Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is the virus that causes the coronavirus disease (COVID-19). It is confirmed that nucleocapsid (N) protein is closely related to viral pathogenesis, modulation of host immune response, RNA transcription, and replication and virus packaging. Therefore, the N protein is a preponderant antigen target for virus detection. The codon-optimized N gene was designed according to the encoding characteristics of insect cells and inserted into pFastBacTM1 vector with 6 × His-tag-fused N protein for expression in insect sf21 cells. Six anti-N mAbs (4G3, 5B3, 12B6, 18C7-A2, 21H10-A3, 21H10-E9) were prepared by recombinant N protein. The mAbs showed high titers, antibody affinity, and reactivity with the SARS-CoV-2 N protein. Then, fourteen overlapped peptides that covered the intact N protein were synthesized (N1-N14). Peptide N14 was identified as the main linear B-cell epitope region via peptide-ELISA and dot-blot assay, and this region was truncated gradually until mapping the peptide 401-DFSKQLQQ-408. Simultaneously, compared with the sequence of variants of concern (VOCs) and variants of interest (VOIs) strains among the several countries, epitope 401-DFSKQLQQ-408 is very conservative among them. The findings provide new guidance for the design and detection of COVID-19 targets. KEY POINTS: • The N protein was optimized according to the insect cell codon preference and was highly expressed. • The monoclonal antibodies prepared in this study were shown high antibody titers and high affinity. • Monoclonal antibodies were used to map the epitope 401-408 amino acids of N protein for the first time in this study.
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is the virus that causes the coronavirus disease (COVID-19). It is confirmed that nucleocapsid (N) protein is closely related to viral pathogenesis, modulation of host immune response, RNA transcription, and replication and virus packaging. Therefore, the N protein is a preponderant antigen target for virus detection. The codon-optimized N gene was designed according to the encoding characteristics of insect cells and inserted into pFastBacTM1 vector with 6 × His-tag-fused N protein for expression in insect sf21 cells. Six anti-N mAbs (4G3, 5B3, 12B6, 18C7-A2, 21H10-A3, 21H10-E9) were prepared by recombinant N protein. The mAbs showed high titers, antibody affinity, and reactivity with the SARS-CoV-2 N protein. Then, fourteen overlapped peptides that covered the intact N protein were synthesized (N1-N14). Peptide N14 was identified as the main linear B-cell epitope region via peptide-ELISA and dot-blot assay, and this region was truncated gradually until mapping the peptide 401-DFSKQLQQ-408. Simultaneously, compared with the sequence of variants of concern (VOCs) and variants of interest (VOIs) strains among the several countries, epitope 401-DFSKQLQQ-408 is very conservative among them. The findings provide new guidance for the design and detection of COVID-19 targets. KEY POINTS: • The N protein was optimized according to the insect cell codon preference and was highly expressed. • The monoclonal antibodies prepared in this study were shown high antibody titers and high affinity. • Monoclonal antibodies were used to map the epitope 401-408 amino acids of N protein for the first time in this study.
A novel type of coronavirus caused a pneumonia large area outbreak and epidemic around the world (Zhu et al. 2020b; Wu et al. 2020a). According to research, the virus has a strong capacity to spread from person to person (Chan et al. 2020). On January 12, 2020, the novel pneumonia was named 2019-nCoV (later renamed COVID-19) by the World Health Organization (Gorbalenya et al. 2020). Sequencing the genome of the virus that generated COVID-19 showed that it is related to SARS-CoV that caused the outbreak in 2002. On February 11, based on its phylogenetic similarity to SARS-CoV (de Groot et al. 2012), the new coronavirus was named SARS-CoV-2. The clinical manifestations of patients with COVID-19 are mainly fever, malaise, fatigue, soreness, dry cough, and even chest tightness, dyspnea (Huang et al. 2020a). The virus has a very high transmission and infection rate in the pre-symptomatic phase. The COVID-19 constitutes global public health security and a great threat (Liu et al. 2020; Hu et al. 2020).SARS-CoV-2 is a kind of enveloped coronavirus with round virus particles and coronal arrangement of fibrils around it, which are distributed in the cytoplasm, positive single-stranded RNA virus with a genome length of approximately 30 kb (Huang et al. 2020b). There is a methylated cap structure at the 5′end and a poly-A tail structure at the 3′end of the virus genome; the coding region contains the open reading frame (ORF) and other auxiliary genes common to coronaviruses. The ORF encodes viral structural proteins mainly including spike (S) protein, nucleocapsid (N) protein, envelope (E) protein and membrane (M) protein (Zhou et al. 2020). Among them, N protein is a phosphoprotein and composed of 418 amino acid residues, located in the nucleus. The N protein mainly contains two globular domains, the N- and C-terminal domains (NTD and CTD, respectively), surrounded by intrinsically disordered regions. N protein is highly basic (pI ~ 10), and multiple RNA-binding sites are found throughout the protein (Kang et al. 2020). The NTD is an RNA-binding domain. The CTD forms a tightly linked dimer with a large RNA-binding groove. The nucleocapsid is the most abundant protein in coronaviruses and its amino acid sequence is largely conserved as previously reported (Tilocca et al. 2020). Despite it being located within the viral particle rather than on its surface, patients infected with SARS-CoV-2 showed higher and earlier antibody responses to the nucleocapsid protein than to the surface spike protein (Burbelo, et al. 2020). Previous studies had reported on SARS-CoV N protein epitopes as capable of eliciting massive production of antibodies in infected subjects (Tilocca et al. 2020). Similar to the function of SARS-CoV, the N protein acts a pivotal part in the pathogenesis. For example, it can form nucleocapsid with viral genome RNA (Zhu et al. 2020a; Snijder et al. 2003), participate in viral genome replication and particle assembly, may bind to host SMcAD3 and regulate transforming growth factor-beta signaling (Stertz et al. 2006), and has strong immunogenicity, which can induce the body to produce a high level of immune response (Zhao et al. 2008). N protein is highly conserved and strong antigenic in CoVs; 89% of the SARS patients induced the antigen–antibody. On the other hand, other studies have shown that the N protein immunization did not lead to the production of neutralizing antibodies; in essence, however, due to its strong immunogenicity, N protein can be used as a diagnostic test target protein. S protein is a key protein that mediates virus invasion into target cells and induces the production of antiviral neutralizing antibodies. S protein was cleaved into S1 and S2 parts. However, S1 is highly variable, and there are significant differences among different viruses or different strains of the same virus. Furthermore, in comparison with other structural proteins, N protein has the highest expression content among the structural proteins during the infection and it can be highly detected in infected patients (Wu et al. 2004a; Zhang et al. 2011), which make it to be an antigen for diagnostic antibody (Egger et al. 2020). Therefore, both N protein and antibodies against it are all important detection targets for SARS-CoV-2 infection.Epitopes are the basis of protein antigenicity. Accurate and detailed mapping of the epitopes of protein is very important for the diagnosis and prognosis of diseases, the design of vaccine molecular structure, and immune intervention therapy (Li et al. 2003). According to the characteristics of B cell epitopes, it is an easy application and economical method to predict antigen epitopes in advance, and then to synthesize peptides and verify them in experiments (Luo et al. 2015). Among them, spikes protein has several mutation hotspots, while nucleocapsid protein is more stable (Chen et al. 2020a). The study of epitopes is of great significance in basic etiology, immunology, pharmacology, and preventive medicine, as well as a clinical diagnosis.
Materials and methods
Gene, cells, and animals
Based on the original SARS-CoV-2, N protein sequence (GenBank accession No. QOQ37303.1) was acquired from the NCBI, the design was greatly improved, and the codon-optimized N protein gene was designed according to the encoding characteristics of insect cells (Figure S1). The eukaryotic expression vector was pFastBacTM1, the restriction enzyme cutting sites were BamHI and XbaI, and the recombinant plasmid was synthesized by Sangon Biotech (Shanghai) Co., Ltd. (China). The sequence of SARS-CoV N (GenBank accession No. NP_828858.1) and MERS-CoV N (GenBank accession No. ATG84884.1) protein were also expressed in insect cells. The competent cell Escherichia coli DH10Bac and competent cell Escherichia coli DH5α were purchased from Beijing Biomed Genomics Central Co., Ltd. (China). The myeloma SP2/0 and sf21 insect cells were stored in our laboratory. Human embryonic kidney 293 T (HEK293T) cells were obtained from ATCC (Manassas, VA, USA). BALB/c mice were purchased from Henan Sikebesi Biological Technology Co. LTD (Henan, China).
Construction and expression of N protein
The recombinant plasmid of N protein was designed with secretory expression signal peptide and C-terminal 6 × His label. The plasmid was transformed into Escherichia coli DH10Bac competent cell and positive clones that are recombinant Bacmid were obtained by blue-white screening. The recombinant baculovirus stock was obtained from sf21 cell culture supernatant after transfection 72 h, then infection sf21 cells with the harvested recombinant baculovirus stock again up to three cycles. Then amplify the baculoviral stock and protein expression. The cell supernatant in culture was collected and bound into Ni Sepharose™ excel affinity column (His Trap ™ excel, GE). Following washed with gradient washing buffers (25 mM Tris–HCl pH 8.0, 50 mM NaCl, 10, 20, and 50 mM Imidazole). The N protein was eluted with elution buffer (25 mM Tris–HCl pH 8.0, 50 mM NaCl, 200 mM Imidazole). The N protein was also expressed in the prokaryotic system (Escherichia coli BL21 (DE3) cells) for follow-up work. The purification method is the same as above.
Animal immunization and hybridoma cell production
Five female BALB/c mice were immunized with N protein expressed in sf21 cells. The immunization strategy is subcutaneous multipoint injection with purified N protein. The immunization dose is a 200 μL emulsion containing 4.5 μg antigen mixed with Freund’s complete adjuvant. Three booster immunizations were given at the same dose at every 3-week interval. Blood samples were collected for antibody titer determination. The mouse with the highest titer was given the last booster immunization intraperitoneally. Then it was euthanized through carbon dioxide (CO2) inhalation. The spleen cells were fused with SP2/0 that cells are round, transparent and grow exponentially, more adherent and less suspended using the PEG-1500 (Sigma-Aldrich, USA). The fused cells were resuspended in a HAT selection medium containing 10% Fetal Bovine Serum (Sigma-Aldrich, USA) and transferred into 96-well culture plates and grew in a specified incubator (Thermo Fisher Scientific, USA) with 5% CO2 at 37 °C. After cell fusion 7–10 days, the positive hybridomas were screened by indirect ELISA. In the middle, HT medium was used to replace HAT medium to continue screening positive hybridoma cells. Positive hybridoma cells were sub-cloned two to three cycles via the finite dilution method (Oliveria et al. 2020; Li et al. 2013).
Preparation and characterization of monoclonal antibodies
All antibodies were prepared from ascites in mice. To be specific, Freund's incomplete adjuvant was injected into the abdominal cavity of old BALB/c mice (500 uL per mouse) when one week before injection of hybridoma culture suspensions (1 × 106 hybridoma cells). Seven days after hybridoma injection, ascites were collected, then purification by N-octanoic acid and saturated ammonium sulfate precipitation, successively. The SDS-PAGE was used to analyze the purified N mAbs. We identified the isotype of mAbs of the screened by the Mouse Monoclonal antibody Subtype Identification Kit (Proteintech, USA). Mouse monoclonal antibody-specific subtypes include heavy chain (IgG1, IgG2a, IgG2b, IgG2c, IgG3, and IgM) and light chain (Kappa and Lambda), the operation was carried out according to the manufacture's instruction (Wang et al. 2020b).
Indirect ELISA and western blot
The titer of monoclonal antibodies and screening of positive clonal hybridoma cell lines were determined by indirect ELISA. The N protein as coating antigen that was coated on 96-well plates diluted to 1 μg / mL with carbonate buffer (0.05 M sodium carbonate–sodium bicarbonate, pH 9.6) incubated at 4 °C overnight. The coated plates were washed by PBST (1 × PBS with 0.05% Tween 20, pH 7.4) for 3–4 times and were blocked with 5% skimmed milk at 37 °C for 1 h. Primary antibody (immunized mice serum or culture medium of N monoclonal antibody-contained or different dilutions of purified N monoclonal antibodies) were incubated at 37 °C for 30 min and the HRP-conjugated Affinipure Goat Anti-Mouse IgG(H + L) (Proteintech, USA, Cat No. SA00001-1) were as the secondary antibody incubated at 37 °C for 30 min. After washing the plates, the reaction was stopped by a stop solution (2 mol/ L H2SO4). The optical density (OD) values were determined at 450 nm via a microplate reader.The specificity of mAbs against the N-His fusion protein and the expression of N-His fusion protein were verified by western blot. The N protein was performed by SDS-PAGE and the protein gel was transferred onto a PVDF membrane with tris–glycine transfer buffer (39 mM glycine, 48 mM tris, 1.28 mM SDS, 20% methanol), blocked (PBST with 0.5% skimmed milk), and then incubated with HRP conjugated 6*His-Tag Monoclonal Antibody (Proteintech, USA, Cat No. HRP-66005) or mouse anti-N monoclonal antibodies antiserum at room temperature for 1 h. The Goat anti-Mouse poly-HRP antibody (Proteintech, USA, Cat No. SA00001-1) was used as the secondary antibody. After, the PVDF membrane was washed, mixed with ECL chemiluminescence reagents, and then imaged on a chemiluminescence imaging system instrument.
Peptide design and synthesis
A total of 419 amino acids in the full length of N protein were segmented and truncated into 14 peptides, of which the first 13 peptides each contained 35 amino acid residues, and the last one contained 41 amino acid residues; 5 amino acid residues were overlapped between two adjacent peptides (Table 1). A cysteine was added to the N-terminal of each peptide for subsequent peptide coupling. The peptides were synthesized by GL Biochem (Shanghai, China) Ltd., and peptides were purified via high-performance liquid chromatography with higher than 95% purity.
Table 1
Amino acid sequences of 14 overlapped synthetic peptides of SARS-CoV-2 N protein (Five amino acid residues are repeated between adjacent peptides)
Peptide ID
Sequence
Location
N1
SDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGAR
1–35aa
N2
ERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLK
30–64aa
N3
GKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRI
59–93aa
N4
RATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPY
88–122aa
N5
EAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPA
117–151aa
N6
GTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQ
146–180aa
N7
SRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARM
175–209aa
N8
TSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQ
204–238aa
N9
MSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAY
233–267aa
N10
TATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTD
262–296aa
N11
IRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTP
291–325aa
N12
GMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNK
320–354aa
N13
VILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQ
349–383aa
N14
TQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA
378–418aa
Amino acid sequences of 14 overlapped synthetic peptides of SARS-CoV-2 N protein (Five amino acid residues are repeated between adjacent peptides)
Peptide ELISA and dot-blot assay
The peptides were conjugated to the BSA protein by coupling reagent Sulfo-SMCC (Thermo Scientific, USA). Specifically, dissolved Sulfo-SMCC in DMSO and added BSA, then stirred at RT for 1 h wherein BSA was dissolved in coupling buffer, including 0.1 M PB, pH 7.2, 0.15 M NaCl, and 1 mM EDTA. The excess coupling reagent was removed via dialysis. Finally, the peptides and the Sulfo-SMCC-BSA were mixed overnight at 4℃. The conjugated peptides were coated as antigen, and the operation method was the same as indirect ELISA.The coupled peptides were dropped onto the nitrocellulose filter (NC) membrane which was completely wetted with 1 × PBS and then dried. Then blocked at 37 °C for 2 h using 5% skimmed milk and incubated with the mouse anti-N monoclonal antibodies antiserum at indoor temperature for 1 h. The follow-up operation method was the same as western blot.
Immunofluorescence assay
The specificity of the N protein with screened anti-N mAbs was determined by immunofluorescence assay. The HEK293T cells were cultured in a 12-well cell plate and the cell density reached 70–80%; the constructed positive plasmid pcDNA3.1-N was transfected with Lipofectamine®2000 (Invitrogen, Life Technologies, USA). Thirty-six to 48 h after transfection, the cells were fixed with methanol at − 20 ℃ for 5–10 min, washed with PBST three times, then blocked at 37 °C for 1–2 h using 5% skimmed milk. The N monoclonal antibodies were as the primary antibody incubated at RT for 1 h. The secondary antibody was the Donkey anti-Mouse IgG (H + L) Highly Cross-Adsorbed Secondary Antibody, Alexa Fluor 488 (Invitrogen, Life Technologies, USA, Cat No.A-21202) incubated at RT for 1 h, then the cells were stained by 4′6-diamidine-2-phenylindole dihydrochloride (DAPI, SolarBio, China) and observed under a fluorescence microscope (ZEISS, Germany) (Xie et al. 2018; Jiang et al. 2020).
Structure prediction
SWISS-MODEL was used to construct the spatial structure of the SARS-CoV-2 N protein (https://swissmodel.expasy.org/interactive). In this study, the alignment modeling sequence of SARS-CoV-2 N was from 345 to 419 amino acid sequences. The spatial localization of epitope 401-DFSKQLQQ-408 was analyzed and visualized via the PyMOL software (Version 2.5.0).
Statistical analysis
The image of SDS-PAGE, western blot, dot-blot in this research were performed by the ImageJ (version 1.51j8). The statistical graphics were analyzed using GraphPad Prism 8.0 (version 8.0.1.244). This manuscript was drafted using the Microsoft Office Professional Plus Word 2016. The figures of this study were shown by the Microsoft Office Professional Plus PowerPoint 2016.
Sequence information
We have submitted the sequence of SARS-CoV -2 N protein optimized according to the insect cells codon preference in this study to NCBI. The GenBank accession number is No. MZ948831.1.
Results
Expression and purification of N protein
A 1260 bp DNA sequence was optimized for N protein expression preferably in insect sf21 cells. Codon usage bias was adjusted to fit the better expression profile of the insect. The relative codon frequency distribution was shown in this paper (Fig. 1a). The CAI (Codon Adaptation Index) was upgraded from 0.5 to 0.9 (a CAI of 0.8–1.0 is regarded as an optimal expression). The content of GC was adjusted from 47.2 to 57.5% and unfavorable peaks were removed (Fig. 1b). Repeated areas in the original sequences were removed to avoid stem-loop structures in mRNA. The original sequence of the N protein, the optimized sequence, and amino acid sequence were all shown in this study (Figure S1).
Fig. 1
Codon optimization of nucleocapsid protein of SARS-CoV-2 a Relative codon frequency distribution of N protein; Color of codons indicates the frequency for that codon, with respect to the host. Codons that are rarely used are shown in light blue color and frequently used are shown in red color. More red indicates the higher frequency was used and was better suited for the host codon bias, and resulting in higher expression. b GC content adjustment; The original GC content is 47.2%, and the optimized value is 57.5%
Codon optimization of nucleocapsid protein of SARS-CoV-2 a Relative codon frequency distribution of N protein; Color of codons indicates the frequency for that codon, with respect to the host. Codons that are rarely used are shown in light blue color and frequently used are shown in red color. More red indicates the higher frequency was used and was better suited for the host codon bias, and resulting in higher expression. b GC content adjustment; The original GC content is 47.2%, and the optimized value is 57.5%The SARS-CoV-2 N plasmid was transformed into competent cells E. coli DH10 Bac and screened for positive clones and identified by PCR (Figure S2). Then the positive recombinant plasmid was transfected into sf21 cells to express the recombinant protein. After purification with Ni Sepharose™ excel affinity column (His Trap ™ excel, GE), the obtained N-His fusion protein was analyzed by SDS-PAGE and western blot. The N-His fusion protein was observed at about 52 kDa (Fig. 2a). The obtained N protein had a purity that can reach 95%, the target protein band in the eluted fraction was recognized at about 52 kDa (Fig. 2b). To further identify the target band, the western blot was performed and the results indicated that a specific distinct band of N-His fusion protein was observed at about 52 kDa (Fig. 2c). Also, SARS-CoV-2 N protein expressed in E. coli strain BL21 (DE3) was observed at about 52 kDa (Fig. 2d). For subsequent experimental studies, SARS-CoV N and MERS-CoV-N protein were also expressed in insect sf21 cells, and the results of protein purification were shown in Figure S3.
Fig. 2
Expression and identification of N protein a The expression of N protein was identified by SDS-PAGE. M: Protein molecular weight standard; 1: N protein expressed in sf21 cells. b The expression of N protein was identified by SDS-PAGE. M: Protein molecular weight standard; 1–2, N protein expressed in sf21 cells after purification on Ni–NTA agarose. c Western blot analysis of the N protein. M: Protein molecular weight standard; 1–2, western blot for N protein expressed in sf21 cells detected using anti-His tag antibody. d M: molecular-weight markers; 1, The expression of N protein in E. coli BL21 (DE3).
Expression and identification of N protein a The expression of N protein was identified by SDS-PAGE. M: Protein molecular weight standard; 1: N protein expressed in sf21 cells. b The expression of N protein was identified by SDS-PAGE. M: Protein molecular weight standard; 1–2, N protein expressed in sf21 cells after purification on Ni–NTA agarose. c Western blot analysis of the N protein. M: Protein molecular weight standard; 1–2, western blot for N protein expressed in sf21 cells detected using anti-His tag antibody. d M: molecular-weight markers; 1, The expression of N protein in E. coli BL21 (DE3).
Mass spectrometric identification of N protein
To further prove that the detected protein was the target protein, protein spectrum sequencing was performed. The N protein was for SDS-PAGE gel electrophoresis, the target gel band (Fig. 2b) was cut off and sent to Shanghai Sangon Biotech Co., Ltd. (China) for protein mass spectrum sequencing. One of the second-order spectra of trypsin digestion in the gel band was presented (Fig. 3a). The covered portions in N protein were in bold green (Fig. 3b). The N protein sequence coverage was about 64%. The above results indubitably confirmed the correct expression of the N-His fusion protein of SARS-CoV-2.
Fig. 3
Mass spectrometric identification of N protein a One of the second order spectrum of the trypsin digestion in the gel band by LC-MSMS of His-fusion N protein. b The matched peptide fragments in N protein. The matched parts are shown in green bold
Mass spectrometric identification of N protein a One of the second order spectrum of the trypsin digestion in the gel band by LC-MSMS of His-fusion N protein. b The matched peptide fragments in N protein. The matched parts are shown in green bold
Preparation and characterization of mAbs against N protein
BALB/C mice were immunized following the program (Fig. 4a); the titers of anti-N antibodies in the serum of tested mice were obviously higher than that from the negative mouse (Table S1). Meanwhile, the result indicated that the antibody titers of NO.1 mouse were higher than those of NO. 2, 3, 4, and 5 mice (Fig. 4b, Table S1). Therefore, the NO.1 mouse was selected for cell fusion. Seven days after cell fusion, the cell clone grew out in the plate and gradually became larger. In this study, we screened six stable positive mAb-secreting hybridoma cell lines and named 4G3, 5B3, 12B6, 18C7-A2, 21H10-A3, and 21H10-E9, respectively.
Fig. 4
Determination of titers in mice serum a Immunization program in BALB/C mice. b Titration of N antibodies in the mice sera 40 days after immunization carried out by ELISA
Determination of titers in mice serum a Immunization program in BALB/C mice. b Titration of N antibodies in the mice sera 40 days after immunization carried out by ELISAThe results of the indirect ELISA showed that the titers of six mAbs can reach 1:1.3 × 107 (Fig. 5a). At the same time, the results of the experiment indicated that the isotype of the mAbs were all IgG1/Kappa type (Table 2). Western blot demonstrated that the six mAbs could recognize N protein of the SARS-CoV-2 and SARS-CoV, but not MERS-CoV (Fig. 5a, b). The N proteins of SARS-CoV and MERS-CoV were expressed in insect cells (Figure S3). The IFA test further proved the reactivity between the six mAbs and the SARS-CoV-2 N protein (Fig. 5c). From the experimental results, the fluorescence level of the reaction between the monoclonal antibodies and the protein was consistent with that of the positive control (positive serum) and the protein reaction. The above results indicated that the screened six monoclonal antibodies had good reactivity with SARS-CoV-2 N protein. The ELISA was used to analyze the affinity of these mAbs, the high-affinity parameter “Ka” of some mAbs can reach about 4.6 × 108 (Table 2). The affinity parameter is calculated according to the following formula (Li et al. 2013 & Zhou et al. 2009). These results all certified that the mAbs are highly specific to N-His fusion protein.
Fig. 5
Characterization of six mAbs prepared using N protein a Indirect- ELISA was used to analyze binding ability of six mAbs and nucleocapsid protein of SARS-CoV-2, SARS-CoV, and MERS-CoV. The negative control (NC) was Baculovirus proteins that pFastBacTM1 vector transfection with insect sf21 cells. b Western blot was used to measure the specificity between the six mAbs and SARS-CoV-2 N, SARS-CoV N, and MERS-CoV N protein. The negative control (NC) was Baculovirus proteins that pFastBacTM1 vector transfection with insect sf21 cells. c IFA assay analyzed the reactivity between six mAbs and SARS-CoV-2 N protein. The green color is anti-N mAbs, the blue color is the nucleus, the negative control (NC) was untransfected pcDNA3.1-N cells and incubated with positive serum; the positive control (PC) was transfected pcDNA3.1-N cells and incubated with positive serum, (the positive serum was eyeball blood from mice that was used to screen for these monoclonal antibodies), Scale bars, 50 μm
Table 2
Characteristics of mAbs in this research
NO
mAbs
Titers(Ascitic fluid)
Types
Affinity constant
Heavy chain
Light chain
(L/mol)
1
4G3
1:6,553,600
IgG1
Kappa
4.3 × 108
2
5B3
1:1,638,400
IgG1
Kappa
3.5 × 106
3
12B6
1:13,107,200
IgG1
Kappa
2.1 × 107
4
18C7-A2
1:1,638,400
IgG1
Kappa
3.6 × 108
5
21H10-A3
1:13,107,200
IgG1
Kappa
3.9 × 108
6
21H10-E9
1:1,638,400
IgG1
Kappa
4.6 × 108
Characterization of six mAbs prepared using N protein a Indirect- ELISA was used to analyze binding ability of six mAbs and nucleocapsid protein of SARS-CoV-2, SARS-CoV, and MERS-CoV. The negative control (NC) was Baculovirus proteins that pFastBacTM1 vector transfection with insect sf21 cells. b Western blot was used to measure the specificity between the six mAbs and SARS-CoV-2 N, SARS-CoV N, and MERS-CoV N protein. The negative control (NC) was Baculovirus proteins that pFastBacTM1 vector transfection with insect sf21 cells. c IFA assay analyzed the reactivity between six mAbs and SARS-CoV-2 N protein. The green color is anti-N mAbs, the blue color is the nucleus, the negative control (NC) was untransfected pcDNA3.1-N cells and incubated with positive serum; the positive control (PC) was transfected pcDNA3.1-N cells and incubated with positive serum, (the positive serum was eyeball blood from mice that was used to screen for these monoclonal antibodies), Scale bars, 50 μmCharacteristics of mAbs in this research[Ab’] and [Ab] are the mAb concentrations (ng /L) correspond to 50% of maximum absorption values of two different concentration plate coating antigens.[Ag]t and [Ag']t represent the molarity of two different coating sources respectively.
Epitope mapping on N protein recognized by mAbs
The peptide-ELISA and dot-blot assay were used to determine B cell epitopes of the SARS-CoV-2 N protein. The reaction regions of 14 peptide linear epitopes were measured using the six mAbs. Of the 14 peptides, only N14 peptide (aa 378–418) could be identified by all six mAbs (Fig. 6a). Next, the N14 peptide was further truncated to N14-1, N14-2, N14-3, and N14-4 (Table 3). The binding activity of the four peptides with the six mAbs, upon the peptide-ELISA and dot-blot assay, the N14-3 peptide showed the reaction with the 5B3, 18C7-A2, 21H10-A3, and 21H10-E9 mAbs, but not with 4G3 and 12B6 mAbs (Fig. 6b). The N14-4 had a weak reaction and the N14-1; N14-2 had no reaction with the six mAbs. To further pinpoint the region of linear B-cell epitopes, we combined N14-3 and N14-4 peptides and truncated it to N14-3–1, N14-3–2, and N14-3–3 (Table 3). Results indicated that the N14-3–1 was shown to bind with the 5B3, 18C7-A2, 21H10-A3, and 21H10-E9 mAbs effectively, but not with the 4G3 and 12B6 mAbs (Fig. 6c). For further mapping the key region, the N14-3–1 peptide was truncated to N14-3–1-1 and N14-3–1-2 (Table 3). Peptide N14-3–1-1 was shown to bind with 5B3 and 21H10-A3 mAbs, but not with 4G3, 12B6, 18C7-A2, and 21H10-E9 (Fig. 6d). For N14-3–1-2, all mAbs were shown no reaction with it. To sum up, the 5B3 and 21H10-A3 mAbs can recognize a minimum of eight amino acid epitopes (401-DFSKQLQQ-408), the 18C7-A2 and 21H10-E9 can recognize eleven-amino acid epitopes (398-DLDDFSKQLQQ-408), and the 4G3 and 12B6 can map a region of 41 amino acids (378-TQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA-418).
Fig. 6
Map the linear B -cell epitopes of SARS-CoV-2 N protein using the peptide ELISA and Dot -blot assay. The negative control (NC) was BSA protein a Fourteen overlapped peptides (N1-N14) covered intact N protein were used to bind six mAbs by peptide-ELISA and dot-blot assay. b The binding of N14-1, N14-2, N14-3, and N14-4 peptides with six mAbs using the peptide-ELISA and dot-blot assay. c The binding of N14-3–1, N14-3–2, N14-3–3 peptides with six mAbs using the peptide-ELISA and dot-blot assay. d The binding of N14-3–1 and N14-3–1-2 peptides with six mAbs using the peptide-ELISA and dot-blot assay
Table 3
Synthesis protocol of SARS-CoV-2 N protein peptides truncation (Five amino acid residues are repeated between adjacent peptides)
Peptide ID
Sequence
Location
N14-1
TQALPQRQKKQQTVT
378–392aa
N14-2
QQTVTLLPAADLDDF
388–402aa
N14-3
DLDDFSKQLQQSMSS
398–412aa
N14-4
QSMSSADSTQA
408–418aa
N14-3–1
DLDDFSKQLQQ
398–408aa
N14-3–2
KQLQQSMSSAD
404–414aa
N14-3–3
MSSADSTQA
410–418aa
N14-3–1-1
DFSKQLQQ
401–408aa
N14-3–1-2
SKQLQQ
403–408aa
Map the linear B -cell epitopes of SARS-CoV-2 N protein using the peptide ELISA and Dot -blot assay. The negative control (NC) was BSA protein a Fourteen overlapped peptides (N1-N14) covered intact N protein were used to bind six mAbs by peptide-ELISA and dot-blot assay. b The binding of N14-1, N14-2, N14-3, and N14-4 peptides with six mAbs using the peptide-ELISA and dot-blot assay. c The binding of N14-3–1, N14-3–2, N14-3–3 peptides with six mAbs using the peptide-ELISA and dot-blot assay. d The binding of N14-3–1 and N14-3–1-2 peptides with six mAbs using the peptide-ELISA and dot-blot assaySynthesis protocol of SARS-CoV-2 N protein peptides truncation (Five amino acid residues are repeated between adjacent peptides)
The conservation of epitopes
In order to analyze the conservation of linear B-cell epitopes defined by the mAbs prepared in this study, strains from 14 regions in five continents were collected. The N protein sequences of fourteen SARS-CoV-2 strains, SARS-CoV, and MERS-CoV were analyzed together. The detailed information of the N protein sequences is shown in Table 4. The alignment analysis found the epitope “401-DFSKQLQQ-408”; even the 41-amino acid epitope region was highly conserved among the strains. The epitope had two amino acids different from the N protein of SARS-CoV, which was obvious differences with the N protein of MERS-CoV (Fig. 7a). At the same time, we also analyzed the conservation of epitope according to variants of concern (VOCs) and variants of interest (VOIs); the epitope “401-DFSKQLQQ-408” was also highly conserved among the VOC and VOI strains (Table 5, Fig. 7b).
Table 4
The SARS-CoV-2 N protein strains cited in this work
Name
Accession number
Country
Continent
SARS-CoV-2-Hubei-China
YP_009724397
China
Asia
SARS-CoV-2-HongKong-China
QJW69661
China
Asia
SARS-CoV-2-N
QOQ37303
USA
North America
SARS-CoV-2-Japan
BCU66490
Japan
Asia
SARS-CoV-2-Pakistan
QNV71176
Pakistan
Asia
SARS-CoV-2-Sierra
QUX03897
Sierra Leone
Africa
SARS-CoV-2-India
QOS50650
India
Asia
SARS-CoV-2- Italy
QRX3933.1
Italy
Europe
SARS-CoV-2-Austria
QSE38362
Austria
Europe
SARS-CoV-2-New York- USA
QUC93171
USA
North America
SARS-CoV-2-Florida- USA
QTC85863
USA
North America
SARS-CoV-2- Brazil
QVE55309.1
Brazil
South America
SARS-CoV-2-Australia
QPF58246
Australia
Oceania
SARS-CoV -2-Tunisia
QVL01173
Tunisia
Africa
SARS-CoV
AAZ67049.1
China
Asia
MERS-CoV
ATG84884
Saudi Arabia
Asia
Fig. 7
Bioinformatics analysis of epitopes a Conservation analysis of identified epitopes alignment of SARS-CoV-2 N protein among the different countries, also including SARS-CoV N and MERS-CoV N protein expressed in this study. b Analysis of the conservation of epitope according to variants of concern (VOCs) and variants of interest (VOIs) in this work. Accession number was from the GISAID database (https://www.gisaid.org/). The accession number QOQ37303.1 was the SARS-CoV-2 N protein studied in this work. (c) Visualization of the position of the novel linear B-cell epitope 401-DFSKQLQQ-408 in a spatial structure of N protein and the alignment modeling sequence of it was from 345 to 419. The 401-DFSKQLQQ-408 epitope was exposed to a α-helix (401-DFSKQLQQ-408, labeled color; other amino acids, gray). d The 3D model of N protein that sequence from 345 to 419 and the spatial position of epitope 401-DFSKQLQQ-408 are shown in the picture (401-DFSKQLQQ-408, labeled color; other amino acids, gray)
Table 5
Analysis of the conservation of epitope according to variants of concern (VOCs) and variants of interest (VOIs) in this work. Accession number was from GISAID database (https://www.gisaid.org/)
Accession number
Pango lineage
WHO label
Country
EPI_ISL_7196036
B.1.1.7
Alpha
Sweden
EPI_ISL_7191076
B.1.1.7
Alpha
Japan
EPI_ISL_7018207
B.1.351
Beta
South Africa
EPI_ISL_6963048
B.1.351
Beta
Malawi
EPI_ISL_7066072
B.1.351
Beta
Italy
EPI_ISL_7132994
P.1
Gamma
Brazil
EPI_ISL_7151816
P.1
Gamma
Italy
EPI_ISL_7216892
B.1.617.2
Delta
Sweden
EPI_ISL_7211092
B.1.617.2
Delta
India
EPI_ISL_7181721
B.1.1.529
Omicron
UK
EPI_ISL_7192734
B.1.1.529
Omicron
China, Hong Kong
EPI_ISL_6946001
C.37
Lambda
Peru
EPI_ISL_7040703
C.37
Lambda
USA
EPI_ISL_7191808
B.1.621
Mu
Colombia
EPI_ISL_6945483
B.1.621
Mu
Colombia
The SARS-CoV-2 N protein strains cited in this workBioinformatics analysis of epitopes a Conservation analysis of identified epitopes alignment of SARS-CoV-2 N protein among the different countries, also including SARS-CoV N and MERS-CoV N protein expressed in this study. b Analysis of the conservation of epitope according to variants of concern (VOCs) and variants of interest (VOIs) in this work. Accession number was from the GISAID database (https://www.gisaid.org/). The accession number QOQ37303.1 was the SARS-CoV-2 N protein studied in this work. (c) Visualization of the position of the novel linear B-cell epitope 401-DFSKQLQQ-408 in a spatial structure of N protein and the alignment modeling sequence of it was from 345 to 419. The 401-DFSKQLQQ-408 epitope was exposed to a α-helix (401-DFSKQLQQ-408, labeled color; other amino acids, gray). d The 3D model of N protein that sequence from 345 to 419 and the spatial position of epitope 401-DFSKQLQQ-408 are shown in the picture (401-DFSKQLQQ-408, labeled color; other amino acids, gray)Analysis of the conservation of epitope according to variants of concern (VOCs) and variants of interest (VOIs) in this work. Accession number was from GISAID database (https://www.gisaid.org/)
Three‑dimensional visualization of immunogenic epitopes
The three-dimensional structure of N protein was built by the SWISS-MODEL server, and the alignment modeling sequence of N protein was from 345 to 418. The position of the novel linear B-cell epitope 401-DFSKQLQQ-408 in the spatial structure was visualized by PyMOL software (Fig. 7c). It could be found that the 401-DFSKQLQQ-408 epitope was exposed to the α-helix (Fig. 7d) and located on the surface of the protein. This further indicated that the 401-DFSKQLQQ-408 epitope is a linear B-cell epitope.
Discussion
The rampant behavior of COVID-19 had caused great losses to the global economy, also brought serious threats to human health (Wang et al. 2021). In order to prevent the spread of disease and carry out effective antiviral therapy, a rapid and accurate diagnostic method and reagents for early detection of virus in disease are necessary (Wu et al. 2020b; Chen et al. 2020b). The study showed that the patients who had anti–N protein antibodies account for 89%, while only 63% of antibodies against S protein in patients (Wang 2020a; Wu et al. 2004b; Zeng et al 2004). The N protein can react with the sera of most patients, and the sera of patients in the acute phase (5–10 days after virus infection) could not bind with S protein, but could react with N protein, which indicates that the anti–N protein antibodies are produced earlier than the anti-S protein antibodies. Moreover, the N protein of the coronavirus family have high immunogenicity. All these characteristics indicate that N protein is a preponderant target for diagnosis.Because of its high specificity and homogeneity, mAbs have been widely used in experimental research and clinical detection (Di et al. 2005). For the preparation of monoclonal antibodies against some special pathogens, the selection of dominant antigen expression products or synthetic peptides as immunogens will undoubtedly bring great convenience (Yamaoka et al. 2016). In this study, the Bac-to-Bac expression system was used to express the codon-optimized N protein in sf21 cells. It can promote the correct folding and post-translational modification of the N protein. In this research, the expression level of N protein in sf21 cells was up to 20 mg/L.Six monoclonal cell lines with high efficiency were prepared and screened using N protein. The titers of mAbs can reach 1:1.3 × 107 (Fig. 5a), then they could react with N protein via IFA assay and western blot experiments (Fig. 5b and c). Interestingly, we found that these monoclonal antibodies could also bind with the N protein of SARS-CoV, but not with MERS-CoV. It indicates that these monoclonal antibodies could be served to assay SARS-CoV-2 and SARS-CoV simultaneously. We performed multiple sequence alignments of epitopes recognized by monoclonal antibodies and found that SARS-CoV N protein differed only at 404 position “K” to “R” and 408 position “Q” to “N” in “DFSKQLQQ” from 401–408. To some extent, the monoclonal antibodies prepared in this study were shown certain advantages, which can detect both SARS-CoV-2 and SARS-CoV. Preparation and characterization of six mAbs provide new experimental material for the detection of SARS-CoV-2 and SARS-CoV.Epitopes are the basis of protein antigenicity, and they act a vital part in the preparation of specific antibodies against proteins, the computer-aided design of vaccines, especially in the recent tumor immunotherapy (Corral-Lugo et al. 2020). Epitopes are divided into linear epitopes and conformational epitopes. According to the amino acid sequence of antigenic protein, a series of peptide fragments of multiple overlapping amino acids are synthesized, and the peptide segments that can be recognized by B cells are determined by antibody binding test. It is the most classic method of B-cell epitope screening, which can accurately and effectively detect linear B-cell epitopes. According to this study, 14 overlapped peptides were synthesized according to the N protein sequence of SARS-CoV-2, and peptide N14 was screened out using the monoclonal antibodies prepared in this study (Fig. 6). The N14 peptide was progressively truncated and finally fine mapped to 401-DFSKQLQQ-408 (Fig. 6) as a novel linear B-cell epitope.At present, there are few reports on B-cell epitopes of N protein in SARS-CoV-2. Sergio C. Oliveria reported that the most dominant B-cell epitopes of N protein in SARS-CoV-2 are located between aa176 and 206 (Rakib et al. 2020). Yufeng Dai predicted the immunodominant epitopes of N protein using several bioinformatics servers, including N229-269, N349-399, and N405-419 (Dai et al. 2020). Terry et al. reported the preparation of the monoclonal antibody that recognizes amino acids at position 381–419 aa of N protein (Terry et al. 2021). Amrun et al. found that the positive serum of patients could recognize the amino acid site 153–170 of N protein (Amrun et al. 2020). Tian et al. mapped the epitope using a Rabbit mAb (Tian et al. 2021). In this paper, a novel linear B-cell epitope 401-DFSKQLQQ-408 of N protein was identified by 5B3 and 21H10-A3 mAbs for the first time. The six mAbs all can map the epitope region 378–418aa (Fig. 6a). Interestingly, all the six mAbs could bind the epitope region 378–418aa, 4G3, and 12B6 mAbs could not bind the truncated epitope, while 5B3, 18C-A2, 21H10-A3, and 21H10-E9 mAbs could (Fig. 6b, c). The epitope was further truncated to eight-amino acids (401–408 aa), and only 5B3 and 21H10-A3 mAbs could recognize it, but not for 18C7-A3 and 21H10-E9 mAbs (Fig. 6d). Namely, the monoclonal antibodies prepared in this work could recognize epitope regions of different lengths. Meanwhile, compared with the sequences of SARS-CoV-2 N from five continents including 14 regions, the peptide 401-DFSKQLQQ-408 was highly conserved (Fig. 7).In conclusion, N protein of SARS-CoV-2 was expressed and purified in insect sf21cells via the Bac-to-Bac expression system. Six anti-N monoclonal antibodies were prepared and characterized. A novel linear B -cell epitope 401-DFSKQLQQ-408 of N protein was identified for the first time, which was highly conserved in strains from different countries and VOC’s and VOI’s strains. The findings of this study provide new thoughts for the diagnosis and test target of COVID-19 and the design of the vaccine.Below is the link to the electronic supplementary material.Supplementary file1 (PDF 388 KB)
Authors: Siti Naqiah Amrun; Cheryl Yi-Pin Lee; Bernett Lee; Siew-Wai Fong; Barnaby Edward Young; Rhonda Sin-Ling Chee; Nicholas Kim-Wah Yeo; Anthony Torres-Ruesta; Guillaume Carissimo; Chek Meng Poh; Zi Wei Chang; Matthew Zirui Tay; Yi-Hao Chan; Mark I-Cheng Chen; Jenny Guek-Hong Low; Paul A Tambyah; Shirin Kalimuddin; Surinder Pada; Seow-Yen Tan; Louisa Jin Sun; Yee-Sin Leo; David C Lye; Laurent Renia; Lisa F P Ng Journal: EBioMedicine Date: 2020-07-22 Impact factor: 8.143
Authors: Peter D Burbelo; Francis X Riedo; Chihiro Morishima; Stephen Rawlings; Davey Smith; Sanchita Das; Jeffrey R Strich; Daniel S Chertow; Richard T Davey; Jeffrey I Cohen Journal: J Infect Dis Date: 2020-06-29 Impact factor: 5.226
Authors: Margot Egger; Christian Bundschuh; Kurt Wiesinger; Christian Gabriel; Martin Clodi; Thomas Mueller; Benjamin Dieplinger Journal: Clin Chim Acta Date: 2020-05-30 Impact factor: 3.786