millipore). Aliquots of 200 µl were flash-frozen in liquid nitrogen and stored at −80°C until use for crystallization.

Crystallization

Crystals were grown following established crystallization approaches at the SSGCID. Briefly, recombinant GilaA.00312.a was diluted to 13.46 mg ml−1. Protein concentration was assessed using the OD280 with a molar extinction coefficient of 7450 M −1 cm−1. Single crystals were obtained by vapor diffusion in sitting drops using equal volumes of protein solution and precipitant solution equilibrated against a reservoir containing precipitant solution (Table 2 ▸).
Table 2

Crystallization

MethodSitting-drop vapor diffusion
Plate type96-well Compact 300, Rigaku
Temperature (K)290
Protein concentration (mg ml−1)13.46
Buffer composition of protein solution20 mM HEPES pH 7.0, 300 mM NaCl, 5% glycerol, 1 mM TCEP
Composition of reservoir solution100 mM Tris pH 5.5, 25%(w/v) PEG 3350, 200 mM ammonium acetate
Volume and ratio of drop0.4 µl protein solution plus 0.4 µl reservoir solution
Volume of reservoir (µl)80

Data collection and processing

Data collection and processing were performed using established protocols at the SSGCID. Specifically, a single crystal was transferred into cryosolution (buffer solution plus 20% ethylene glycol), flash-cooled in liquid nitrogen and transferred into a puck for data collection on APS beamline 21-ID-F. Data were processed using XDS/XSCALE (Kabsch, 2010 ▸). Additional data-collection information is provided in Table 3 ▸.
Table 3

Data collection and processing

Values in parentheses are for the outer shell.

Diffraction sourceSSRL beamline BL12-2
Wavelength (Å)0.9795
Temperature (K)100
DetectorADSC Quantum 315R CCD
Space group I4122
a, b, c (Å)119.90, 119.90, 104.59
α, β, γ (°)90, 90, 90
Resolution range (Å) 39.41–1.35 (1.42–1.35)
No. of unique reflections82643 (5692)
Completeness (%)99.50 (96.60)
Multiplicity6.30 (4.80)
I/σ(I)〉13.50
R r.i.m. 0.081 (5.40)
Overall B factor from Wilson plot (Å2)14.0

Estimated R r.i.m. = R merge[N/(N − 1)]1/2, where N is the data multiplicity.

Structure solution and refinement

The structure was solved by molecular replacement using MOLREP (Lebedev et al., 2008 ▸; Vagin & Teplyakov, 2010 ▸) with the structure of yeast mitochondrial matrix factor 1 (PDB entry 1jd1; Deaconescu et al., 2002 ▸) as the search model. Initial refinement was carried out with REFMAC (Murshudov et al., 2011 ▸) with TLS, with manual refinement in Coot (Emsley & Cowtan, 2004 ▸; Emsley et al., 2010 ▸). The structure quality was checked by MolProbity (Headd et al., 2009 ▸) and the resulting structure-refinement data are provided in Table 4 ▸.
Table 4

Structure solution and refinement

Values in parentheses are for the outer shell.

Resolution range (Å)37.35–1.35 (1.38–1.35)
Completeness (%)99.6
No. of reflections, working set82626 (5432)
No. of reflections, test set4134 (260)
Final R cryst 0.176 (0.255)
Final R free 0.191 (0.264)
Cruickshank DPI0.056
No. of non-H atoms
 Protein2971
 Ions0
 Ligand20
 Water443
 Total3434
R.m.s. deviations
 Bonds (Å)0.004
 Angles (°)0.893
Average B factors (Å2)
 Protein13.5
 Ligands18.5
 Water23.7
Ramachandran plot
 Most favored (%)97.81
 Allowed (%)2.19
 Outlier (%)0

Results and discussion

Each monomer of the hypothetical G. lamblia protein (GilaA.00312.a; PDB entry 3i3f) folds as a two-layer αβ sandwich. The quaternary structure is a homotrimer stabilized by seven hydrogen bonds and 99 nonbonded contacts per monomer. The trimer forms a β-barrel with core β-sheets surrounded by α-helices (Fig. 2 ▸ a). The largest interface between the monomers contains electron density for small molecules, which we built as two molecules of pentanoic acid and one of butanoic acid. The ligands have sufficient electron density, as indicated by composite omit maps (Supplementary Fig. S1), and their B factors are consistent with the contacting protein atoms. It is plausible that these ligands have dual conformations or could have been built with other small molecules (Supplementary Figs. S1 and S2). Nonetheless, the significance of these molecules is that they sit in the largest clefts in the structure. These largest clefts have volumes of ∼1850 Å3 and are consistent with the allosteric sites observed in other endoribonucleases.
Figure 2

Structure of GilaA.00312.a (PDB entry 3i3f). (a) A GilaA.00312.a trimer with one monomer shown as a white surface; the identical residues in similar proteins are shown in red. (b) Alternative view of the trimer showing the unique insertion found in GilaA.00312.a as gold sticks. Endoribonuclease allosteric sites are identified by the modeled ligands in ball-and-stick representation. (c) Superposition of the GilaA.00312.a monomer (aquamarine) on the closest structures (gray). (d) A GilaA.00312.a trimer (aquamarine) superposed on the closest structures (gray). (e) ENDScript alignment of the closest structures. The secondary-structure elements shown are α-helices (α), 310-helices (η), β-strands (β) and β-turns (TT). Identical residues are shown in red and similar residues in yellow. The same structures are used in (c), (d) and (e).

ENDScript (Gouet et al., 2003 ▸; Robert & Gouet, 2014 ▸) analysis was used to identify the most similar structures to GilaA.00312.a (Fig. 2 ▸). The most similar structures identified from the analysis were those of YabJ from Bacillus subtilis (PDB entries 5y6u, 1qd9 and 7cd2; Sinha et al., 1999 ▸; Fujimoto et al., 2021 ▸). A conserved hypothetical protein from Clostridium thermocellum Cth-2968 (PDB entry 1xrg) was identified as the next closest structure. Other similar structures include Saccharomyces cerevisiae homologous mitochondrial matrix factor 1 (PDB entry 1jd1; Deaconescu et al., 2002 ▸), a putative translation-initiation inhibitor PH0854 from Pyrococcus horikoshii (PDB entry 2dyy), a putative endonuclease from Entamoeba histolyca (PDB entry 3mqw), Saccharomyces cerevisiae mitochondrial matrix protein Mmf1 (PDB entry 3quw; Pu et al., 2011 ▸), TTHA0137 from Thermus thermophilus HB8 (PDB entry 2csl) and RidA from the Antarctic bacterium Psychrobacter sp. (PDB entry 6l8p; Kwon et al., 2020 ▸). The similar structures identified by ENDScript analysis belong to the YjgF/YER057c/UK114 family of endoribonucleases with L-PSP topology (Kim et al., 2018 ▸; Zhang et al., 2010 ▸; Volz, 1999 ▸). Structural analysis with PDBeFold (http://www.ebi.ac.uk/msd-srv/ssm/; Krissinel & Henrick, 2004 ▸) and the DALI server (http://ekhidna2.biocenter.helsinki.fi/dali/; Holm, 2020 ▸) confirms that GilaA.00312.a has the structural features of the YjgF/YER057c/UK114 family of endoribo­nucleases (Figs. 2 ▸ and 3 ▸). Detailed results of the DALI and PDBeFold analysis are included in the supporting information.
Figure 3

Structural and primary-sequence alignment of GilaA.00312.a and structurally similar YjgF/YER057c/UK114 endoribonucleases. The secondary-structure elements are shown as follows: α-helices are shown as large coils, 310-helices ae shown as small coils labeled η, β-strands are shown as arrows labeled β and β-turns are labeled TT. Identical residues are shown on a red background; conserved residues are shown in red and conserved regions in blue boxes. This figure was generated using ESPript (Gouet et al., 1999 ▸, 2003 ▸).

The YjgF/YER057c/UK114 family of endoribonucleases belong to the superfamily of proteins known as endoribo­nuclease L-PSP/chorismate mutase-like (IPR013813). These are homotrimeric proteins in which the intermolecular cavity forms putative allosteric binding sites for small molecules (Mistiniene et al., 2003 ▸; Burman et al., 2003 ▸, 2007 ▸; Miyakawa et al., 2006 ▸). The superfamily includes two broadly defined families: YjgF/YER057c/UK114 and AroH chorismate mutases. The YjgF/YER057c/UK114 family are found in bacteria, archaea and eukaryotes (Lambrecht et al., 2012 ▸), while AroH chorismate mutases are only found in bacteria. Specific members of the superfamily are YjgF (which was renamed RidA), which is known to deaminate reactive enamine/imine intermediates in pyridoxal 5′-phosphate (PLP)-dependent enzyme reactions (Lambrecht et al., 2012 ▸), and the yeast growth inhibitor YER057c, which has roles in the regulation of metabolic pathways and cell differentiation (Kim et al., 2001 ▸). Other members include UK114/L-PSP (liver perchloric acid-soluble protein), mammalian translational inhibitor proteins and endoribonucleases that directly affect mRNA translation by inducing disaggregation of the reticulo­cyte polysomes into 80S ribosomes (Morishita et al., 1999 ▸). RutC is essential for the ability of E. coli to use uracil as a sole nitrogen source and possibly by reducing aminoacrylate peracid to aminoacrylate (Kim et al., 2010 ▸), while B. subtilis YabJ is required for adenine-mediated repression of purine-biosynthetic genes (Sinha et al., 1999 ▸). The structural neighbors of GilaA.00312.a are all members of the YjgF/YER057c/UK114 family and the overall structural topology is well conserved (Figs. 2 ▸ and 3 ▸). These closest structures share less than 32.1% sequence with GilaA.00312.a (Fig. 3 ▸). GilaA.00312.a has a unique insertion of three residues (LSD) that differentiates it from its structural neighbors (Fig. 2 ▸). These residues follow Ser92 in the loop preceding α-helix 2 and form part of the access to the allosteric binding cavity of GilaA.00312.a (Figs. 2 ▸ and 3 ▸). Furthermore, the allosteric site of GilaA.00312.a differs from the conserved topology of its structural neighbors (Figs. 2 ▸ and 3 ▸). The significance of this observation will be investigated further since experimental evidence indicate that the metabolic functions of endoribo­nucleases are mediated by the allosteric site (Niehaus et al., 2015 ▸).

Closing remarks

The structure of a hypothetical protein from G. lamblia (GilaA.00312.a) suggests that it belongs to the YjgF/YER057c/UK114 family, forming a trimer with allosteric active sites. Future studies are required to determine the ligands that bind to GilaA.00312.a and the specific mechanisms of its functions in the light of the observed unique structural features in its allosteric binding site. PDB reference: hypothetical protein from Supplementary data including Supplementary Figures,. DOI: 10.1107/S2053230X21013595/ft5116sup1.pdf
  37 in total

1.  A test case for structure-based functional assignment: the 1.2 A crystal structure of the yjgF gene product from Escherichia coli.

Authors:  K Volz
Journal:  Protein Sci       Date:  1999-11       Impact factor: 6.725

2.  A member of the YER057c/yjgf/Uk114 family links isoleucine biosynthesis and intact mitochondria maintenance in Saccharomyces cerevisiae.

Authors:  J M Kim; H Yoshikawa; K Shirahige
Journal:  Genes Cells       Date:  2001-06       Impact factor: 1.891

3.  Crystal structures and putative interface of Saccharomyces cerevisiae mitochondrial matrix proteins Mmf1 and Mam33.

Authors:  You-Guang Pu; Yong-Liang Jiang; Xiao-Dong Ye; Xiao-Xiao Ma; Peng-Chao Guo; Fu-Ming Lian; Yan-Bin Teng; Yuxing Chen; Cong-Zhao Zhou
Journal:  J Struct Biol       Date:  2011-05-12       Impact factor: 2.867

4.  Ribonuclease activity of rat liver perchloric acid-soluble protein, a potent inhibitor of protein synthesis.

Authors:  R Morishita; A Kawagoshi; T Sawasaki; K Madin; T Ogasawara; T Oka; Y Endo
Journal:  J Biol Chem       Date:  1999-07-16       Impact factor: 5.157

5.  The Rut pathway for pyrimidine degradation: novel chemistry and toxicity problems.

Authors:  Kwang-Seo Kim; Jeffrey G Pelton; William B Inwood; Ulla Andersen; Sydney Kustu; David E Wemmer
Journal:  J Bacteriol       Date:  2010-04-16       Impact factor: 3.490

6.  Features and development of Coot.

Authors:  P Emsley; B Lohkamp; W G Scott; K Cowtan
Journal:  Acta Crystallogr D Biol Crystallogr       Date:  2010-03-24

7.  REFMAC5 for the refinement of macromolecular crystal structures.

Authors:  Garib N Murshudov; Pavol Skubák; Andrey A Lebedev; Navraj S Pannu; Roberto A Steiner; Robert A Nicholls; Martyn D Winn; Fei Long; Alexei A Vagin
Journal:  Acta Crystallogr D Biol Crystallogr       Date:  2011-03-18

8.  Immobilized metal-affinity chromatography protein-recovery screening is predictive of crystallographic structure success.

Authors:  Ryan Choi; Angela Kelley; David Leibly; Stephen Nakazawa Hewitt; Alberto Napuli; Wesley Van Voorhis
Journal:  Acta Crystallogr Sect F Struct Biol Cryst Commun       Date:  2011-08-13

9.  Model preparation in MOLREP and examples of model improvement using X-ray data.

Authors:  Andrey A Lebedev; Alexei A Vagin; Garib N Murshudov
Journal:  Acta Crystallogr D Biol Crystallogr       Date:  2007-12-05

10.  A novel chlorination-induced ribonuclease YabJ from Staphylococcus aureus.

Authors:  Hyo Jung Kim; Ae-Ran Kwon; Bong-Jin Lee
Journal:  Biosci Rep       Date:  2018-10-17       Impact factor: 3.840

View more
  1 in total

1.  Crystal structure of a hypothetical protein from Giardia lamblia. Corrigendum.

Authors:  Dylan K Beard; Seonna Bristol; Kayla Cosby; Amber Davis; Courtney Manning; Lionel Perry; Lauren Snapp; Arian Toy; Kayla Wheeler; Jeremy Young; Bart Staker; Tracy L Arakaki; Jan Abendroth; Sandhya Subramanian; Thomas E Edwards; Peter J Myler; Oluwatoyin A Asojo
Journal:  Acta Crystallogr F Struct Biol Commun       Date:  2022-02-28       Impact factor: 1.056

  1 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.