Literature DB >> 34767570

Genetic diversity, antifungal evaluation and molecular docking studies of Cu-chitosan nanoparticles as prospective stem rust inhibitor candidates among some Egyptian wheat genotypes.

Hanaa S Omar1,2, Abdullah Al Mutery3,4, Neama H Osman1, Nour El-Houda A Reyad5, Mohamed A Abou-Zeid6.   

Abstract

Wheat has a remarkable importance among cereals worldwide. Wheat stem and leaf rust constitute the main threats that destructively influence grain quality and yield production. Pursuing resistant cultivars and developing new genotypes including resistance genes is believed to be the most effective tool to overcome these challenges. This study is the first to use molecular markers to evaluate the genetic diversity of eighteen Egyptian wheat genotypes. Moreover, the molecular docking analysis was also used to assess the Cu-chitosan nanoparticle (CuChNp) treatment and its mode of action in disease control management. The tested genotypes were categorized into two main cluster groups depending on the similarity matrix, i.e the most resistant and susceptible genotypes to stem and leaf rust races. The results of SCoT primers revealed 140 polymorphic and 5 monomorphic bands with 97% polymorphism. While 121 polymorphic and 74 monomorphic bands were scored for SRAP primers (99% polymorphism). The genotypes Sakha 94, Sakha 95, Beni Sweif 4, Beni Sweif 7, Sohag 4 and Sohag 5 were resistant, while Giza 160 was highly susceptible to all stem rust races at the seedling stage. However, in the adult stage, the 18 genotypes were evaluated for stem and leaf rust-resistant in two different locations, i.e. Giza and Sids. In this investigation, for the first time, the activity of CuChNp was studied and shown to have the potential to inhibit stem and leaf rust in studied Egyptian wheat genotypes. The Spraying Cu-chitosan nanoparticles showed that the incubation and latent periods were increased in treated plants of the tested genotypes. Molecular modeling revealed their activity against the stem and leaf rust development. The SRAP and SCoT markers were highly useful tools for the classification of the tested wheat genotypes, although they displayed high similarities at the morphological stage. However, Cu-chitosan nanoparticles have a critical and effective role in stem and leaf rust disease control.

Entities:  

Mesh:

Substances:

Year:  2021        PMID: 34767570      PMCID: PMC8589204          DOI: 10.1371/journal.pone.0257959

Source DB:  PubMed          Journal:  PLoS One        ISSN: 1932-6203            Impact factor:   3.240


1. Introduction

Wheat (Triticum aestivum) is considered to be a major source of food grains in Egypt and worldwide. By 2050, wheat demand is expected to noticeably rise by 60 percent, particularly in the developing countries [1]. This increased demand for wheat is very serious, especially in the context of climate change, resulting in a 29% decrease in final productivity [2]. Furthermore, wheat is mainly targeted by three rust diseases, i.e. stripe, leaf, and stem rusts. The latter was caused by Puccinia graminis Pers. f. sp. tritici is a devastating disease in wheat crops around the world where it has become has epidemic under suitable environmental conditions [3]. Stem rust fungus attacks wheat plants, especially those planted lately, leading to blockage of the vascular system, plant stunting, and finally causing up to approximately 100% yield losses due to damaged grains and tillers [4]. In Egypt, this pathogen causes 1.96 to 8.21% losses in yield of most of the local wheat varieties [5]. In Egypt, leaf rust caused by Puccinia triticina could cause yield loss of 5–10% or more in commercial wheat cultivars as they lack adequate resistance to the pathogen [6,7]. Molecular marker techniques are considered a useful tool for the determination, characterization, and assessment of genetic diversity among different organisms at the species-level (Hanaa, et al. 2020). SCoT and SRAP markers are effectively used in various species of microorganisms to test the genetic diversity, structure, identification of cultivars, quantitative trait loci (QTL) mapping and DNA fingerprinting [8,9]. However, the genetic diversity assessment between and within the species of Carthamus was carried out by SRAP [10,11]. Bioinformatics and molecular docking approaches are important to identify new sources of resistant genes and to decipher the role of natural compounds such as chitosan-copper nanoparticles as natural fungicides that could serve as an environmentally friendly alternative to synthetic fungicides. Recent studies [12] have shown that a single MAP kinase. Pmk1 of M. oryzae has a chemical genetic inhibition, preventing the invasion of adjacent plant cells, and hence leaving the casual fungus trapped within a cell. Pmk1 regulates the expression of the secreted fungal effector proteins involved in host immune defense suppression, preventing reactive oxygen species production and excessive callose deposition at plasmodesmata. Moreover, it also regulates the hyphal constriction necessary for fungal growth from one cell to the adjacent rice cell, facilitating the colonization of the host tissue and blast disease. Besides, MAPK could also be used for the production of a natural component as the effective fungicides against wheat leaf rust pathogen as a molecular target. Chitosan mainly works on plant innate immunity that makes it resistant to most pathogen and plant diseases. This property could additionally be improved by utilizing it as nanoparticles. Moreover, chitosan can interact with several metals, establishing different chemical bonds that increase its stability when converted to nanoparticles. Metal-based chitosan nanomaterial plays a dual role as a plant growth promoter and a plant protection agent as well. Due to their dual activity, metal-based chitosan nanomaterial have attracted a lot of interest. Chitosan encapsulated metals are also less toxic due to the process of slow-release and have also shown a long-lasting impact on plants. Mixing Zn and Cu with Nano-chitosan is beneficial as it improves plant nutrition and growth, and protects against both biotic and abiotic stresses [13]. In this connection, the application of copper-chitosan nanoparticles could protect tomato plants from blight and wilt pathogens [14]. However, the effect of CuChNp on controlling each leaf and stem rust of wheat has not been identified yet. Therefore, the main objectives of this study are to evaluate the disease response of 18 Egyptian wheat varieties against the bio-agent stem and leaf rust at the adult plant stage, under field conditions and at the seedling stage under greenhouse conditions. Moreover, to assess the genetic diversity among eighteen species of wheat plants using both SRAP and SCoT molecular markers. Also, to determine the relationship between the disease parameters and molecular markers linked to them. Additionally, a preliminary screening and evaluation process of the copper-chitosan nanoparticles antifungal on 18 Egyptian wheat varieties against stem rust was performed and their mode of action was studied by molecular docking analysis. Therefore, further studies are needed to completely and crucially emphasize and investigate the protective role of these compounds in controlling such a disease in wheat.

2. Materials and methods

Ethics statement not applicable in this the present study.

2.1 Assessment of the disease reaction of the tested wheat genotypes

2.1.1 Assessment of the reaction of wheat seedlings to the stem and leaf rust diseases (greenhouse experiment)

This experiment was carried out at the seedling stage in the greenhouse of Wheat Diseases Res. Dept., Plant Pathology Res. Inst. and ARC Giza, Egypt during the year 2020. Eighteen Egyptian wheat genotypes were evaluated for both stem and leaf rust resistance, as shown in Table 1. In three complete random replicates, these genotypes were screened against twenty stem rust and leaf rust races. Six grains of each wheat genotype were sown in plastic pots (6 cm. diam.) containing a mixture of peat moss and soil (1:1 v/v). A paintbrush infected with the urediniospores of each rust race inoculated the seven-day-old seedlings. The inoculated seedlings were incubated for 14 hrs in a dark dew chamber at 18° C, then transferred to the greenhouse benches and maintained at 20–24° C and 70–80 percent relative humidity with 16 hrs of light and 8 hrs of dark at around 7600 lux [15]. Sowing was observed regularly before rust and leaf pustules formed. The seedlings’ response was scored 10–12 days after inoculation based on the type of infection (IT) expressed using a 0–4 scale on each genotype [16].
Table 1

Pedigree and year of release of the tested wheat genotypes.

CodeWheat genotypePedigreeYear of release
1Gemmeiza 11B0W"S"/KVZ"S"//7C/SERI82/3/GIZA168/SAKHA61. GM7892-2GM-1GM-2GM-1GM-0GM.2011
2Gemmeiza 12OTUS/3/SARA/THB//VEE.CCMSS97Y00227S-5Y-010M-010Y-010M-2Y-1M-0Y-0GM2017
3Sids 12BUC//7C/ALD/5/MAYA74/ON//1160-147/3/BB/GLL/4/CHAT"S"/6/MAYA/VUL-4SD-1SD-1SD-0SD.2007
4Misr 1OASIS/SKAUZ//4*BCN/3/2*PASTOR. CMSSOYO1881T-050M-030Y-O3OM-030WGY-33M-0Y-0S.2010
5Misr 2SKAUZ/BAV92. CMSS96M0361S-1M-010SY-010M-010SY-8M-0Y-0S.2011
6Misr 3ATTILA*2/ABW65*2/KACHU CMSS06Y00258 2T-099TOPM-099Y-099ZTM-099Y-099M-10WGY-0B-0EGY2018
7Giza 168MIL/BUC//Seri CM93046-8M-0Y-0M-2Y-0B1999
8Giza 171Sakha 93 / Gemmeiza 9 S.6-1GZ-4GZ-1GZ-2GZ-0S2013
9Sakha 94OPATA/RAYON//KAUZ. CMBW90Y3280-0TOPM-3Y-010M-010M-010Y-10M-015Y-0Y-0AP-0S.2004
10Sakha 95PASTOR//SITE/MO/3/CHEN/AEGILOPS SQUARROSA(TAUS)//BCN /4/WBLL1CMSA01Y00158S-040P0Y-040M-030ZTM-040SY-26M-0Y-0SY-0S2018
11Beni Sweif 7ALO/5/HUI/YAV_1/6/ARDENTE/7/HUI/YAV79/8/POD_9CDSS02Y01233T0OTOPB-0Y-0M-26Y-0Y-0SD2017
12Shandaweel 1SITE//MO/4/NAC/TH.AC//3*PVN/3/MIRLO/BUC. CMSS93B00567S-72Y-010M-010Y-010M-0HTY-0SH2011
13Giza 164KVZ/Buha "s"//Kal/Bb CM33027-F-15M-500y-0M1987
14Sakha 69Inia–RL4220´7C/YR"S"CM15430- 25 -65-0S-0S1980
15Giza 160Chenab 70/Giza 1551982
16Beni Sweif 4AUSL/5/CANDO/4/BY*2/TACE//II27655/3/TME//ZB/W*2. ICD88-1120-ABL-0TR-1BR-0TR-6AP-OSD.2007
17Sohag 4Ajaia-16//Hora/Jro/3/Gan/4/Zar/5/Suok-7/6/Stot//Altar84/Ald CDSS99B00778S-OTOPY-0M-0Y-129Y-0M-0Y-1B-0SH2016
18Sohag 5TRN//21563/AA/3/BD2080/4/BD2339/5/Rascon 37// Tarro 2// Rascon 3/6/Auk/Gull//GreenCDSS00B00364T-0T0PB-0B-2Y-0M-0Y-1B-0Y-0SH2016

2.1.2 Assessment of adult plant resistance to wheat stem and leaf rust diseases (field experiment)

This study was performed at Giza and Sids, Agricultural Research Stations, Agric. Res. Center of Egypt, during the 2020 growing season in a randomized complete block design (RCB), with three replicates. Each genotype was sown in plots divided into two rows of a three-meter length and 30 cm apart. All plots were surrounded by a highly susceptible wheat variety, i.e. Morocco and Thatcher plants, which were planted over an area of 1 m2 to provide a high and uniform disease pressure. All recommended cultural practices, i.e. fertilization, irrigation and other management were applied. To enhance the development of stem rust epidemics under field conditions, the experiment was irrigated and inoculated by dusting a mixture of urediniospores of the common and more aggressive stem rust pathotypes, mixed with talcum, at a rate of one volume of fresh urediniospore mixture to 20 volumes of talcum powder according to the method described by Tervet and Cassell [17]. The development of the disease was assessed using three epidemiological parameters, i.e. final rust severity (FRS %), area under disease progression curve (AUDPC) and stem and leaf rust disease increasing rate increase (R-value). The adult-plant reactions were reported using the [18] description. When the highly susceptible (check) variety was severely rusted and the disease rate reached its maximum or final level of severity, the final rust severity (FRS %) was recorded for each of the tested varieties [19]. The area under the disease progress curve (AUDPC) disease was estimated using the following formula proposed by Pandey et al [20]. In addition, the rate of increase in stem and leaf rust diseases (R-value) was determined using the following [21]. AUDPC = D [1/2 (Y1 + Yk) + (Y2 + Y3+ - - - - - + Yk-1)] Where: D = Days between two consecutive recordings (time intervals) Y1 + Yk = Sum of the first and last disease severity scores.Y2 + Y3 + - - - + Yk-1 = Sum of all in between disease scores. X1 = the proportion of the susceptible infected tissues (disease severity %) at date t1. X2 = the proportion of the susceptible infected tissues (disease severity %) at date t2, t2-t1 T1 = the interval in days between these dates.

2.2 Molecular analysis

2.2.1 DNA extraction

The high-quality genomic DNA was isolated from the fresh eighteen wheat leaf genotypes (100 mg) using the CTAB method [22]. Spectrophotometer analysis was used to measure the DNA concentrations (260 / 280). The gel electrophoresis (1% agarose gel) was used for PCR analysis at the final 25 ng/μl concentration. A 100 bp DNA ladder was used as a DNA marker.

2.2.2. SCoT -PCR amplification

A total of 20 primers established by Collard and Mackill [23] were utilized for genetic diversity analysis of the 18 wheat genotypes. The PCR technique was done in a total volume of 25 μl containing 1X reaction buffer, 1.5 mM MgCl2, 0.1 mM dNTP, 0.3 μM of a primer, 60 ng genomic DNA and 2U of Taq DNA polymerase. The amplification of PCR was programmed at 94 ◦C for 3 min, 36 cycles of 94 ◦C for 50 ◦C for 1 min and 72 ◦C for 2 min and the final step at 72 ◦C was held for 5 min. All the PCR amplification products were separated by electrophoresis on 1.5% agarose gels.

2.2.3. SRAP-PCR amplification

The SRAP molecular markers analysis was performed according to the technique described by Li and Quiros [24] with minor modifications. All SRAP primer combinations were initially screened using a group of samples according to [25]. Twelve primer combinations with scorable polymorphic bands were done. PCR analysis was done in a total volume of 25 μl i.e. 10 μl of Master Mix, 2 μl of genomic DNA, 2 μl of the two set primers (10 μmol/l primers), and 3 μl of dd H2O. The SRAP markers were identified at the following parameters: 5 min at 94°C, 5 cycles of 94°C for 1 min, 35°C for 1 min, 72°C for 2 min, 30 cycles of 94°C for 1 min, 50°C for 1 min, 72°C for 2 min, and final step of 5 min at 72°C. The amplification fragments were separated by electrophoresis in a 1.5% agarose gel.

2.2.4 Statistical analysis of data

The PCR products produced from SCoT and SRAP analysis were recorded. The data analysis and the final scores were determined for the clear bands only. For each marker, the band was scored (1) as a present or (0) as absent to generate the binary data set for the eighteen wheat genotypes. The percentage of polymorphism was calculated by dividing the number of polymorphic fragments by the total number of amplified bands using the same primer or the primer combination. The genetic similarity coefficient was measured according to the Dice coefficient [26]. A dendrogram was produced through the cluster analysis using the unweighted pair group analysis of the mathematical average (UPGMA) for all the exclusive marker systems. systat ver. 7 (SPSS Inc. 1997 SPSS Inc.3/97 standard version statistical software analysis was used to compare the similarity matrices and the dendrograms generated by the SCoT and SRAP analysis for the 18 wheat varieties. In addition, the significant differences between the eighteen varieties were verified by the analysis of variance (ANOVA) test as outlined by Snedecor and Cochran [27]. Mean comparisons for variables were made between the tested genotypes using the least significant differences (LSD at 5% level) value. On the other hand, based on the interaction between the presence of rust strains and wheat varieties, were developed. The heatmap was drawn with the aid of the ClustVis tool [28,29] and JavaScript script language [30].

2.3 Effect of nanoparticle composite on wheat stem rust

2.3.1 Preparation of Cu-chitosan composite nanoparticle infection

Cu–chitosan NPs were prepared based on the ionic gelation of chitosan with TPP anions and CuSO4 [31,32]. In a nutshell, chitosan at 0.5% (w/v) was dissolved in an acetic acid solution of 1% (v/v) and the pH was adjusted to 4.6–4.8 with 10 N sodium hydroxide (NaOH). Tri-Poly-Phosphate (TPP) solution (0.25%, w/v) was prepared and gradually added to 3 ml of chitosan solution in drops under magnetic stirring at room temperature then chitosan nanoparticles formed spontaneously. Before purification of the chitosan nanoparticle suspension, 100 μg/ml of copper ions solution was added and the final formed solution was centrifuged at 9000 g for 30 min at 4°C (discard the supernatants). Then, the chitosan nanoparticles were extensively rinsed with distilled water to remove any sodium hydroxide, followed by sonication to gain purified Cu-chitosan NPs. The nanoparticles were dried using freeze-drying and stored for further use. Synthesized NPs were characterized for physicochemical properties, including particle size, using Transmission Electron Microscopy (TEM).

2.3.2 Characterization of nanoparticles using Transmission Electron Microscopy (TEM)

TEM micrographs were obtained using an FEI Spirit TEM (Hillsboro, USA) operated at 120kV using a 400-mesh Formvar ® carbon-coated copper grid. The Cu–chitosan NPs sample was prepared by vortexing and placing 2.0l of the sonicated colloidal solution onto the grid, using a 10 ml disposable pipet to re-suspend the sample, making EM grids (carbon-coated 400-mesh copper grids) directly on the specimen and using the filter to wick away specimen droplets, specimen–side up in the specimen petri dish.

2.3.3 Seedling treatment and disease measurement

The studied 18 wheat genotypes were sprayed with Cu-chitosan composite nanoparticles at 0.1% (w/v) concentration [33], either 24 hr. before or 24 hr. before and after inoculation with urediniospores of stem rust to determine the effect of this solution and its application in controlling the disease. The estimation of the causal pathogen races as expressed on the wheat plants of the tested wheat genotypes was carried out as incubation period (IP), latent period (LP), and infection type (IT).

2.4. In silico interpretation of the Cu-chitosan composite nanoparticles against P. graminis f. sp. tritici

2.4.1. Retrieve and analyze the target protein’s sequence

The sequence of each fungus protein of PtMAPK1 of P. triticina (Accession No. AAY89655.1) and PgMAPK of P. graminis f. sp. tritici (Accession No. EFP88010) was downloaded from NCBI (https://www.ncbi.nlm.nih.gov/) in FASTA format. NCBI BLASTp (https://blast.ncbi.nlm.nih.gov/) was used to identify the required template structure for protein modeling and functional prediction [34]. BLASTp analysis suggested that 2FA2 and 2VKN are the most appropriate template structure for the construction of the target proteins with the highest sequence identity and query coverage and less E value.

2.4.2. Homology modeling of Pt MAPK1 and PgMAPK

In the absence of a crystallographic structure for MAPK1 and MAPK protein sequences from P. triticina and P. graminis f. sp. Tritici, respectively, its three dimensional structure was acquired by homology modeling, according to a previously reported procedure [35]. Concisely, PtMAPK1 and PgMAPK primary sequences (GenBank entry: AAY89655.1 and EFP88010, respectively) were submitted to Swiss [36]. The SWISSMODLE server (https://swissmodel.expasy.org/) was used to predict the 3D structure of the MAPK1 and PgMAPK proteins using its template structure. The fungus proteins with a QMEAN score were established for the development of models. In addition, for final confirmation, the protein model with a below -4 score was chosen. The predictive model of MAPK1 and PgMAPK was eventually validated using Ramachandran plot.

2.4.3. Evaluation of stability and reliability of the structural model

To assess their stability and reliability, a range of methods were used to estimate the efficiency of the rough MAPK model. PROCHECK analysis, which quantifies the residues in the Ramachandran plot accessible zones, was used to identify stereochemical quality of the model. The ERRAT tool, which defines the protein’s overall quality factor, was used to study statistics on no-bonded interactions among different types of atoms.

2.4.4. Preparation of protein and ligands

The ligand structures of the cu-chitosan composite nanoparticle treatments were determined to identify the direct effect on the fungi. The ligands were retrieved from the PubChem database. The ligands were prepared and designed in ChemDraw (https://www.perkinelmer.com/category/chemdraw) in PDB format, then converted into MOL2 format using openable software (http://openbabel.org/wiki). Then the ligands were iteratively docked to the homology model of MAPK1 and MAPK protein sequences from P. triticina and P. graminis f. sp. tritici, respectively. The molecular docking analysis was performed using SAMSON software 2020 (https://www.samsonconnect.net/) to determine the interaction between the target proteins of the wheat stem rust fungus. The affinity minimization was done using the 3DREFINE server (http://sysbio.rnet.missouri.edu/3Drefine/index.html). The energy minimization was done at neutral pH 7.0 ± 2.0.in SAMSON software. The grid was always configured with the following parameters i.e. all water molecules and ligands were deleted while hydrogen atoms for the target proteins were added. A receptor grid X, Y, and Z values of proteins were produced depending on the blind docking to explore the effect of the ligands on the proteins and the mechanism against the virulence of the causal pathogen.

2.4.5 Binding site prediction (Protein-ligand docking)

The SAMSON software (https://www.samson-connect.net/) was used for binding site prediction. It uses the interaction energy between the protein and a simple Van der Waals probe to locate energetically favorable binding sites. This software uses Auto-docking Vina as an element to maximize the accuracy of these predictions while minimizing the computer time. The program works based on quantum mechanics. It predicts the potential affinity, molecular structure, geometry optimization of the structure, vibration frequencies of coordinates of atoms, bond length, and bond angle. Following the exhaustive search, 100 poses were analyzed and the best scoring poses were used to calculate the binding affinity of the ligands. The ligands that tightly bind to a target protein with a high score were selected. The proteins were docked against the compounds chitosan and cu using SAMSON software (https://www.samson-connect.net/). The 2D interaction was performed to detect the favorable binding geometries of the ligand with the proteins using Discovery studio software to generate the 2D interaction image of the Docked protein-ligand complex with a high score to the predicted active site. The ligands were docked with the target protein and the best docking poses were identified.

3. Results

3.1 Evaluation of plant diseases

3.1.1. Assessment of seedling resistance against the wheat stem and leaf rust pathogens

In this study, eighteen Egyptian wheat genotypes were evaluated in their seedling stage against twenty different stem and leaf rust races under greenhouse conditions in Giza locations during the two growing season 2020. At the seedling-plant stage, twenty stem rust disease data on infection types and severity was determined on eighteen Egyptian wheat genotypes as presented in Table 2. Ten genotypes were found resistant (Misr 3, Sakha 94, Sakha 95, Beni Sweif 4, Beni Sweif 7, Sohag 4, Sohag 5, Gemmeiza 12, Shandaweel 1 and Giza 171).), accounting for 55% of total genotypes, eight genotypes (44%) (Gemmeiza 11, Sids 12, Misr 1, Misr 2, Sakha 69, Giza 164, Giza 168 and Giza 160) were susceptible. However, Misr 3, Sakha 94, Sakha 95, Beni Sweif 4, Beni Sweif 7, Sohag 4 and Sohag 5 genotypes were resistant to all races, but Giza 160 proved to be susceptible to all races as presented in Table 2. On the other hand, at the seedling-plant stage, five leaf rust disease date on infection types and severity was also detected on eighteen Egyptian wheat genotypes as shown in Table 3. Seven genotypes (38%) were noticed resistant (Gemmeiza 12, Misr 1, Giza 171, Misr 3, Beni Sweif 7, Giza 160 and Ben Sweif 4), while, eleven genotypes (61%) (Gemmeiza 11, Sids 12, Giza 164, Misr 2, Giza 168, Sakha 94, Sakha 69 Sakha 95, Shandaweel 1, Sohag 4 and Sohag 5) were susceptible.
Table 2

Response of 18 wheat varieties against twenty stem rust races at the seedling stage under greenhouse condition.

Wheat genotypesBTSTCSKTTCIKGKCSIDCCDKTTCPKTTCPKTTHPCTKCSTKTCTKTPCTKPTCTKSTCTKTTSTTKSCTTTSKPKTTHPCTKCSTKTCTKTPCTKPTC
Gemmeiza 1103001143000403304030
Gemmeiza 12020020224200; 002; 00; 000
Sids 122+330343420; 0443344033
Misr 1133130; 04414223103310
Misr 2143; 042+1330311, 232; 0330; 0
Misr 302+20001012++0111100; 000
Giza 164313010443043430; 0404; 0
Giza 16804011143404433303030
Giza 171022; 00042404232104; 000
Sakha 69013102++43124410103030
Sakha 94201000122200; 00; 0; 00000
Sakha 95001; 01011, 211000010; 0; 000
Shandaweel 122024211111, 2011330004
Beni Sweif 40; 01; 01, 20012; 0111210000; 0
Beni Sweif 7; 0110210; 0111002++1; 00; 000
Sohag 4111; 022222++2202++2++220000
Sohag 511200011201122100000
Giza 16033343343333343343334
Table 3

Response of 18 wheat varieties against five leaf rust races at the seedling stage under greenhouse condition.

DTJHCJKGTCTJTPCTKKTCPKPTC
Gemmeiza 1142444
Gemmeiza 1210112
Sids 1204204
Misr 101000
Misr 202040
Misr 310021
Giza 16444444
Giza 16844444
Giza 17112021
Sakha 6944444
Sakha 9443334
Sakha 9512413
Shandaweel 142+344
Beni Sweif 40102++0
Beni Sweif 70112+0
Sohag 400010
Sohag 510011
Giza 16044444
Moreover, using the heat map to determine the relationship between the eighteen wheat genotypes and twenty stem rust races were performed. The results of Heat map and Principal component (PCA) as analyses revealed that one-dimensional heatmap visualization of the interaction between the presence of rust races and wheat varieties performance revealed grouping of the 18 wheat varieties into three distinct groups as presented in Figs 1 and 2. Cluster I consist of almost resistance to stem rust in the seedling stage; cluster II included moderate susceptible to stem rust races in the seedling stage and cluster III included the highly susceptible to stem rust races in seedling wheat genotypes. In this respect, the results confirmed that there is a correlation between the genotypes and the stem rust at the seedling. The results were quite similar to those from the previous analysis, with the inclusion of the term “response to seedling stage, All the terms are related to the response of plants to stem rust races disease.
Fig 1

One-dimensional heat map showing the clustering of the 18 wheat varieties based on the presence of rust strains and varieties’ performance revealed grouping into three distinct groups.

Rows represent the 18 wheat genotypes and columns represent the 20 rust strains.

Fig 2

Principal component analysis (PCA) based on the rust races scoring data.

The figure demonstrates a sharp clustering into three distinctive groups (blue) resistance to stem rust in the seedling stage; (green) moderate susceptible to stem rust races in the seedling stage; genotypes; (red) highly susceptible to stem rust races in seedling stage genotypes; wheat genotypes).

One-dimensional heat map showing the clustering of the 18 wheat varieties based on the presence of rust strains and varieties’ performance revealed grouping into three distinct groups.

Rows represent the 18 wheat genotypes and columns represent the 20 rust strains.

Principal component analysis (PCA) based on the rust races scoring data.

The figure demonstrates a sharp clustering into three distinctive groups (blue) resistance to stem rust in the seedling stage; (green) moderate susceptible to stem rust races in the seedling stage; genotypes; (red) highly susceptible to stem rust races in seedling stage genotypes; wheat genotypes).

3.1.2. Postulation of genes (Sr,s) conditioning stem rust resistance at seedling stage under greenhouse conditions

The possible Sr, s genes that condition resistance to stem rust in the 18 Egyptian genotypes were predicted and determined during this study as presented in Table 4. To postulate sr genes in the tested genotypes, the low (L) and high (H) infection types displayed by the eighteen wheat genotypes as presented in Table 5 were compared with the infection types of some known Sr’s genes against twenty identified tested pathotypes of P. triticina under greenhouse conditions. The wheat genotype Gemmeiza-11 probably possesses Sr’s 5, 9a, 26, 17, 32 and other genes that indicate this cultivar showed low infection types to 16 phenotypes. However, the wheat genotype Gemmeiza 12 was resistant to eight pathotypes. It probably has Sr’s 11, 9g, 30, 28, 29, 33 and other genes for stem rust resistance. Although the Misr 1 genotype was resistant to three phenotypes, it did not carry any resistance genes of the tested Sr line set. Misr 2 was resistant to 7 phenotypes. Thus, it probably has two genes, i.e. Sr11 and 9, and may have an additional gene (s). Misr 3 showed low infection types of 16 phenotypes. Thus, it may probably carry Sr’s 5, 9, 26, 17, 32 and other genes for stem rust resistance. Giza 164 was resistant to three phenotypes, but it did not carry any resistance genes of the tested Sr’s. Giza 168 was resistant to eleven phenotypes. And hence, it probably has Sr’s 5, 11, 9g, 26, 30, 17, 28, 29, 33 and other genes from stem rust resistance. Giza 171 may probably carry all genes under study, i.e. Sr 5, 11, 36, 9a, 11, 6, 8a, 9g, 26, 9b, 30, 17, 28, 29, 30, 32, 33, and 34. Sakha 69 was resistant to four phenotypes, but it probably carries only one resistance gene, (Sr 29) and there could be other genes for leaf rust resistance. Sakha 94 showed a low infection type for ten phenotypes of the thirteen phenotypes under study. Therefore, this cultivar probably carries seven genes, i.e. Sr’s 5, 11, 9g, 30, 28, 29, 33 and other genes for leaf rust resistance. Sakha 95 was resistant to 11 phenotypes. So, it probably has eight genes, i.e. Sr’s 5, 11, 9g, 26, 30, 28, 29, 33 and may have an additional gene (s). Shandawel-1was resistant to 7 phenotypes. So, it probably has two genes, i.e. Sr11 and 9g, and may have an additional gene (s). Bani Swif 4 may probably carry Sr 5 and other genes for stem rust resistance. Beni Suef 7 may probably carry Sr’s 9g, 26, 17 and other genes for stem rust resistance. Sohag 4 may probably carry Sr 5 and other genes for stem rust resistance. Sohag 5 has 4 genes (s) of the tested Sr’s lines set. It probably has Sr’s 29, 30, 33, 34 and other genes for leaf rust resistance. Giza 160 was resistant to three pathotypes, but it did not carry any resistance genes of the tested Sr’s lines set. The data presented in S1 and S2 Tables indicated that the virulence genes (Lr,s and Sr,s) of the 20 P. graminis f. sp. tritici and five P. triticina pathotypes were used to study stem and leaf rust resistance of eighteen Egyptian wheat genotypes. The wheat genotypes Gemmeiza-11, Gemmeiza-12, Giza 171, Sakha-94, Sakha 95, Sids 12, Misr 3, Beni Sweif 7, Beni Sweif 4, Sohag 4 and Sohag 5) probably possess more than three Sr’s genes and other genes. And hence, it probably has more than Sr’s other genes for stem rust resistance. That indicated this cultivar showed low infection types and resistance to many phenotypes. The result of gene Postulation confirmed the assessment of seedling resistance against the wheat stem rust pathogens.
Table 4

These seedling reaction of 18 Egyptian wheat cultivars tested against 13 races of P. graminis tritici under greenhouse conditions.

Wheat CultivarP. graminis tritici
BCQNCFSCCFTSHCCGKKTSMMDSMKKSMTTNMTKTPTTSPTSSTHTSTMJT
Gemmeiza 11LLLLLLLLLLL
Gemmeiza 12LLLLLLLL
Sids 12LLLLLLLLLL
Misr 1LLL
Misr 2LLLLLLL
Misr 3LLLLLLLLLLL
Giza 164LLL
Giza 168LLLLLLLL
Giza 171LLLLLLLLLLLLL
Sakha 69LLLLLLLLLLL
Sakha 94LLLLLLLLLL
Sakha 95LLLLLLLLLLL
Shandaweel 1LLLLLLL
Beni Sweif 4LLLLLL
Beni Sweif 7LLLLLLLLL
Sohag 4LLL
Sohag 5LLLLLLLL
Giza 160LLL

L = low infection type, Blank: High infection type.

Table 5

Seedling reaction of 18 monogenic lines (Sr’s) tested against 13 races of Puccinia graminis f.sp. tritici under greenhouse conditions in 2019/2020.

Puccinia graminis tritici
Sr’s BGQNCBSCHFTSLCCGLTTSMKKS MCDSMKKS MCDSMKTNMLKTPFKSPSSSPTTSTTJT
Sr5 LLL
Sr10 LLLLLLLLLLL
Sr36 LLLLLLLLL
Sr9a LLLLLLLLL
Sr11 LLL
Sr6 LLLLLL
Sr8a LLLLLLLL
Sr9g LL
Sr26 LLL
Sr9b LLLLLLLLLL
Sr30 LLLLL
Sr17 LLLL
Sr28 LLLLLLLL
Sr29 LL
Sr30 LLLLLLLLLLL
Sr32 LLLLLLLLL
Sr33 LLLLLLLL
Sr34 LLLLLLLLLL

L = low infection type, Blank: High infection type.

L = low infection type, Blank: High infection type. L = low infection type, Blank: High infection type.

3.1.3 Assessment of wheat adult plant resistance to stem and leaf rust diseases under field condition

The 18 wheat genotypes were evaluated for stem rust and leaf rust resistance at the adult plant stage under natural infection in the field at two different locations (Giza and Sids). The evaluation was carried out and expressed through these final rust severity (FRS %), the area under disease progress curve (AUDPC) and the rate of rust disease increase (R-value) as presented in Table 6. The results obtained from the final rust severity (FRS %) represented in Table 6 revealed in general that the FRS% was significantly varied among the tested genotypes and ranged from 0 to 80 S for stem rust and from TrMr to 70 S for leaf rust. The highest final stem rust severity percent was recorded for Giza 160, Giza 164, Misr 2, Sakha 69 and Misr1genotypes either at Giza or Sids, but the lowest final stem rust severity% was noticed. While, the area under disease progress curve (AUDPC), as a useful and more reliable quantitative estimator of plant disease severity over time, was also considered to evaluate the 18 genotypes for resistance to stem and leaf rust in Giza and Sids stations. The result revealed that the AUDPC values differed among the tested genotypes. AUDPC values more than 250 were classified as highly susceptible to rusts but those with less than 250 were classified as highly resistant genotypes. Therefore the genotypes Giza 164, Sakha 69 and Giza 160 were highly susceptible to stem and leaf rust in Giza and Sids stations with highly AUDPC values. Misr 1 and Misr 2 genotypes were highly susceptible to stem rust but not to leaf rust. Beni Sweif 4 and Gemmeiza 11 were highly susceptible to leaf rust but not to stem rust. Sids 12 and Sakha 95 were highly susceptible to stem rust in Sids station only. The remaining genotypes displayed the lowest AUDPC values (less than 250) either for stem or leaf rust in both locations (Table 6).
Table 6

Final stem rust severity (FRS %), area under disease progress curve (AUDPC) and rate of rust disease increase (r-value) of 18 wheat genotypes grown at Giza and Sids Agric. Res. Station, during 2020/21 growing seasons.

GenotypeFRSAUDPCr-value
SRLRSRLRSRLR
GizaSidsGizaSidsGizaSidsGizaSidsGizaSidsGizaSids
Gemmeiza 11 20 MS10 MS40 MS50 MS143.5087.50283.50297.500.1830.1490.1210.121
Gemmeiza 12 Tr MS5 MS30 MR20 MR24.5059.50199.50164.500.0670.0670.0690.040
Sids 12 20 S40 S20 MR20 MR178.50525.00101.50164.500.1700.1850.1400.140
Misr 1 40 S60 STrMR5 MR560.001050.0045.5066.500.1920.1890.0670.067
Misr 2 60 S60 S5 MR5 MR735.00980.0042.0045.500.2150.2830.0530.067
Misr 3 Tr S5 S10 MR10 MR31.5063.0038.5066.500.0790.0790.0880.103
Giza 168 5 S10 S20 M30 M63.00122.5094.50171.500.1040.0360.0320.007
Giza 171 10 M010 R20 R66.500.0063.00164.500.1030.000.0960.140
Sakha 94 5 MS20 MS5 R10 R52.5052.5052.50101.500.0670.0670.0670.088
Sakha 95 20 S30 S10 R20 R178.50318.5042.00171.500.1000.1080.0960.032
Shandaweel 1 10 MR5 MR20 MS30 MS66.5052.50129.50227.500.1000.0670.1320.164
Giza 164 70 S60 S60 S70 S910.001050.00735.00910.000.2450.2850.2240.245
Sakha 69 50 S40 S70 S70 S700.00507.50822.50962.500.2050.2210.2810.281
Beni Sweif 7 30 MS10 MS10 S20 S234.50115.5080.50178.500.0940.0930.1140.103
Beni Sweif 4 20 MS5 MS30 S40 S164.5031.50437.50507.500.0400.0670.1000.121
Sohag 4 10 MSTr MS20 S30 S56.0052.50178.50297.500.0790.0670.1530.100
Sohag 5 5 STr S20 S30 S94.5052.50262.50283.500.0320.0670.0740.178
Giza 160 80 S80 S50 S60 S1260.001260.00560.00910.000.2320.2320.2050.205
Mean ----306.639354.472231.58316.1670.1280.1260.1170.122
LSD 0.05 - - - - 2.25 3.75 2.25 3.79 1.85 1.67 0.156 0.186
On the other hand, each of the stem rust and leaf rust disease progressed more slowly and increased at relatively lower rates (R-value) on all tested wheat cultivars. According to this the third parameter. The first group included eleven wheat varieties, (Gemmeiza 12, Misr 3, Giza 168, Giza 171, Sakha 94, Sakha 95, Shandaweel 1, Bany Swif 7, Bany Swif 4, Sohag 4 and Sohag 5). These genotypes exhibited a slower rate of stem rust development but increased at relatively lower rates of disease increase (R-values) that ranged from 0.00 to 0.100 during the growing season. The second group included the wheat varieties (Gemmeiza 11, Sids 12, Misr 1, Misr 2, Giza 164, Sakha 69 and Giza 160) which showed the lowest levels of resistance to stem rust infection in comparison with the studied other cultivars as the R-values reached the maximum level, more than 0.100. Therefore, the genotypes were classified as fast rusting or highly susceptible wheat ones. While leaf rust disease severity in the wheat cultivars can also be ranked into two main groups. The first group included eleven wheat cultivars, (Gemmeiza 12, Misr 1, Misr 2, Misr 3,Giza 168, Giza 171, Sakha 94, Sakha 95 and Sohag 5) which exhibited stem rust developed more slowly and increased at relatively lower rates of disease increase (R-value). These varieties were designated as the partial resistance and slow rusting ones. Since they displayed the highest level of adult plant resistance or field resistance under the stress of leaf rust infection, they may have durable resistance to leaf rust.

3.2. Genetic diversity of the tested wheat genotypes using SCoT and SRAP analysis

3.2.1. SCoT markers diversity pattern

In the present investigation, 20 SCoT primers were selected to study the genetic diversity analysis among the eighteen Egyptian wheat genotypes, including stem and leaf resistant and susceptible species. Only eleven SCoT primers generated distinct polymorphic bands. However, a total of 216 bands were polymorphic (97%), and their sizes ranged from 200 to 3000 bp. The number of polymorphic bands for each primer ranged from 6 (SCot71) to 24 (SCot13) and the number of monomorphic bands ranged from 1 (SCoT 14, 24, and 71) to 2 (SCoT 33). Moreover, the number of unique bands ranged from 1 (SCoT 70) to 23 (SCoT 13) as shown in Table 7 and Fig 3. The Jaccard’s genetic similarity values of the eighteen Egyptian genotypes, including stem and leaf resistant and susceptible, depend on SCoT molecular markers, ranging from 38 to 84%. The highest genetic similarity revealed by the SCoT molecular markers analysis was 84% recorded between Sakha 69 and Giza 164, which are categorized as susceptible to stem and leaf rust. Meanwhile, the lowest similarity percentage (38%) was recorded for Shandaweel 1 and Gemmeiza 11, given that Shandweel 1 is resistant to stem rust but susceptible to leaf rust. While Gemmeiza 11 is categorized as susceptible to both stem and leaf rust (S3 Table). A dendrogram depends on UPGMA analysis using SCoT marker consisting of two main clusters as presented in Fig 5A. The first cluster grouped all plants from the phylogenetically similar susceptible to stem and leaf rust races, i.e. Beni Sweif 7 and Sohag 4. While the second cluster consists of two sub clusters. The second sub cluster I indicated that the most susceptible genotypes to leaf and stem rust (Giza 164, Sakha 69, Sohag 5, Bani Sweif 4, Giza 160 and Shandaweel 1) were genetically similar to three resistant genotypes to leaf rust races (Giza 171, Sakha 94 and Sakha 95). In addition, the second sub cluster II showed that all species belonging to the most resistant genotypes to leaf rust (Misr 1, Misr 2, Misr 3, Gemmiza 12, and Sids12 were similar to some species belonging to susceptible genotypes to stem and leaf rust (Giza 168 and Gemmiza11) races. These results indicate that SCoT primers have high amplification efficiency and are reliable in the discovery of polymorphisms between stem and leaf rust races.
Table 7

Primer code, Size of bands, primer sequence, percentage of polymorphism, total polymorphic and unique bands in the profile of SCoT primer.

Primer CodeSize of bands (bp)Primer sequenceNumber of bandsUnique bandPolymorphism %
TotalPolymorphicMonomorphic
SCOT13700–1.9005’ACGACATGGCGACCATCG3’4724-23100
SCOT14500–30005’ACGACATGGCGACCACGG3’20131695
SCOT24500–19005’CACCATGGCTACCACCAT3’19121694.7
SCOT26300–25005’ACCATGGCTACCACCGTC3’2015-5100
SCOT31300–18005’CCATGGCTACCACCGCCT3’2215-7100
SCOT33200–12005’CCATGGCTACCACCGCAG3’20112790
SCOT34500–19005’ACCATGGCTACCACCGCA3’2618-8100
SCOT52200–11005’ACAATGGCTACCACTGCA3’1310-3100
SCOT61300–27005’CAACAATGGCTACCACCG3’118-3100
SCOT70200–12005’ACCATGGCTACCAGCGCG3’98-1100
SCOT71300–17005’CCATGGCTACCACCGCCG3’961288.8
Total Average200–3000216191401271697
Fig 3

Amplification profile obtained with eleven ScoT primers in eighteen wheat genotypes.

(M) molecular marker (100 bp); lanes 1–18.

Fig 5

A dendrogram based on UPGMA analysis using.

(A) SCoT marker, (B) SRAP, (C) Combined data among 18 wheat genotypes.

Amplification profile obtained with eleven ScoT primers in eighteen wheat genotypes.

(M) molecular marker (100 bp); lanes 1–18.

3.2.2. SRAP markers diversity pattern

To investigate the genetic diversity and to evaluate the polymorphism degree among the eighteen Egyptian genotypes, including stem and leaf resistant and also susceptible species. A total of 20 SARP primer combinations were tested against these species genotypes. Only 14 out of 20 primer combinations revealed discernible polymorphism. However, a total of 230 bands were polymorphic (99%), and their sizes ranged from 100 to 2000 bps. The results showed that the total number of bands produced were distinct sharp bands. The number of polymorphic bands per primer combination ranged from 3 (Me1-Em6) to 16 (Me2-Em1), and the number of unique bands per primer ranged from 2 (Me4-Em4) to 19 (Me1-Em3) as presented in Table 8 and Fig 4. The Jaccard’s genetic similarity values of the eighteen wheat species depend on the SRAP profile molecular markers that ranged from 60 to 94%. The highest genetic similarity value revealed by the SRAP molecular markers analysis was 94% between Sakha 69 and Giza 160, belonging to susceptible genotypes for the stem rust race. Meanwhile, the lowest similarity percentage (0.60%) was noticed for Sohag 5 and Gemmeiza 11 (S4 Table). A dendrogram analysis generated from SRAP analysis based on UPGMA clustering grouped the 18 wheat genotypes into two main clusters as presented Fig 5B. The first cluster consists of the most susceptible genotypes to stem and leaf rust (Shandaweel 1, Sohag 5, Giza 164, Sakha 69, Giza 160, Beni Sweif 4 and Sohag 4). The second cluster grouped the largest number of the most resistant genotypes to leaf rust (Misr 1, Misr 2, Misr 3, Gemmeiza 12, Giza genotypes 171, Sakha 95 and Sakha 94) beside some cultivars susceptible to stem and leaf rust (Beni Sweif 7, Giza 168, Gemmeiza 11, Sids 12). According to the cluster analysis, the SRAP data successfully clustered similar resistant and susceptible genotypes to leaf and stem rust into the same phenotypes and genotypic groups. These results show that the SRAP clusters exhibited a relatively direct connection with plant sequence taxonomy and assessment of stem and leaf rust races.
Table 8

Primer code, primer sequence, Size of bands and combination total bands, polymorphic bands, unique band and percentage of polymorphism in the SRAP primer.

Primer Code SRAPSize of bands (bp)Primer combinationPrimer sequenceNumber of bands Total Polymorphic MonomorphicUnique bandPolymorphism %
Me1 500–1600 Me1- Em2 TGAGTCCAAACCGGATA 20 11 - 9 100
Me2 300–600 Me1- Em3 TGAGTCCAAACCGGAGC 28 9 - 19 100
Me3 300–600 Me1- Em4 TGAGTCCAAACCGGAAT 16 10 - 6 100
Me4 100–800 Me1- Em5 TGAGTCCAAACCGGACC- 17 6 - 11 100
Me5 100–2000 Me1- Em6 TGAGTCCAAACCGGAAG 7 3 - 4 100
Em1 100–1300 Me2- Em1 GACTGCGTACGAATTAAT 25 16 - 9 100
Em2 90–600 Me2- Em3 GACTGCGTACGAATTTGC 8 4 1 3 87.5
Em3 200–1400 Me2- Em5 GACTGCGTACGAATTGAC 18 11 - 7 100
Em4 200–2200 Me4- Em2 GACTGCGTACGAATTTGA 19 8 - 11 100
Em5 200–2200 Me4- Em4 GACTGCGTACGAATTAAC 16 10 4 2 75
Em6 150–1700 Me4- Em5 GACTGCGTACGAATTGCA 7 6 1 - 85.7
100–600 Me4- Em6 6 6 - - 100
90–200 Me5- Em2 11 7 4 - 63.6
170–1500 Me5- Em5 12 9 3 - 75
200–1000 Me5- Em6 20 11 - - 100
100–2000 Total Average 230 16 121 8 13 6 74 5 99
Fig 4

Amplification profile generated by 14 SRAP primers in 18 wheat genotypes.

(M) molecular marker (100 bp); lanes 1–18.

Amplification profile generated by 14 SRAP primers in 18 wheat genotypes.

(M) molecular marker (100 bp); lanes 1–18.

A dendrogram based on UPGMA analysis using.

(A) SCoT marker, (B) SRAP, (C) Combined data among 18 wheat genotypes.

3.2.3 Diversity analysis using the combined data

The generic dendrogram was constructed using the combined data of all the molecular markers used in this investigation (SCoT and SRAP) grouped the eighteen studied wheat genotypes into two main clusters as presented in Fig 5C. Cluster 1 comprises of the most resistant genotypes to the leaf rust pathogen i.e. Beni Sweif 7, Giza 171, Sakha 94, Misr 1, Misr 2, Misr 3, Giza 168, Gemmeiza 11, Gemmeiza 12 and Sids 12. Meanwhile, Cluster II consists of the most susceptible genotypes to both stem and leaf rust (Sakha 95, Shandaweel 1, Giza 164, Sakha 69, Giza 160, Beni Sweif 4, Sohag 5 and Sohag 4). The data scored from SCoT and SRAPP were combined and analyzed to produce the deeper relationships dependent on the wider and more versatile genome coverage. The combined dendrogram included two clusters with a high topology that harmonized with the SRAP dendrogram only. Finally, the Jaccard’s genetic similarity values of the eighteen wheat species depend on the combined data and displayed consistent results that were comparable to the grouping produced by the cluster analysis. The combined data analysis results confirmed the presence of the highest genetic similarity (85%) between Sakha 69 and Giza 160 as presented in S5 Table.

3.3. Characterization of nanoparticles using Transmission Electron Microscopy (TEM)

3.3.1. Effect of Cu-chitosan composite nanoparticle treatments and the application methods on incubation period, latent period and infection type of wheat stem rust pathogen

In our earlier study, these CuChNp were well characterized for various physico-chemical properties, like the interaction of chitosan with Cu and the internal architecture by transmission electron microscopy (TEM) (Fig 6). In the present investigation, the eighteen wheat genotypes were treated with cu-chitosan composite nanoparticles either before or after inoculation with uridiospores of the stem rust pathogen to study and determine the effect of nanoparticle treatment and its application methods in controlling the disease. The estimation was expressed as incubation, latent period stem and leaf rust infection type as presented in Tables 9 and 10. The results of CuChNp treatment on stem and leaf rust races revealed that the infection process was reduced when the plant was treated 24 h before and 24 h before and after the inoculation. The incubation and latent periods were increased in treated wheat plants of the tested genotypes rather than in the untreated plants. Besides, the treatment gave the lowest infection type compared to the control ones.
Fig 6

EM micrographs of the aggregated Cu–chitosan nanoparticles composite.

Table 9

Effect of Cu-chitosan NPs treatments and application methods on incubation, latent periods and infection type of the wheat stem rust disease.

Treatment/ VeritiesIncubation period/dayLatent period/dayInfection type
ControlBefore*Post**ControlBefore*Post**ControlPrepost
Gemmeiza 118.5914.315.0412.0419.9519.9732+2+
Gemmeiza 127.2316.2715.5413.2820.0520.3121+1
Sids 126.9814.2114.5613.4619.9219.3542++2+
Misr 15.6713.1613.4511.6718.6718.6742+2+
Misr 25.7613.3313.5711.0620.2120.3132++2+
Misr 37.8516.8316.9213.4521.2221.04211
Giza 1646.0313.5713.8913.7819.9220.8142++3
Giza 1687.0715.7615.7812.8620.0520.09312
Giza 1718.4515.3715.6212.3519.0719.08211
Sakha 697.6314.5614.8712.3519.0920.18321++
Sakha 948.1216.9316.3611.9219.9219.94211
Sakha 957.9517.5617.4513.0020.6320.97311+
Shandaweel 18.3117.9317.9713.5720.4620.93322+
Beni Sweif 48.3417.8417.9214.0120.2322.03212
Beni Sweif 77.9317.3617.3512.0419.0719.0421+1
Sohag 46.3815.9315.3813.7519.219.8321+1
Sohag 57.0116.2616.1713.8419.3519.47211
Giza 1605.0112.3512.4811.8719.0819.09433+

* spray before inoculation by 24 hours

**Spray before and after inoculation by 24 hours.

0, 1,1+, 2, 2+, 2++ (Low infection types) Resistance.

3. 4 (High infection types) Susceptible.

Table 10

Effect of Cu-chitosan NPs treatments and application methods on incubation, latent periods and infection type of the wheat leaf rust disease.

Treatment/ VeritiesIncubation period/dayLatent period/dayInfection type
ControlBefore*Post**ControlBefore*Post**ControlPrepost
Gemmeiza 117.2113.4513.9910.2518.9518.812++01
Gemmeiza 127.2115.2316.3412.2219.2216.212+11
Sids 127.2315.2216.5512.4518.6518.3332+2
Misr 16.7612.2212.7310.6417.4518.43211
Misr 26.6312.2312.4210.1118.2218.23211
Misr 35.5515.4216.5312.1219.2019.04201
Giza 1645.2212.5212.9010.7616.4319.18422
Giza 1686.1112.3416.4711.8717.1619.21422
Giza 1716.9816.3216.6310.3317.0918.13211
Sakha 696.3113.5516.7711.3516.1717.22422
Sakha 946.2317.9018.3310.9218.9217.863+22+
Sakha 958.7516.5518.5510.1118.2221.64201
Shandaweel 17.3215.2318.2313.5321.4422.53312
Beni Sweif 47.43318.8518.9311.0316.2419.14312
Beni Sweif 76.2214.3315.4510.1318.2118.13412
Sohag 47.3114.8114.9912.2617.2218.74311+
Sohag 56.2115.2216.1811.4417.3618.42312
Giza 1607.1213.5413.5610.2118.1218.95422+

* spray before inoculation by 24 hours

**Spray before and after inoculation by 24 hours.

0, 1,1+, 2, 2+, 2++ (Low infection types) Resistance.

3. 4 (High infection types) Susceptible.

* spray before inoculation by 24 hours **Spray before and after inoculation by 24 hours. 0, 1,1+, 2, 2+, 2++ (Low infection types) Resistance. 3. 4 (High infection types) Susceptible. * spray before inoculation by 24 hours **Spray before and after inoculation by 24 hours. 0, 1,1+, 2, 2+, 2++ (Low infection types) Resistance. 3. 4 (High infection types) Susceptible.

3.4 In silico interpretation of the Cu-chitosan composite nanoparticle against stem rust and leaf rust pathogens

3.4.1 3D structure prediction, quality assessment and validation

BLASTp analysis provided PDB ids: 2VKN and 2FA2 putative templates, respectively showed high-level sequence identity with MAPK1 and PgMAPK sequences as presented in Table 10. Accordingly, the BLAST analysis PDB ID: 2vkn chain A with a resolution of 2.05 Å and 2FA2 chain A with a resolution of 2.85 Å reflected the best template structure for the comparative model building of MAPK1 and PgMAPK, respectively. The query coverage of protein sequences revealed MAP kinase 1 of P. triticina and PGTG of P. graminis f. sp. tritici (84 and 12%) query coverage’s with 56.14, 56.15 identity with the template proteins (2VKN, 2FA2) that used as template proteins for homology modeling of our target proteins. The SWISSMODLE server-generated 25 and 35 predictive models for MAPK1 of P. triticina and PgMAPK of P. graminis f. sp. tritici proteins with different (QMEAN) score values. The model with low values for QMEAN score (-1.53 and -0.69, respectively) was selected as a final model for in silico characterization and docking studies. The structural analysis and verification server were used to analyze and validate the stability of the MAPK1 and PgMAPK models (https://services.mbi.ucla.edu/SAVES/). The reliability of the backbone of torsion angles i.e. φ and Ψ was evaluated using the PROCHECK program, which measures amino acid residues falling in the existing regions of Ramachandran plot, as depicted in Fig 7A and 7B. Analysis of Ramachandran plot for MAPK1 and PgMAPK revealed that, respectively 91 and 93% residues were found in the most favored regions (A, B, and L) and only 8.7 and 6.1% residues occupied the additionally, allowed regions (a, b, l, and p). 8.3% residues in additional acceptable regions, 0.8% residues in generously acceptable regions, and 1.4% residue in disallowed regions (S6 Table). The quality of the MAPK1 model was further justified by a better ERRAT score of 71.6931 (a value of ~ 95% reveals high resolution), which recommended an acceptable environment for protein (Colovos and Yeates, 1993). This confirms that the predicted model quality MAPK1 of P. triticina and PgMAPK of P. graminis f. sp. tritici had a good stereochemical quality and was close to the template structure. The ProQ is a neural network-based predictor based on several of structural features as it predicts the quality of the protein model. The ERRAT score for the modeled structure was found to be 96.22 and 78.4314, respectively. The 3D revealed that the predicted proteins MAPK1 and PgMAPK have 96.22 and 81.36% of the residues have an average 3D-1D score > = 0.2 Pass At least 80% of the amino acids have scored > = 0.2 in the 3D/1D profile. Moreover, the ligand-binding sites identified in the target modeling proteins structure are presented in Table 11 and Fig 8A and 8B.
Fig 7

Ramachandran plot of the modeled structure.

(A) MAPK1 and (B) PgMAPK evaluated and checked by SAVES. For both residues, the plot demonstrates phi-psi torsion angles.

Table 11

Binding free energy of chitosan alone or complexed with copper predicted by molecular docking with MAPK1 and PgMAPK proteins of P. triticina and P. graminis tritici, respectively.

FungiGrid box (x, y, z)Protein/accession no.LigandsBinding energy
P. triticinax = 8.6875y = 7.9130z = 26.0847MAP kinase 1 P. triticina (AAY89655.1)chitosan-6.9
cu-chitosan-6.6
P. graminis f. sp. triticix = 11.3055y = 22.877z = 1.3282PGTGP. graminis f. sp. tritici(10532062)chitosan-4.6
cu-chitosan-5.6
Fig 8

The binding site of the rust fungus.

The MAKP1 of the leaf rust fungus and (B) the PGTG protein of stem rust.

Ramachandran plot of the modeled structure.

(A) MAPK1 and (B) PgMAPK evaluated and checked by SAVES. For both residues, the plot demonstrates phi-psi torsion angles.

The binding site of the rust fungus.

The MAKP1 of the leaf rust fungus and (B) the PGTG protein of stem rust.

3.4.2 Protein-ligand docking

In this investigation, the modeled proteins MAPK1 and PgMAPK were docked with all the chitosan and chitosan- copper complex to generate their binding mode to refine the best the pose with an allowed conformational change in the tested proteins. The MPAK1 was bound to chitosan with ΔGbind were bound and docking score was -6.9 kcal/mol with the interactive binding site residues (ARG106, ASP192, GLU210, GLY212, LEU213, GLU223, THR224, GLY225, MET227, VAL231, ALA232 and ARG234).While, the MPAK1 was bound to chitosan with CU the ΔGbind are -6.6kcal/ mol with the interactive binding site residues (ARG106, LYS194, GLU223, MET227, GLU229, VAL231, ALA232, GLN247 and GLY273). On the other hand, the PGAT protein for leaf rust was bound to chitosan with ΔGbind -4.6kcal/mol with the interactive binding site residues (TYR441, PRO448, ASN449, SER483, SER478, GLN470 and LYS467). Also, the PGAT was bound to chitosan with CU the ΔGbind are -5.6 kcal/mol with the interactive binding site residues (pro 448, Ala443, Glu450, Arg472, Arg 473 and Ph453) as presented in Fig 9A and 9B.
Fig 9

The overall 3D surface view of the modeled protein.

PtMAPK1 and PGTG with chitosan only and chitosan–Cu complex. MAPK1 with chitosan only, (B) MAPK1 with chitosan–Cu complex, (C) PGTG with chitosan only and, (D (PGTG with chitosan–Cu complex.

The overall 3D surface view of the modeled protein.

PtMAPK1 and PGTG with chitosan only and chitosan–Cu complex. MAPK1 with chitosan only, (B) MAPK1 with chitosan–Cu complex, (C) PGTG with chitosan only and, (D (PGTG with chitosan–Cu complex.

4. Discussion

Wheat is one of the major important crops for the urgent need for food supply all over the world. Wheat stem rust (Puccinia graminis f. sp. tritici) and leaf rust (Puccinia triticina) are the most common rust diseases that constitute the greatest threats that destructively influence plant growth, grain quality, and yield production. There are many approaches to controlling crop diseases, including genetic breeding, cultural sanitation systems, and new pesticide products. Host genetic resistance is the most promising method for the control of plant diseases. Therefore, the present study is designed to analyze the morphological and genetic diversity between susceptible and resistant eighteen Egyptian genotypes to the stem and leaf rust diseases using modern analytical approaches that use functional markers such as SCoT and SRAP. Besides, we characterized and assessed the biological activities of the Cu-chitosan nanoparticle against stem and leaf rust diseases. Moreover, the molecular docking analysis was also used to study the mode of action of Cu-chitosan nanoparticles in disease control management. In this regard, Egyptian wheat varieties collected from different regions have a range of resistant genes. They can be used as a new source of rust resistance genes to obtain and grow novel resistance genotypes of wheat [37]. The present study is designed to evaluate the eighteen Egyptian wheat genotypes in the seedling stage against twenty different stem rust races. The experiment was carried out under greenhouse conditions as well as in the adult stage in the field located in two different locations during the 2020 growing season. The results of stem rust disease under greenhouse conditions in the 2020 season revealed that the resistance response was observed in some wheat genotypes while the susceptible reaction was detected in the second group of wheat genotypes and some of the genotypes were susceptible to almost all races. In this study, we used a transcriptomic-derived heat map to globally corroborate Metascape analyses and component analysis (PCA). It successfully separated the wheat genotypes under study into three groups (resistance, susceptible, and highly susceptible). This result was confirmed by the results obtained at the adult plant stage. This result is consistent with [29,38]. On the other hand, the results of the leaf rust disease revealed that the susceptible reaction was identified in 11 genotypes. Whereas, the resistant response was determined in 7 genotypes. Therefore, the apparent disparity between the tested genotypes in their seedling reaction susceptibility to stem rust breeds could have a complex genetic history. Among the 18 genotypes, the high frequency of MS to S genotypes suggests that ineffective stem rust resistance genes are present in their genetic backgrounds. Likewise, within Brazilian genotypes with aluminum tolerance backgrounds, [39] documented a high frequency of moderate response to susceptible infection forms. Besides, 9 and 2 genotypes showed clear and moderate resistance (RMR) to leaf rust and stem rust, respectively. This indicates that these lines could bear various resistance genes that are effective against leaf rust and stem rust and hence could be used effectively as parents in breeding programs. This result was confirmed by those obtained by [40-45]. The gene postulation applies the principles of gene-for-gene theory to theorize which stem and leaf rust resistance genes could possibly be present in the wheat genotype. The effective advantage of the gene postulation test is that it predicts the probability of the presence of resistance genes in a few weeks using the primary leaves of seedling plants. The postulation gene at seedling stage may lead to the conclusion that if any wheat cultivar is proved to have only one single gene for stem or leaf rust resistance, it won’t lead to durable resistance due to the rapid development of new physiologic races of the stem and leaf rust fungus. Therefore, this cultivar will be discarded soon after it’s released. In this study, cultivars Giza 160 and Giza 164 do not contain any resistance genes of the Sr, s set and cultures that were used in this study. These results are in accordance with those previously reported by [40]. On the other hand, some wheat genotypes, like Giza 171, Gemmiza 11 and Gemmiza 12, display many resistance genes. This result was inconsistent with [46]. The reason may be supplanting the breaking of genotype resistance could be attributed to the appearance of new races of the pathogen. On the other hand, AUDPC values for stem and leaf rust significantly differed among the studied wheat genotypes. However, performance revealed grouping of the 18 wheat varieties into two distinct groups. Wheat genotypes in the first group with values of less than 250 are classified as highly resistant genotypes. The second group displayed high estimates of AUDPC, more than 250 classified as highly susceptible to rust. In this group, the wheat genotypes were divided into two groups, moderately susceptible and highly susceptible. This result was consistent with the results of the heat map and principal component (PCA) as analyses revealed that one-dimensional heatmap visualization of the interaction between the presence of rust races and wheat variety performance revealed grouping of the 18 wheat varieties. These results are in good agreement with those previously reported by [5,29,47-49] The rate of rust disease increase (r-value) is one of the epidemiological parameters used for quantitative determination of partial resistance to stem and leaf rusts under field conditions. In this study, the performance revealed grouping of the 18 wheat genotypes into two distinct groups: the resistance group, as they displayed lower rates of disease increase with low r-value, and the susceptible group, the fast-rusting or the highly susceptible ones, when subjected to the same pathogen populations and under the same environmental field conditions as in the current study. However, it was previously reported that differences in (r-value) estimates between two wheat cultivars tested during an epidemic development are due to one of two reasons. The first reason is the disease severity in each, and the second reason is the spread of the rust races reproduction, or the time of disease increase [22]. In this investigation, the genetic relationship between different plant species and genera is very important because new relationships between plants need to be discovered in plant evolution [50]. Genetic diversity is a requirement for detecting leaf and stem rust-resistant wheat cultivars [51]. Accordingly, we carried out gene-targeted molecular markers (SCoT) and sequence-related amplified polymorphisms (SRAP) analyses to determine their elevated power in polymorphism identification in wheat. In this study, the SCoT and SRAP markers were approved to study the genetic diversity among eighteen wheat genotypes, including resistant and susceptible species to stem and leaf rust. The results revealed that the gene-targeted molecular marker (SCoT) has several advantages over the use of dominant random markers (such as ISSR, RAPD, and AFLP). However, these markers reveal genetic diversity from the genic region in the genome and this functional diversity can be used in any species [52]. Moreover, the SRAP marker system is a new, simple, and efficient marker system that can be adapted for a variety of purposes, such as linkage map construction [53], genomic and cDNA fingerprinting gene tagging [24], and genetic diversity analysis. The results revealed that SRAP markers have the potential to improve the current suite of molecular tools in a diversity of fields by providing an easy-to-use, highly variable marker with essential biological significance. Abou-Deif, et al., [54] used the ISSR molecular marker to estimate the genetic diversity between some Egyptian wheat genotypes. But El-Moneim, [55] and Gowayed and El-Moneim [9] used ISSR and SCoT primers to determine and evaluate some Egyptian wheat genotypes tolerant to drought and salt stress, respectively. But our current study used different primers for SCoT in genetic diversity and evaluation of Egyptian wheat genotypes’ resistance to stem and leaf rust diseases. The SCoT and SRAP markers indicated the highest level of polymorphism (97 and 99% respectively) and were established to be effective in detecting genetic diversity among the eighteen genotypes studied. Besides, there were a number of 71 and 74 unique loci for SCoT and SRAP molecular markers, respectively. The highest similarity values among the 18 genotypes obtained by SCoT and SRAP primers were noticed between Sakha 69 and Giza 164, which are characterized as susceptible to stem and leaf rust. This could be interpreted that the two genotypes in their history may bear ineffective genes for stem rust and leaf rust resistance. Shadwell 1 (moderately resistant to stem rust) has a genetic background far from Gemmeiza 11 (susceptible to both stem and leaf rust) according to the similarity value (38%) obtained by SCoT analysis, but Shandweel 1 varied with Sohag 5 (susceptible to stem and leaf rust) with a similarity of 0.95 percent according to SRAP analysis. The determined high level of polymorphism was indicative of the greater genetic diversity among the studied genotypes, which can be effectively utilized for gene tagging and genome mapping of crosses to introgress beneficial traits into thecultivated genotypes. Our results agreement with [56] evaluated the genetic relationships of sixteen species belonging to two major genera of Mammillaria and Notocactus in the family Cactaceae using modern gene-targeting marker techniques, i.e. the Start Codon Targeted (SCoT) Polymorphism. Moreover, Hanaa et.al., [57] reported that the gene-targeted marker techniques (SCoT) were highly beneficial tools for the classification of sixteen medicinal plant species. In general, in distinguishing between resistant and susceptible wheat genotypes, especially leaf rust, SRAP was more effective than SCoT, as it showed the greatest genetic polymorphism. In addition, SRAP (Me1-Em2 and Me2-Em5) displayed the largest number of polymorphic bands, but the largest specific bands were given by Me4-Em2 and Me1-Em5 SRAP primers. Thus, the wheat genotypes were considered to be the best primers to determine and distinguish the wheat genotypes. In addition, in both SRAP and combined data analysis, the similarity matrix showed a close relationship between Sakha 69 and Giza 160 genotypes. At the same time, the SRAP clusters had a relatively direct connection with plant wheat taxonomy. The ability of the SRAP marker to distinguish and decide genetic diversity among genotypes is considered to be the most important feature of the best marker [55]. In this respect, [58] reported that several markers, such as inter-simple sequence repeat (ISSR), random amplified polymorphic DNA (RAPD) and amplified fragment length polymorphism (AFLP), have been applied to address hypotheses at lower taxonomic levels in the past few decades. But, lately, sequence-related amplified polymorphism (SRAP) markers have been established, which are done to amplify coding regions of DNA with primers targeting open reading frames. These markers have been confirmed to be robust and highly variable, on equivalence with AFLP, and are attained through a significantly less technically demanding process. Moreover, the SRAP markers have been used for assessing the genetic diversity of large germplasm collections. In this respect, [59] reported that the Simple Sequences Repeats (SSR) and SRAP were fast, accurate, and high throughput fingerprinting could be acquired using those markers, from the combined analysis, which revealed the existence of significant variation among the 33 accessions. The most distant accessions can be used by breeders to develop improved sorghum genotypes. Therefore, SRAP and SCoT markers may be appropriate for distinguishing the resistance and vulnerability of wheat genotypes to stem and leaf rust as a result of the wide genetic variation observed among the 18 wheat genotypes. On the other hand, the association of molecular markers with stem and leaf rust evaluation is an important factor in understanding the genetic role of tolerance by predicting the genomic regions that affect the plant’s response to stem and leaf rust disease. In this investigation, for the first time, the activity of chitosan nanoparticles (CuChNp) was studied and shown to have the potential to inhibit stem and leaf rust in studied Egyptian wheat genotypes. In this respect, Kheiri et al. [60] reported that CS/NPs have important inhibitory effects on the growth of fungi, colony formation and conidial germination of F. grinearum. In addition, in vitro plates treated with chitosan-Cu nanoparticles showed effectively inhibited mycelial growth and spore germination of Alternaria alternata (90%), Macrophomina phaseolina (63%), and Rhizoctonia solanii (60%) [61]. The antimicrobial effect of chitosan on pathogens (bacteria, fungi and viruses) is based on several mechanisms [62]. The positive charge of protonated chitosan allows electrostatic interactions with the negative charge of the surface of the pathogen [63].The damage to the cells and the leakage of the pathogen increase the permeability of the membrane, resulting in cell death [32]. Chitosan then chelates the necessary elements (including metal ions, minerals, and nutrients) for the creation of pathogens, thus preventing the normal growth of pathogens [53]. The interaction of pathogens with penetrated chitosan by DNA/RNA contributes to the inhibition of mRNA syncretism and pathogen reproduction and the deposition of chitosan on the microbial surface of pathogens [64]. Finally, chitosan deposition on the microbial surface of pathogens constitutes a barrier to the extracellular transport of critical nutrients and metabolites from entering the cell, thereby inhibiting the normal growth of pathogens [13]. Due to the large surface area that comes in contact with the pathogens, the efficiency of the system in action can be improved by the small size of the chitosan nanoformulations. The small size can also increase the absorption and increase the thick coat of seeds, plant tissues, as well as the cell membranes of pathogens of the penetrated and permeated chitosan, resulting in better plant immunity and defensive response activities. This is the first study to use Cu-chitosan composite nanoparticles in foliar fertilizer applications that could help in maintaining and controlling rust. Moreover, the activity and mode of action of chitosan-copper composite nanoparticles in controlling the wheat disease stem rust were studied using molecular docking analysis. Computational modeling could determine exceptional information to understand the mechanism of the mode of action of the antifungal molecules that inhibit the fungal infection process. The molecular docking approach was used to predict the molecules that have the ability to bind specifically to the protein active site that is responsible for the fungal infection process 34. In the present study, the docking of the active molecules of the studied chitosan-copper nanoparticles with two essential proteins involved in the stem and leaf rust development pathway was evaluated. In this respect, the results of molecular docking analysis showed that the MPAK1 protein for stem rust was bound to chitosan with a binding affinity of-6.9 kcal/mol, while the MPAK1 was bound to cu-chitosan nanoparticles with a binding affinity of-6.6kcal/mol. On the other hand, the PGAT protein for leaf rust was bound to chitosan with a binding affinity of-4.6kcal/mol, while this protein also bound to cu-chitosan nanoparticles with a binding affinity of-5.6 kcal/mol. Hence, this leads to inhibition of stem and leaf rust pathogenicity. These proteins are a vital element of the pathway of the transduction signal that controls numerous stem and leaf rust infection processes in all organisms. They are responsible for the phosphorylation of target transcription factors that trigger particular genes [65,66]. In many fungi, molecular genetic studies have revealed that MAPK homologs fall into three major subgroups defined in Saccharomyces cerevisiae based on the following diverse functions: osmoregulation and other stress responses (ScHog1 and YSAPK-like), various developmental processes such as mating and filamentation, hyphal formation, conidiation, and conidial germination (ScFus3/ In pathogenic fungi, mutants tend to affect pathogenesis in homologs of all three classes, which is not surprising given the broad functions they impinge on. The MAPK gene was isolated for the first time from P. triticina by Guanggan et al., [67]. This wheat leaf rust gene was called PtMAPK1 and revealed that it codes for a protein that is closely homologous to the Ustilago maydis YERK1 subfamily kinases (Ubc3/Kpp2 and Kpp6). These MAPKs can play a role in mating interactions and invasion of plant tissue and pathogenic growth after mating. Also, it plays an important role in haustorium and infection peg formation [68,69]. Presently, no crystalline structural data has been reported for MPAK1 and PGAT. This information gap hinders the development and improvement of MPAK1 and PGAT modulators. In the present study, 3D MPAK1 and PGAT protein structures were plotted using SWISS-MODEL according to the two 2VKN and 2FA2 putative templates, which have proved to be a powerful and valuable tool for homology modeling [70]. Thus, docking analysis confirmed the ability of the cu-chitosan nanoparticles to inhibit the two rust studied pathogens through their high binding affinity for modelling MAPK machinery, resulting in disturbance of key pathways involved in growth, mating and virulence of the pathogen. This will help in the prevention and management of leaf and stem rust in an eco-friendly manner. Our findings during this investigation concluded that primers for SRAP (Me1-Em2 and Me2-Em5) and SCoT13 proved to be sufficient for assessing the genetic diversity of the tested wheat genotypes. Thus, to classify the resistance genes, their sequences could be used to identify the parents of wheat genotypes. Besides, spraying foliar wheat plants with the cu-chitosan nanoparticles composite plant reduced the form of host reaction to stem and leaf rusts.

5. Conclusion

Wheat production can be enhanced by using tolerant and resistant genotypes. Therefore, evaluation and assessment of the stem and leaf rust resistance potential in wheat through marker analysis could potentially diminish the cost of breeding programs and be a powerful strategy for the selection of the most resistant stem and leaf rust genotype. SARAP markers were more efficient and had stronger discriminating power than SCoT markers for assessing the genetic diversity of the tested wheat genotypes, as shown by the number of specific bands, polymorphism percentage, and high values of the genetic diversity indices. Besides, spraying foliar wheat plants with the cu-chitosan nanoparticles composite plant reduced the form of host reaction to stem and leaf rust and increased incubation and latent periods. An insight into the interactions between cu-chitosan nanoparticles and MAPK P. graminis tritici or MAPK P. triticina protein is given in the computational analysis. Besides confirming the validity of virtual screening techniques, our predictive and experimental results could provide a valuable starting point for the design of MAPK P. triticina I and PGTG of P. graminis f. sp. tritici nhibitors are able to limit the transduction signal that controls numerous stem and leaf rust infection processes. It elucidates the way the fungal infection is inhibited by MAPK protein targeting. This is the first report on the use of (CuChNp) of foliar fertilizers for controlling rust disease in wheat. The results showed that (CuChNp) could be a useful biological pesticide for controlling stem and leaf rust diseases. We proposed that the CuChNp represents a safe and good opportunity for the development of commercial plant protection against rust disease. However, with regard to the antifungal activity of CuChNp, many experimental trials are needed to understand the particular mechanism of penetration and transportation of these treatments into plant cells and their interaction with fungal cells in these cells.

A virulence/virulence pattern of 20 Puccinia graminis f.sp. tritici pathotypes used to study stem rust resistance of eighteen Egyptian wheat genotypes.

(DOCX) Click here for additional data file.

A virulence/virulence, based on seedling reaction for 5 isolates leaf rust in 2019/2020 season.

(DOCX) Click here for additional data file.

Genetic similarity matrix among the 18 wheat genotypes based on the Dice coefficient generated from SCOT marker.

(DOCX) Click here for additional data file.

Genetic similarity matrix among the 18 wheat genotypes based on the Dice coefficient generated from SRAP marker.

(DOCX) Click here for additional data file.

Genetic similarity matrix among the 18 wheat genotypes based on the Dice coefficient generated from combined data.

(DOCX) Click here for additional data file.

Sequence identity, Query coverage and QMEAN scores of templates structure for homology model building of MAPK1 and PgMAPK proteins of P. triticina and P. graminis tritici through BLAST against RCSB PDB.

(DOCX) Click here for additional data file. 23 Jun 2021 PONE-D-21-08742 Molecular identification of leaf, stem rust resistance in eighteen Egyptian wheat genotypes and the antifungal activity of chitosan-copper nanoparticles by molecular docking analysis PLOS ONE Dear Dr. omar, Thank you for submitting your manuscript to PLOS ONE. After careful consideration, we feel that it has merit but does not fully meet PLOS ONE’s publication criteria as it currently stands. Therefore, we invite you to submit a revised version of the manuscript that addresses the points raised during the review process. Please submit your revised manuscript by Aug 07 2021 11:59PM. If you will need more time than this to complete your revisions, please reply to this message or contact the journal office at plosone@plos.org. When you're ready to submit your revision, log on to https://www.editorialmanager.com/pone/ and select the 'Submissions Needing Revision' folder to locate your manuscript file. Please include the following items when submitting your revised manuscript: A rebuttal letter that responds to each point raised by the academic editor and reviewer(s). You should upload this letter as a separate file labeled 'Response to Reviewers'. A marked-up copy of your manuscript that highlights changes made to the original version. You should upload this as a separate file labeled 'Revised Manuscript with Track Changes'. An unmarked version of your revised paper without tracked changes. You should upload this as a separate file labeled 'Manuscript'. If you would like to make changes to your financial disclosure, please include your updated statement in your cover letter. Guidelines for resubmitting your figure files are available below the reviewer comments at the end of this letter. If applicable, we recommend that you deposit your laboratory protocols in protocols.io to enhance the reproducibility of your results. Protocols.io assigns your protocol its own identifier (DOI) so that it can be cited independently in the future. For instructions see: http://journals.plos.org/plosone/s/submission-guidelines#loc-laboratory-protocols. Additionally, PLOS ONE offers an option for publishing peer-reviewed Lab Protocol articles, which describe protocols hosted on protocols.io. Read more information on sharing protocols at https://plos.org/protocols?utm_medium=editorial-email&utm_source=authorletters&utm_campaign=protocols. We look forward to receiving your revised manuscript. Kind regards, Himanshu Sharma Academic Editor PLOS ONE Additional Editor Comments (if provided): The manuscript entitled by Molecular identification of leaf, stem rust resistance in eighteen Egyptian wheat genotypes and the antifungal activity of chitosan-copper nanoparticles by molecular docking analysis by hanaa omar has been critically reviewed by the competent reviewers and based on their comments I will not be positive and authors have to revise the manuscript critically according to the queries. So that all the mistakes will be rectify and have sound message for the audience. My special comments to authors are: 1. There are lots of mistake so read the manuscript critically and edit it. 2. Improve the Results, Discussion and rewrite the conclusion. 3. The authors have used very small no of phenotype merely 18 and the number is not sufficient for phenotype of rust resistance, Peoples used a panel 200 or 300 phenotype to score the data for at three different places for 3 years. The gene pool is very narrow and results may be biased. Is it possible for authors to increase the number of samples? In the light of these comments revise the manuscript critically. Journal Requirements: When submitting your revision, we need you to address these additional requirements. 1.Please ensure that your manuscript meets PLOS ONE's style requirements, including those for file naming. The PLOS ONE style templates can be found at and https://journals.plos.org/plosone/s/file?id=ba62/PLOSOne_formatting_sample_title_authors_affiliations.pdf 2. We note that the grant information you provided in the ‘Funding Information’ and ‘Financial Disclosure’ sections do not match. When you resubmit, please ensure that you provide the correct grant numbers for the awards you received for your study in the ‘Funding Information’ section. 3. In your Data Availability statement, you have not specified where the minimal data set underlying the results described in your manuscript can be found. PLOS defines a study's minimal data set as the underlying data used to reach the conclusions drawn in the manuscript and any additional data required to replicate the reported study findings in their entirety. All PLOS journals require that the minimal data set be made fully available. For more information about our data policy, please see http://journals.plos.org/plosone/s/data-availability. Upon re-submitting your revised manuscript, please upload your study’s minimal underlying data set as either Supporting Information files or to a stable, public repository and include the relevant URLs, DOIs, or accession numbers within your revised cover letter. For a list of acceptable repositories, please see http://journals.plos.org/plosone/s/data-availability#loc-recommended-repositories. Any potentially identifying patient information must be fully anonymized. Important: If there are ethical or legal restrictions to sharing your data publicly, please explain these restrictions in detail. Please see our guidelines for more information on what we consider unacceptable restrictions to publicly sharing data: http://journals.plos.org/plosone/s/data-availability#loc-unacceptable-data-access-restrictions. Note that it is not acceptable for the authors to be the sole named individuals responsible for ensuring data access. We will update your Data Availability statement to reflect the information you provide in your cover letter. 5. Please amend the manuscript submission data (via Edit Submission) to include authors Neama H.Osman, Nour El-Houda A. Reyad , Mohamed A. Abou-Zeid. 6. Please include your full ethics statement in the ‘Methods’ section of your manuscript file. In your statement, please include the full name of the IRB or ethics committee who approved or waived your study, as well as whether or not you obtained informed written or verbal consent. If consent was waived for your study, please include this information in your statement as well. 7. Please upload a new copy of Figure 1,3,5,6 and 8 as the detail is not clear. Please follow the link for more information: " ext-link-type="uri" xlink:type="simple">https://blogs.plos.org/plos/2019/06/looking-good-tips-for-creating-your-plos-figures-graphics/" https://blogs.plos.org/plos/2019/06/looking-good-tips-for-creating-your-plos-figures-graphics/”. 8. Please ensure that you refer to Figure 5 in your text as, if accepted, production will need this reference to link the reader to the figure. 9. We note that Figures 1,2,3,4,6,7 and 8 in your submission contain copyrighted images. All PLOS content is published under the Creative Commons Attribution License (CC BY 4.0), which means that the manuscript, images, and Supporting Information files will be freely available online, and any third party is permitted to access, download, copy, distribute, and use these materials in any way, even commercially, with proper attribution. For more information, see our copyright guidelines: http://journals.plos.org/plosone/s/licenses-and-copyright. We require you to either (1) present written permission from the copyright holder to publish these figures specifically under the CC BY 4.0 license, or (2) remove the figures from your submission: a. You may seek permission from the original copyright holder of Figures 1,2,3,4,6,7 and 8 to publish the content specifically under the CC BY 4.0 license. We recommend that you contact the original copyright holder with the Content Permission Form (http://journals.plos.org/plosone/s/file?id=7c09/content-permission-form.pdf) and the following text: “I request permission for the open-access journal PLOS ONE to publish XXX under the Creative Commons Attribution License (CCAL) CC BY 4.0 (http://creativecommons.org/licenses/by/4.0/). Please be aware that this license allows unrestricted use and distribution, even commercially, by third parties. Please reply and provide explicit written permission to publish XXX under a CC BY license and complete the attached form.” Please upload the completed Content Permission Form or other proof of granted permissions as an "Other" file with your submission. In the figure caption of the copyrighted figure, please include the following text: “Reprinted from [ref] under a CC BY license, with permission from [name of publisher], original copyright [original copyright year].” b. If you are unable to obtain permission from the original copyright holder to publish these figures under the CC BY 4.0 license or if the copyright holder’s requirements are incompatible with the CC BY 4.0 license, please either i) remove the figure or ii) supply a replacement figure that complies with the CC BY 4.0 license. Please check copyright information on all replacement figures and update the figure caption with source information. If applicable, please specify in the figure caption text when a figure is similar but not identical to the original image and is therefore for illustrative purposes only. 10. Please include captions for your Supporting Information files at the end of your manuscript, and update any in-text citations to match accordingly. Please see our Supporting Information guidelines for more information: http://journals.plos.org/plosone/s/supporting-information. 11.We suggest you thoroughly copyedit your manuscript for language usage, spelling, and grammar. If you do not know anyone who can help you do this, you may wish to consider employing a professional scientific editing service. Whilst you may use any professional scientific editing service of your choice, PLOS has partnered with both American Journal Experts (AJE) and Editage to provide discounted services to PLOS authors. Both organizations have experience helping authors meet PLOS guidelines and can provide language editing, translation, manuscript formatting, and figure formatting to ensure your manuscript meets our submission guidelines. To take advantage of our partnership with AJE, visit the AJE website (http://learn.aje.com/plos/) for a 15% discount off AJE services. To take advantage of our partnership with Editage, visit the Editage website (www.editage.com) and enter referral code PLOSEDIT for a 15% discount off Editage services.  If the PLOS editorial team finds any language issues in text that either AJE or Editage has edited, the service provider will re-edit the text for free. Upon resubmission, please provide the following: The name of the colleague or the details of the professional service that edited your manuscript A copy of your manuscript showing your changes by either highlighting them or using track changes (uploaded as a *supporting information* file) . [Note: HTML markup is below. Please do not edit.] Reviewers' comments: Reviewer's Responses to Questions Comments to the Author 1. Is the manuscript technically sound, and do the data support the conclusions? The manuscript must describe a technically sound piece of scientific research with data that supports the conclusions. Experiments must have been conducted rigorously, with appropriate controls, replication, and sample sizes. The conclusions must be drawn appropriately based on the data presented. Reviewer #1: Yes Reviewer #2: Yes ********** 2. Has the statistical analysis been performed appropriately and rigorously? Reviewer #1: Yes Reviewer #2: Yes ********** 3. Have the authors made all data underlying the findings in their manuscript fully available? The PLOS Data policy requires authors to make all data underlying the findings described in their manuscript fully available without restriction, with rare exception (please refer to the Data Availability Statement in the manuscript PDF file). The data should be provided as part of the manuscript or its supporting information, or deposited to a public repository. For example, in addition to summary statistics, the data points behind means, medians and variance measures should be available. If there are restrictions on publicly sharing data—e.g. participant privacy or use of data from a third party—those must be specified. Reviewer #1: Yes Reviewer #2: Yes ********** 4. Is the manuscript presented in an intelligible fashion and written in standard English? PLOS ONE does not copyedit accepted manuscripts, so the language in submitted articles must be clear, correct, and unambiguous. Any typographical or grammatical errors should be corrected at revision, so please note any specific errors here. Reviewer #1: Yes Reviewer #2: No ********** 5. Review Comments to the Author Please use the space provided to explain your answers to the questions above. You may also include additional comments for the author, including concerns about dual publication, research ethics, or publication ethics. (Please upload your review as an attachment if it exceeds 20,000 characters) Reviewer #1: Comments: 1. Wheat production is negatively affected by the attack of stem and rust diseases in Egypt and worldwide. Wheat production is negatively affected by the attack of stem and leaf rust diseases in Egypt and worldwide. 2. In this respect, out of 20 scot and SRAP primers eleven and fourteen primers, showed polymorphism in 18 evaluated wheat genotypes, respectively. 3. Query: scot (SCoT), check in all manuscript 4. These markers have been listed in numerous references because they are powerful in determining the genetic diversity of various crops, such as wheat (Abou-Deif, et al., 2013 and El-Moneim, 2019). Query: only these are markers to show up diversity what about other SSR and ILP markers if any provide references. 5. In this respect, out of 20 scot and SRAP primers eleven and fourteen primers, showed polymorphism in 18 evaluated wheat genotypes, respectively. SCoT and SRAP ones generated 140 and 121 polymorphic bands with 97 and 99% polymorphism, respectively Query: rate of polymorphism is very high, is any positive or negative control were taken ? 6. Diverse wheat genotypes belong to same background or different? Discussion section 7. Write concluding lines that showed the implementation of chitosan nanoparticles methods mostly suitable for which type of rust infection whether for leaf or stem. 8. Docking discussion is missing put concluding lines about what are the future aspect and what you conclude from this data 9. Heat map quality is poor improve it, check all image quality 10. What is the actual product size of eleven ScoT primers 11. What is the future aspect of overall study? 12. Insert line number in all manuscript Reviewer #2: The manuscript is a useful work and may be considered after the following comments are addressed. Title needs to be changed. Abstract: Uniform primer name SCoT not Scot. It is unclear in abstract if the chitosan nanoparticles play important role in stem or leaf rust or both? You mentioned SRAP and SCoT markers are useful for microbial diversity and cultivar? Why they are suitable in case of wheat? Why not other markers such as SSR or SNP? Why diversity analysis was performed in wheat genotypes? What was its relation with rust? How the authors avoided the rust pathogen DNA during molecular fingerprinting? These markers will amplify every DNA. Give a brief description about each marker type used and their advantages. CuChNp mention full form at its first occurrence in text. Why SWISS model was preferred for modelling MAPK? What are ideal criteria for a homology model to be stable and good for analysis? Elaborate methods for structure modelling, validation (parameters), ligand-protein interaction and docking. Make it more clear. Table 4 and 5 Where are high infection genotypes as mentioned in foot notes? Using what data and how heat map was generated. Mention in the methods. ********** 6. PLOS authors have the option to publish the peer review history of their article (what does this mean?). If published, this will include your full peer review and any attached files. If you choose “no”, your identity will remain anonymous but your review may still be made public. Do you want your identity to be public for this peer review? For information about this choice, including consent withdrawal, please see our Privacy Policy. Reviewer #1: Yes: Pankaj Kumar Reviewer #2: No [NOTE: If reviewer comments were submitted as an attachment file, they will be attached to this email and accessible via the submission site. Please log into your account, locate the manuscript record, and check for the action link "View Attachments". If this link does not appear, there are no attachment files.] While revising your submission, please upload your figure files to the Preflight Analysis and Conversion Engine (PACE) digital diagnostic tool, https://pacev2.apexcovantage.com/. PACE helps ensure that figures meet PLOS requirements. To use PACE, you must first register as a user. Registration is free. Then, login and navigate to the UPLOAD tab, where you will find detailed instructions on how to use the tool. If you encounter any issues or have any questions when using PACE, please email PLOS at figures@plos.org. Please note that Supporting Information files do not need this step. 24 Aug 2021 Authors reply list To: Professor Vaughan Hurry Manuscript Title: Molecular identification of leaf, stem rust resistance in eighteen Egyptian wheat genotypes and the antifungal activity of chitosan-copper nanoparticles by molecular docking analysis. Corresponding author: Hanaa8324@yahoo.com Hanaa S. Omar1,2 Abdullah Al Mutery ,3,4 , Neama H.Osman , 1| Nour El-Houda A. Reyad5, Mohamed A. Abou-Zeid6 Dear Professor We are grateful to the editors and reviewers for their time and constructive comments on our manuscript. We think that reviewer's constructive comments clearly contributed in improving the manuscript. We have carefully addressed all the comments as possible. The corresponding changes and refinements made in the revised paper are summarized below. Line No. Existing to be written 1. There are lots of mistake so read the manuscript critically and edit it. In response to this comment we edited it as required in all manuscript. We tried our best to improve the English language by the help of professional grammar checker. 2. Improve the Results, Discussion and rewrite the conclusion. It has already done with improvements to the Results, discussion rewrite the conclusion sections All 3. The authors have used very small no of phenotype merely 18 and the number is not sufficient for phenotype of rust resistance, Peoples used a panel 200 or 300 phenotype to score the data for at three different places for 3 years. The gene pool is very narrow and results may be biased. Is it possible for authors to increase the number of samples? This study was carried out on Egyptian wheat genotypes. Besides, the numbers of Egyptian wheat genotypes are small. These are the Egyptian genotypes that have been selected from the breeding programs for the implementation of our current study. The aim is a complete study of the genetic diversity of these genotypes to know their sensitivity and resistance to stem and leaf rust disease, and then the application of nanotechnology used in resisting this disease. Moreover, the molecular docking analysis was also used to assess the Cu-chitosan nanoparticle treatment and its mode of action in disease control management. We can't increase the number of cultivars, because this requires waiting for two consecutive years, and therefore it is difficult to do so. Reviewer1 Dear reviewer1, we as authors appreciate your valuable and precious comments which considerably helped to improve and strengthen the manuscript. We are to provide the following replies hoping you will find them satisfactory and properly addressing your concerns. We have addressed the reviewer’s suggestions and revised the manuscript accordingly. Please find attached a detailed point by point response to the points of concern. Comments from the editors and reviewers: Line No. Existing to be written Wheat production is negatively affected by the attack of stem and rust diseases in Egypt and worldwide. Wheat production is negatively affected by the attack of stem and leaf rust diseases in Egypt and worldwide. It has already done with removed that paragraph and added new paragraph to the abstract section. Wheat has a remarkable importance among cereals worldwide. Wheat stem and leaf rust constitute the main threats that destructively influence grain quality and yield production. Pursuing resistant cultivars and developing new genotypes including resistance genes is believed to be the most effective tool to overcome these challenges. In this respect, out of 20 scot and SRAP primers eleven and fourteen primers, showed polymorphism in 18 evaluated wheat genotypes, respectively. In response to this comment we edited it the correct the paragraph in results section Query: scot (SCoT), check in all manuscript In response to this comment we edited it the correct way in all manuscript 4. These markers have been listed in numerous references because they are powerful in determining the genetic diversity of various crops, such as wheat (Abou-Deif, et al., 2013 and El-Moneim, 2019). We already modify this part in discussion section In response to this comment, we edited it the correct way as required in this paragraph and in almost all results and discussion of SCOT and SRAP sections in the manuscript. Abou-Deif, et al., 2013 used the ISSR molecular marker to estimate the genetic diversity between some Egyptian wheat genotypes. But El-Moneim, 2019 and Gowayed and El-Moneim (2021) used ISSR and SCoT primers to determine and evaluate some Egyptian wheat genotypes tolerant to drought and salt stress, respectively. But our current study used different primers for SCoT in genetic diversity and evaluation of Egyptian wheat genotypes' resistance to stem and leaf rust diseases. 5 Query: only these are markers to show up diversity what about other SSR and ILP markers if any provide references. In response to this comment we edited it as required in discussion section for SSR reference. Rate of polymorphism is very high, is any positive or negative control were taken? The rate of polymorphism is very high in positive control 6 Diverse wheat genotypes belong to same background or different? Different background Discussion section 7. Write concluding lines that showed the implementation of chitosan nanoparticles methods mostly suitable for which type of rust infection whether for leaf or stem. In response to this comment we edited in abstract, results, discussion and conclusion sections and added a new table (10) for leaf rust disease. Docking discussion is missing put concluding lines about what are the future aspect and what you conclude from this data In response to this comment, we edited it as required in discussion and conclusion sections. 9. Heat map quality is poor improve it, check all image quality We change and improve the figure of Heat map and added a new figure for PCA in our results and improved all figures. 10 What is the actual product size of eleven ScoT primers We can add the product sizes for SCoT and SRAP in tables (7 and 8) and result sections 11. What is the future aspect of overall study? In response to this comment we edited it as required in conclusion section 12. Insert line number in all manuscript Was done Reviewer2 Dear reviewer, we thank you for the constructive remarks and comments on the manuscript. We have taken the comments on board to improve and clarify the manuscript. Please find below a detailed point-by-point response to all comments. paragraph Title needs to be changed. We already change title manuscript to Genetic Diversity, Antifungal Evaluation and Molecular Docking Studies of Cu-chitosan nanoparticles as Prospective Stem rust Inhibitor Candidates among some wheat genotypes Uniform primer name SCoT not Scot. It was already done. It is unclear in abstract if the chitosan nanoparticles play important role in stem or leaf rust or both? It was already done the chitosan nanoparticles play important role in both stem or leaf rust You mentioned SRAP and SCoT markers are useful for microbial diversity and cultivar? Why they are suitable in case of wheat? Why not other markers such as SSR or SNP? In response to this comment we edited it as required in discussion. The gene-targeted molecular markers (SCoT) and sequence-related amplified polymorphisms (SRAP) analyses were used in the current study to determine their elevated power in polymorphism identification in wheat. The SCoT and SRAP markers were used to estimate and evaluate the genetic diversity among Egyptian wheat to stem and leaf rust disease. The results revealed that the gene-targeted molecular marker (SCoT) has several advantages over the use of dominant random markers (such as ISSR, RAPD, and AFLP). However, these markers reveal genetic diversity from the genic region in the genome and this functional diversity can be used in any species (Paliwal et.al., 2013). Adil et.al., (2014) reported that the Simple Sequences Repeats (SSR) and SRAP were fast, accurate, and high throughput fingerprinting could be acquired using those markers, from the combined analysis, which revealed the existence of significant variation among the 33 accessions. So in this study used SRAP as new technique to estimate genetic diversity between wheat genotypes . Why diversity analysis was performed in wheat genotypes? What was its relation with rust? In response to this comment we edited it as required in discussion. Wheat stem and leaf rust constitute the main threats that destructively influence grain quality and yield production. Genetic diversity was used to detect leaf and stem rust-resistant wheat cultivars. And then the activity of chitosan nanoparticles (CuChNp) was applied on susceptible to stem and leaf rust in studied Egyptian wheat genotypes. How the authors avoided the rust pathogen DNA during molecular fingerprinting? These markers will amplify every DNA. DNA isolation from Egyptian wheat genotypes without infection to estimate genetic diversity. Pathogenic DNA doesn't exist in samples. Give a brief description about each marker type used and their advantages. In response to this comment we edited in discussion section The gene-targeted molecular marker (SCoT) has several advantages over the use of dominant random markers (such as ISSR, RAPD, and AFLP). However, these markers reveal genetic diversity from the genic region in the genome and this functional diversity can be used in any species (Paliwal et.al.,2013). Moreover, the SRAP marker system is a new, simple, and efficient marker system that can be adapted for a variety of purposes, such as linkage map construction (Yeboah et al. 2007), genomic and cDNA fingerprinting gene tagging (Li and Quiros 2001), and genetic diversity analysis. We was added this part in discussion section CuChNp mention full form at its first occurrence in text. Was done Why SWISS model was preferred for modelling MAPK? SWISS-MODEL is powerful and valuable tool for homology modeling. There are many references that use the Swiss model in homology modeling , (Cuccioloni et al. 2017 ) , (Waterhouse, et al., 2018) and Cuccioloni et al. 2020 What are ideal criteria for a homology model to be stable and good for analysis? SWISS-MODEL is powerful and valuable tool for homology modeling (Cuccioloni et al. 2020). Elaborate methods for structure modelling, validation (parameters), ligand-protein interaction and docking. In response to this comment we edited it as required in material and method section. Using what data and how heat map was generated. Mention in the methods. Make it more clear. In response to this comment we edited it as required in material and method section. Table 4 and 5 Where high infection genotypes are as mentioned in foot notes? Was done Submitted filename: response for reviewer.docx Click here for additional data file. 15 Sep 2021 Genetic Diversity, Antifungal Evaluation and Molecular Docking Studies of Cu-chitosan nanoparticles as Prospective Stem rust Inhibitor Candidates among some Egyptian wheat genotypes PONE-D-21-08742R1 Dear Dr. Omar, We’re pleased to inform you that your manuscript has been judged scientifically suitable for publication and will be formally accepted for publication once it meets all outstanding technical requirements. Within one week, you’ll receive an e-mail detailing the required amendments. When these have been addressed, you’ll receive a formal acceptance letter and your manuscript will be scheduled for publication. An invoice for payment will follow shortly after the formal acceptance. To ensure an efficient process, please log into Editorial Manager at http://www.editorialmanager.com/pone/, click the 'Update My Information' link at the top of the page, and double check that your user information is up-to-date. If you have any billing related questions, please contact our Author Billing department directly at authorbilling@plos.org. If your institution or institutions have a press office, please notify them about your upcoming paper to help maximize its impact. If they’ll be preparing press materials, please inform our press team as soon as possible -- no later than 48 hours after receiving the formal acceptance. Your manuscript will remain under strict press embargo until 2 pm Eastern Time on the date of publication. For more information, please contact onepress@plos.org. Kind regards, Himanshu Sharma Academic Editor PLOS ONE Additional Editor Comments (optional): Based on the recommendations of the reviewers manuscript is accepted for publication, there are always possibilities for improvement So authors can improve the manuscript at the time of proofread. Reviewers' comments: Reviewer's Responses to Questions Comments to the Author 1. If the authors have adequately addressed your comments raised in a previous round of review and you feel that this manuscript is now acceptable for publication, you may indicate that here to bypass the “Comments to the Author” section, enter your conflict of interest statement in the “Confidential to Editor” section, and submit your "Accept" recommendation. Reviewer #1: All comments have been addressed Reviewer #2: All comments have been addressed ********** 2. Is the manuscript technically sound, and do the data support the conclusions? The manuscript must describe a technically sound piece of scientific research with data that supports the conclusions. Experiments must have been conducted rigorously, with appropriate controls, replication, and sample sizes. The conclusions must be drawn appropriately based on the data presented. Reviewer #1: Yes Reviewer #2: Yes ********** 3. Has the statistical analysis been performed appropriately and rigorously? Reviewer #1: Yes Reviewer #2: Yes ********** 4. Have the authors made all data underlying the findings in their manuscript fully available? The PLOS Data policy requires authors to make all data underlying the findings described in their manuscript fully available without restriction, with rare exception (please refer to the Data Availability Statement in the manuscript PDF file). The data should be provided as part of the manuscript or its supporting information, or deposited to a public repository. For example, in addition to summary statistics, the data points behind means, medians and variance measures should be available. If there are restrictions on publicly sharing data—e.g. participant privacy or use of data from a third party—those must be specified. Reviewer #1: Yes Reviewer #2: Yes ********** 5. Is the manuscript presented in an intelligible fashion and written in standard English? PLOS ONE does not copyedit accepted manuscripts, so the language in submitted articles must be clear, correct, and unambiguous. Any typographical or grammatical errors should be corrected at revision, so please note any specific errors here. Reviewer #1: Yes Reviewer #2: Yes ********** 6. Review Comments to the Author Please use the space provided to explain your answers to the questions above. You may also include additional comments for the author, including concerns about dual publication, research ethics, or publication ethics. (Please upload your review as an attachment if it exceeds 20,000 characters) Reviewer #1: Authors fulfill all comments now, i think its more stream line and ready for publishing. Reviewer #2: The questions raised were appropriately answered. The revised manuscript may be considered for publishing. ********** 7. PLOS authors have the option to publish the peer review history of their article (what does this mean?). If published, this will include your full peer review and any attached files. If you choose “no”, your identity will remain anonymous but your review may still be made public. Do you want your identity to be public for this peer review? For information about this choice, including consent withdrawal, please see our Privacy Policy. Reviewer #1: No Reviewer #2: No 19 Oct 2021 PONE-D-21-08742R1 Genetic Diversity, Antifungal Evaluation and Molecular Docking Studies of Cu-chitosan nanoparticles as Prospective Stem rust Inhibitor Candidates among some Egyptian wheat genotypes Dear Dr. Omar: I'm pleased to inform you that your manuscript has been deemed suitable for publication in PLOS ONE. Congratulations! Your manuscript is now with our production department. If your institution or institutions have a press office, please let them know about your upcoming paper now to help maximize its impact. If they'll be preparing press materials, please inform our press team within the next 48 hours. Your manuscript will remain under strict press embargo until 2 pm Eastern Time on the date of publication. For more information please contact onepress@plos.org. If we can help with anything else, please email us at plosone@plos.org. Thank you for submitting your work to PLOS ONE and supporting open access. Kind regards, PLOS ONE Editorial Office Staff on behalf of Dr. Himanshu Sharma Academic Editor PLOS ONE
  26 in total

Review 1.  MAP kinase modules: many roads home.

Authors:  Malavika Raman; Melanie H Cobb
Journal:  Curr Biol       Date:  2003-11-11       Impact factor: 10.834

2.  Gene-targeted molecular phylogeny, phytochemical analysis, antibacterial and antifungal activities of some medicinal plant species cultivated in Egypt.

Authors:  Hanaa S Omar; Tarek R Elsayed; Nour El-Houda A Reyad; Israa M Shamkh; Mohamed S Sedeek
Journal:  Phytochem Anal       Date:  2020-12-11       Impact factor: 3.373

3.  Preparation and antibacterial activity of chitosan nanoparticles.

Authors:  Lifeng Qi; Zirong Xu; Xia Jiang; Caihong Hu; Xiangfei Zou
Journal:  Carbohydr Res       Date:  2004-11-15       Impact factor: 2.104

4.  Phylogenetics of flowering plants based on combined analysis of plastid atpB and rbcL gene sequences.

Authors:  V Savolainen; M W Chase; S B Hoot; C M Morton; D E Soltis; C Bayer; M F Fay; A Y de Bruijn; S Sullivan; Y L Qiu
Journal:  Syst Biol       Date:  2000-06       Impact factor: 15.683

5.  ClustVis: a web tool for visualizing clustering of multivariate data using Principal Component Analysis and heatmap.

Authors:  Tauno Metsalu; Jaak Vilo
Journal:  Nucleic Acids Res       Date:  2015-05-12       Impact factor: 16.971

6.  Interfering with the high-affinity interaction between wheat amylase trypsin inhibitor CM3 and toll-like receptor 4: in silico and biosensor-based studies.

Authors:  Massimiliano Cuccioloni; Matteo Mozzicafreddo; Laura Bonfili; Valentina Cecarini; Mara Giangrossi; Maurizio Falconi; Shin-Ichiroh Saitoh; Anna Maria Eleuteri; Mauro Angeletti
Journal:  Sci Rep       Date:  2017-10-13       Impact factor: 4.379

7.  VfODB: a comprehensive database of ESTs, EST-SSRs, mtSSRs, microRNA-target markers and genetic maps in Vicia faba.

Authors:  Morad M Mokhtar; Ebtissam H A Hussein; Salah El-Din S El-Assal; Mohamed A M Atia
Journal:  AoB Plants       Date:  2020-11-29       Impact factor: 3.276

8.  Detection of genetic divergence among some wheat (Triticum aestivum L.) genotypes using molecular and biochemical indicators under salinity stress.

Authors:  Salah M H Gowayed; Diaa Abd El-Moneim
Journal:  PLoS One       Date:  2021-03-29       Impact factor: 3.240

9.  Sequence-related amplified polymorphism (SRAP) markers: A potential resource for studies in plant molecular biology(1.).

Authors:  Daniel W H Robarts; Andrea D Wolfe
Journal:  Appl Plant Sci       Date:  2014-07-11       Impact factor: 1.936

10.  Gene-targeted molecular phylogeny, phytochemical profiling, and antioxidant activity of nine species belonging to family Cactaceae.

Authors:  Heba H Abouseadaa; Mohamed A M Atia; Inas Y Younis; Marwa Y Issa; Haraz A Ashour; Ibrahim Saleh; Gamal H Osman; Ibrahim A Arif; Engy Mohsen
Journal:  Saudi J Biol Sci       Date:  2020-03-12       Impact factor: 4.219

View more
  2 in total

1.  Mechanism of Wheat Leaf Rust Control Using Chitosan Nanoparticles and Salicylic Acid.

Authors:  Mohsen Mohamed Elsharkawy; Reda Ibrahim Omara; Yasser Sabry Mostafa; Saad Abdulrahman Alamri; Mohamed Hashem; Sulaiman A Alrumman; Abdelmonim Ali Ahmad
Journal:  J Fungi (Basel)       Date:  2022-03-16

2.  Synergistic Antimicrobial Activities of Chitosan Mixtures and Chitosan-Copper Combinations.

Authors:  Philipp Lemke; Lena Jünemann; Bruno M Moerschbacher
Journal:  Int J Mol Sci       Date:  2022-03-20       Impact factor: 5.923

  2 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.