Literature DB >> 34336545

In-silico study of peptide-protein interaction of antimicrobial peptides potentially targeting SARS and SARS-CoV-2 nucleocapsid protein.

Ritu Bansal1, Sanika Mohagaonkar2, Anamitra Sen3, Uzma Khanam3, Bhawna Rathi3.   

Abstract

This study is an attempt to find a suitable therapy using antimicrobial peptides (AMPs) by identifying peptide-protein interaction of AMPs and nucleocapsid protein of SARS and SARS-CoV- 2. The AMPs were shortlisted from the APD3 database (Antimicrobial peptide database) based on various physicochemical parameters. The binding efficacy of AMPs was measured using the lowest energy score of the docked complexes with 10 selected AMPs. For SARS-CoV, AP00180 showed the best pose with a binding affinity value of - 6.4 kcal/mol. Prominent hydrogen bonding interactions were observed between Lys85 (nucleocapsid receptor) and Arg13 (antimicrobial peptide ligand) having the least intermolecular distance of 1.759 Å. For SARS-CoV-2, AP00549 was docked with a binding affinity value of - 3.4 kcal/mol and Arg119 and Glu14 of receptor nucleocapsid protein and ligand AMP having the least intermolecular distance of 2.104 The dynamic simulation was performed at 50 ns to check the stability of the final docked complexes, one with each protein. The two best AMPs were AP00180 (Human Defensin-5) for SARS and AP00549 (Plectasin) for SARS-CoV-2. From positive results of dynamic simulation and previously known knowledge that some AMPs interact with the nucleocapsid of coronaviruses, these AMPs might be used as a potential therapeutic agent for the treatment regime of SARS-CoV-2 and SARS infection. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1007/s40203-021-00103-z.
© The Author(s), under exclusive licence to Springer-Verlag GmbH Germany, part of Springer Nature 2021.

Entities:  

Keywords:  Binding energy; Capsid protein; Favorability percentage; Molecular dynamics; Pandemic; Simulation studies

Year:  2021        PMID: 34336545      PMCID: PMC8315091          DOI: 10.1007/s40203-021-00103-z

Source DB:  PubMed          Journal:  In Silico Pharmacol        ISSN: 2193-9616


Introduction

The current global coronavirus pandemic has now affected more than 213 countries and territories across the globe (Countries where Coronavirus has spread-Worldometer 2021). SARS-CoV-2 is said to have originated in Wuhan, China in December 2019 and gradually spread across the world affecting more than 24 million people (WHO Coronavirus Disease (COVID-19) 2021). The past coronavirus infections namely SARS (Severe Acute Respiratory Syndrome) and MERS (Middle Eastern Respiratory Syndrome) affected many parts of the world. This called for scientists to find various measures of treatments for viral diseases, even though no effective drug or vaccine accounts for full recovery in all patients (Lai et al. 2020). In the current study, some antimicrobial peptides (AMPs) are suggested with proper In-Silico studies as effective therapeutic agents against the SARS and SARS-CoV-2 infection. There are various classes of AMPs out of which the Human defensins which are produced and secreted by different mucosal and epithelial cells show antimicrobial properties against viral diseases (Amerikova et al. 2019). AMPs are now widely being studied as an alternative to antibiotics for rapid response. It is one of the first pathways to get upregulated during the defence action (Ahmed et al. 2019). The role of AMP with influenza A has also been extensively studied (Hsieh and Hartshorn 2016). The study of structural and non-structural proteins is important to understand how these viruses interact with the human body. In this paper, we targeted the structural nucleocapsid protein of SARS and SARS-CoV-2. The protein, coded by the 9th ORF of SARS, is helical in shape and plays a major role in pathogenesis, RNA packaging, and replication of the virus. It is a 46 kDa protein with 422 amino acids (Surjit and Lal 2008). It induces an antigenic and immunogenetic response in the human body (Peng et al. 2006). Along with the envelope M protein, the nucleocapsid protein aids in genomic condensation and packaging. It is also expressed in abundance in case of infection thus making it a crucial target to study (Surjit and Lal 2008; Verheije et al. 2010; Ahlquist et al. 2003). We chose nucleocapsid (N gene) over other SARS structural proteins because it is more stable and conserved. It has the fewer mutation and over 90% amino acid homology. In general, the nucleocapsid protein/ gene of coronavirus families are expressed in abundance and highly immunogenic when an infection occurs (Chang et al. 2014; Chen et al. 2020; Pang et al. 2020; Drosten et al. 2003; Marra et al. 2003). The nucleocapsid protein also shows an antigenic response for the T-cell receptors in terms of proliferation and cytotoxic activity in term of vaccine (Grifoni 2020; Cong, et al. 2019; Dutta et al. 2008; Kang, et al. 2020; Lee et al. 2010). There are around 186 AMPs which are antiviral in nature and a total of more than 3000 AMPs present in the antimicrobial peptide database (APD3) (Elnagdy and AlKhazindar 2020). Viral entry into the cell is blocked by human defensin 5 (HD5), which is a potential blocker for SARS-Cov-2 (Maiti 2020).In many kinds of infections by various pathogens, AMPs are one of the first immune pathways which are upregulated in vivo. Of these various classes, the two best AMPs studied till now are the defensins and human cathelicidin LL-37. Antimicrobial peptides like defensins have shown response against blocking cell receptor by binding to it in the case of HIV, inhibiting the protein kinase C signalling pathway in case of HSV, Transferrin has shown their activity by inhibiting cellular trafficking in case of Hantavirus, Rotaviruses etc. (Ahmed et al. 2019; Agier et al. 2015). Although AMPs are usually studied against bacterial infections, we aim to find AMPs for viruses as well for a specific target site namely the nucleocapsid protein of SARS and SARS-CoV-2. Studies have shown that antimicrobial peptides usually affect viral entry into a cell, although its effects have been seen at other sites as well. They generate an innate immune response which is crucial to keeping infections at bay. Such studies were conducted using AMPs in response to the dengue virus using the human neutrophils and further examination by qRT-PCR (Ahmed et al. 2019; Castañeda-Sánchez et al. 2016).The activity of AMPs is decided by their amino acid composition, net charge, size, hydrophobicity and hydrophilicity etc. which have been considered in our study as well which are important from the structural and conformational point of view. It is desired for the selected AMP to be stable (Cunha et al. 2017). Our work focuses on the binding efficacy of AMPs which hinders the activity of nucleocapsid protein of the viruses. Using the docking and dynamic simulation techniques, we aim to find the two most suitable and probable AMPs which will best block the pathway for the viruses.

Materials and methodology

Retrieval of the viral protein sequences (Nucleocapsid) of SARS and SARS-COV-2-CoV

The amino acid sequences of viral nucleocapsid strains (SARS, SARS-CoV-2) were retrieved from UniProtserver (Bateman 2019) (Scheme 1). Their PDB structures were selected from the RCSB PDB database (Burley et al. 2019).
Scheme 1

Schematic flowchart depicting overall methodology of the workflow

Schematic flowchart depicting overall methodology of the workflow

Database screening of antimicrobial peptides

A cluster of AMP's was retrieved from the APD3 server (Antimicrobial Peptide Database) (Wang et al. 2016). The screening of the database was made based on certain criteria such as –length of the peptide should be between 20 to 55 AA(The length of peptide correlated with inhibitory action. The longer the length of peptide, better antiviral activity has been observed as compared to sequences of shorter length (Du et al. 2017), an abundance of basic residue in the peptide, the net charge of the peptide should be more than or equal to zero, as the viral membrane is negatively charged, non-toxicity concerning mammalian cells and interfacial activity of peptide including- Wimley-White interfacial hydrophobicity scale (WWIHS > 0) It is an experimentally calculated free energy scale which helps to determine the propensity of individual amino acids in peptide sequences to partition from water into a phosphatidylcholine interface. Interfacial helical hydrophobic moment (iHHM > 0) It describes the degree to which a peptide can be segregated into hydrophilic and hydrophobic phases when folded in an alpha- helix. A peptide with a large iHHM can interact strongly with membranes as a helix due to partitioning–folding coupling even with a WWIHS score that is not positive overall (Galdiero et al. 2015).

Structure prediction of the selected AMPs

The tertiary structure of the selected AMPs was generated by MODELLER and PEPFOLD server depending upon peptide length (Šali and Blundell 1993; Camproux et al. 2004). If the peptide lengths greater than 30AA, MODELLER was used and for peptide, less than 30AA in length, a PEPFOLD peptide structure prediction server was employed. The generated models were then evaluated based on the Ramachandran Plot generated by ProCheck (Laskowski et al. 1993).

Docking simulation studies

To check the binding affinity between the selected AMP’s and the nucleocapsid protein receptor of SARS and SARS-COV-2-CoV (2CJR and 6M3M respectively), docking simulation was performed using the ClusPro v2.0 server. This server assesses massive datasets of putative complexes and gives a pre-set number of favourable docked poses. For peptide-protein docking, the selected AMPs were set as ligands and docked with both receptors 2CJR and 6M3M. This server rotates the ligand with 70,000 rotations and for each rotation, it translates the ligand in x, y, and z axis relative to the receptor on a grid (Vajda et al. 2016). Further, Autodock Vina (Trott et al. 2009) was used for docking simulation analysis on the best-docked poses that were obtained from the ClusPro v2.0 server to obtain the accurate interactions between the receptor nucleocapsid proteins and ligand anti-microbial peptides.

Molecular dynamic simulation

Molecular dynamic simulation and energy minimization was done for the AMPs and the nucleocapsid receptor complex using GROMACS. All simulated structures were centered typically in a dodecahedron box with a minimum distance of 2.0 nm between each atom of the protein and the box to reduce and the SPC216 water model was used to solvate the system (Abraham et al. 2015). The solvated protein was subsequently neutralized by Cl−ions, where 58.21 ions were used for SARS and SARS—2, respectively. Covalent bonds involving hydrogen atoms were constrained using the LINCS algorithm, and long-range electrostatic interactions were treated with the Particle-Mesh Ewald (PME) method employing a real-space cutoff of 10 Å. Energy minimization was executed by the steepest descent method and the conjugate gradient method for the subsequent 50,000 steps (NIH Lincs Program 2021). The system was initially temporarily minimized with backbone atoms confined to the previous coordinates to remove close contacts, and the restrained system was gradually heated to 300 K under constant volume conditions at 100 ps. Each system was equilibrated for 50 ns using the constant isothermal-isobaric (NPT) ensemble at 1 bar and 300 K without any restraints. The Parrinello-Rahman barostat and a V-rescale thermostat were used with an integration time step of 2 fs. Lennard–Jones interactions were calculated using a cutoff of 1 Å. The pair lists were updated every 400 steps. All simulations were performed using GROMACS 2019.1 along with the OPLS– AA force field. To assess the stability of the selected model, a 50 ns MD simulation was performed using the GROMACS software version 5.0. Before the MD simulation, it must be ensured that the system has no steric clashes or inappropriate geometry. The structure is relaxed through a process called energy minimization. Energy minimization of the system is an important step to relax the structure. The complex system energy minimization was done for 100 ps till the force reaches < 1000 kJ/mol. Equilibrating the solvent and ions around the protein is also an important step before the dynamic simulation calculation.

Results and discussion

Filtration of antimicrobial peptides and modelling

Based upon the criteria for database screening, a total of 37 peptides were filtered out of which, ultimately ten antimicrobial peptides were selected based on the iHHM score. The AMPs were modelled using the PEPFOLD server and MODELLER. The validity of each of those models was checked using the Ramachandran plot generated by the Procheck program. The shortlisted AMPs consisted of the majority of residues in the favoured region, with the peptide ATCYCRTGRCATRESLSGVCEISGRLYRLCCR (Human defensin-5) possessing the highest favourability percentage. The Ramachandran plots can be seen in Fig. 1 of supplementary material.
Fig. 1

Molecular docking simulation using ClusPro v2.0 A SARS nucleocapsid strain docked with AP00180 B SARS nucleocapsid strain docked with AP00223 C SARS- CoV- 2 nucleocapsid strain docked with AP01061 D SARS- CoV-2 nucleocapsid strain docked with AP00549

Molecular docking simulation using ClusPro v2.0 A SARS nucleocapsid strain docked with AP00180 B SARS nucleocapsid strain docked with AP00223 C SARS- CoV- 2 nucleocapsid strain docked with AP01061 D SARS- CoV-2 nucleocapsid strain docked with AP00549

Docking simulation and evaluation of the best complexes

Molecular docking simulation between nucleocapsid protein of SARS (PDB ID:2CJR) and SARS-CoV-2 (PDB ID: 6M3M) and the ten antimicrobial peptides with the help of the ClusPro server was implemented. For SARS, the top two least energy weighted scores were that of AP00180 and AP00223 and for SARS-COV-2, the best-weighted scores were that of AP01061 as well as AP00549 (Table 1). Further docking was implemented on Autodock Vina, where the poses obtained from the ClusPro v2.0 server analysed for their receptor binding domain as well as the interacting bonds between the receptor and the ligand.
Table 1

Lowest energy weighed score of docked complexes using ClusPro

Viral strain [receptor PDB ID]APD3 IDLowest energy weighted score (Kcal/mol)
SARS [2CJR]AP00160− 619.6
AP00692− 838.4
AP01061− 862.8
AP00180− 1063.7
AP00222− 973.3
AP00223− 1013
AP00036− 931.9
AP00549− 830.1
AP02148− 906
AP02733− 689.2
SARS-CoV-2 [6M3M]AP00160− 645.6
AP00692− 826.6
AP01061− 1111.0
AP00180− 1032.4
AP00222− 1067.6
AP00223− 1107
AP00036− 1037
AP00549− 1183
AP02148− 1030
AP02733− 766.4
Lowest energy weighed score of docked complexes using ClusPro

Peptide-protein complex interaction studies

After the selection of the top two lowest weighted score AMPs, the docked structures were analysed for the type of interaction that exists between the nucleocapsid protein receptor and the antimicrobial protein–ligand. The table provides information regarding the specific interaction between the peptide-protein complex as well as the ΔG score between the interacting chains of nucleocapsid and AMP. Interacting bonds that were observed between the receptors and their specific ligands were hydrogen bonds, alkyl bond, salt bridges and pi-sigma bonds. For SARS, human defensin 5 (AP00180) chains B, C and D were in close interaction with the chains E and F of the nucleocapsid protein. The chains A and B of RatNP-2 rat defensin (AP00223) were in close interaction with A, B, C, E and F chains of SARS nucleocapsid. In both cases, conventional hydrogen bonds were in the predominant number. Circulin D (AP01061) was interacting with the SARS-COV-2 nucleocapsid chains A as well as C and varying bond types between individual amino acids. And lastly, Plectasin (AP00549) was interacting with the chains A and C of SARS-COV-2 nucleocapsid and classical hydrogen bonds being in the highest number as seen in Fig. 1. The interaction between the receptor amino acid molecules and ligand AMP molecules is shown in Table 2 of supplementary material along with their respective bond category.
Table 2

Shortlisted antimicrobial peptides and their Ramachandran Plot statistics

PeptideAPD3 IDDefinitionWWIHSNET CHARGEiHHMResidues in most favoured regions (%)Residues in additional allowed regions (%)Residues in generously allowed regions (%)
ALWMTLLKKVLKAAAKAALNAVLVGANAAP00160Dermaseptin-S40.9244.7163.627.39.1
GWFKKAWRKVKNAGRRVLKGVGIHYGVGLIAP00692Hagfish cathelicidin0.2486.4161.928.69.5
KIPCGESCVWIPCVTSIFNCKCKENKVCYHDAP01061Circulin D1.2715.4363.627.39.1
ATCYCRTGRCATRESLSGVCEISGRLYRLCCRAP00180Human defensin 51.3943.8392.97.10.0
VTCYCRRTRCGFRERLSGACGYRGRIYRLCCRAP00222RatNP-1 rat defensin1.0284.2990.49.60.0
VTCYCRSTRCGFRERLSGACGYRGRIYRLCCRAP00223RatNP-2 rat defensin1.774.0190.010.00.0
DFASCHTNGGICLPNRCPGHMIQIGICFRPRVKCCRSWAP00036Bovine beta-defensin 10.2244.7280.811.53.8
GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCYAP00549Plectasin2.1113.6776.723.30.0
FFLLFLQGAAGNSVLCRIRGGRCHVGSCHFPERHIGRCSGFQACCIRTWGAP02148Apl-AvBD163.2655.2675.924.10.0
LFGSVKAWFKGAKKGFQDYRYQKDMAKMNKRYGPNWQQRGGQEPPADAQANDQPPAP02733Piscidin 62.9356.4189.33.63.6
Shortlisted antimicrobial peptides and their Ramachandran Plot statistics Molecular docking simulation using Autodock Vina provided the amino acids of nucleocapsid proteins of SARS and SARS-CoV-2 which were directly interacting with the amino acids of their respective antimicrobial peptides. A total of 6 electrostatic bonds, 11 conventional hydrogen bonds and 8 carbon-hydrogen bonds were found to be interacting between SARS nucleocapsid and AP00180. For SARS and AP00223, 2 electrostatic bonds, 6 conventional hydrogen bonds and 2 carbon-hydrogen bonds were observed. For SARS-CoV-2 and AP00549, 6 conventional hydrogen bonds and 3 hydrophobic bonds were observed and finally, for SARS-CoV-2 and AP01061, 4 conventional hydrogen bonds and 1 hydrophobic bond were observed. As per Table 3 we can observe that the binding affinity score of SARS-CoV with AP00549 and AP01061 and of SARS-CoV-2 with AP00180 and AP00223 are favourable. It was decided to proceed with only those binding affinity scores which showed high favourability in both-ClusPro as well as Autodock Vina.
Table 3

Grid-box dimensions and binding affinity values of Autodock Vina

S. NoViral StrainAPD3 IDGridbox dimension (x)Gridbox dimension (y)Gridbox dimension (z)Binding Affinity scores (kcal/mol)
1SARS-CoVAP00180− 38.480− 0.019− 1.677− 6.4
2SARS-CoVAP00223− 39.3130.206− 1.009− 6.1
3SARS-CoV-2AP0054912.760− 12.033− 24.877− 3.4
4SARS-CoV-2AP0106112.760− 12.033− 24.877− 3.0
5SARS-CoVAP00549− 39.3130.206− 1.009− 6.9
6SARS-CoVAP01061− 39.3130.206− 1.009− 6.2
7SARS-CoV-2AP0018012.760− 12.033− 24.877− 3.7
8SARS-CoV-2AP0022312.760− 12.033− 24.877− 4.1
Grid-box dimensions and binding affinity values of Autodock Vina Autodock Vina employs Broyden-Fletcher-Goldfarb-Shanno (BFGS) algorithm that uses local optimization methods for identifying active sites in the target protein. The default size of the grid box wherein the docking would take place is calculated using protein–ligand complex structures. A docking box is initially constructed which encloses the particular ligand and then the box size increases in random direction that ensures that the minimum length in any direction is atleast 22.5 Å. The specific active site of the nucleocapsid protein was generated by the algorithm to provide best suitable interaction (Trott et al. 2009). Thus, the type of interaction that was predominant between the receptor proteins and antimicrobial peptide ligands were conventional hydrogen bonds, as shown in Table 4 and the most frequent interactions as shown in Fig. 2. The highest interacting bond predominant between the receptor molecule and the AMPs was conventional hydrogen bond. The most prominent interacting amino acids as per the distance given in the table between the receptors and the ligand include Lys85 and Arg13 (Conventional Hydrogen Bond), Ala110 and Glu21(hydrogen and electrostatic interaction) and Lys85 and Cys30 (carbon-hydrogen bond) between AP00180 and SARS nucleocapsid protein. For SARS nucleocapsid and AP00223, Arg13 and Glu111 (hydrogen and electrostatic interaction), Lys85 and Thr8 (Conventional Hydrogen Bond) and Lys 114 and Phe12 (Carbon Hydrogen Bonds) were the most prominent amino acid interactions. For SARS-CoV-2 nucleocapsid protein and AP00549 Asn196 and Asn513 (Conventional Hydrogen Bond) was the most promising hydrogen bonding interaction. For AP01061, Tyr29 and Asn91, as well as Thr256 and Gly5 (Conventional Hydrogen Bond), showed the most promising hydrogen bond interaction as in Fig. 3 and results after molecular docking are seen in Fig. 4
Table 4

Amino acid interactions of receptor nucleocapsid protein and their respective antimicrobial peptides

Viral strainAPD3 IDBinding affinity (kcal/mol)Receptor amino acidsAMP ligand amino acidsBond categoryDistance (Å)
SARS-CoVAP00180− 6.4ALA110GLU21Hydrogen bond; Electrostatic2.233
LYS85ARG31Electrostatic4.476
ARG241GLU21Electrostatic4.803
ALA1ASP87Electrostatic4.792
ALA1ASP834Electrostatic4.788
ARG31GLU14Electrostatic3.488
LYS85ARG13Conventional hydrogen bond1.759
LYS88TYR4Conventional hydrogen bond2.270
GLN129GLU21Conventional hydrogen bond2.177
GLY132SER17Conventional hydrogen bond2.796
ARG227THR7Conventional hydrogen bond3.086
THR246GLY24Conventional hydrogen bond2.504
GLN247GLY24Conventional hydrogen bond2.478
LYS833CYS3Conventional hydrogen bond2.889
LYS833CYS3Conventional hydrogen bond2.786
ARG9CYS10Conventional hydrogen bond3.398
ARG13ASP87Conventional hydrogen bond3.369
LYS85CYS30Carbon hydrogen bond3.500
LYS85ARG31Carbon hydrogen bond3.237
ASP87ARG31Carbon hydrogen bond3.658
PRO115THR2Carbon hydrogen bond3.468
SER612THR12Carbon hydrogen bond3.393
THR12SER612Carbon hydrogen bond3.005
GLY18THR128Carbon hydrogen bond3.604
GLY18GLN129Carbon hydrogen bond3.073
SARS-CoVAP00223− 6.1ARG13GLU111Hydrogen Bond; Electrostatic3.467
LYS833GLU14Electrostatic4.564
LYS85THR8Conventional hydrogen bond2.411
ARG119GLU14Conventional hydrogen bond2.104
ARG227VAL1Conventional hydrogen bond2.395
GLN129ARG15Conventional hydrogen bond3.182
TYR22GLU219Conventional hydrogen bond3.244
ARG25PRO611Conventional hydrogen bond3.263
LYS114PHE12Carbon hydrogen bond2.862
ARG9CYS10Carbon hydrogen bond3.552
SARS-CoV-2AP00549− 3.4ASN94GLN13Conventional hydrogen bond2.656
ARG132GLY1Conventional hydrogen bond2.637
ARG132PHE2Conventional hydrogen bond2.177
ARG132ASN5Conventional hydrogen bond2.891
ASN196ASN5Conventional hydrogen bond2.082
GLN13ASN371Conventional hydrogen bond2.870
THR197PRO198Hydrophobic5.198
TRP8PRO179Hydrophobic5.431
TRP8LEU170Hydrophobic5.338
SARS-CoV-2AP01061− 3LYS1ASN1Conventional hydrogen bond2.945
TYR29ASN91Conventional hydrogen bond2.803
ARG132PRO3Conventional hydrogen bond2.855
THR256GLY5Conventional hydrogen bond2.852
THR370GLU24Carbon Hydrogen bond3.474
ALA93VAL27Hydrophobic4.214
Fig. 2

Total count of most frequent interactions of SARS-CoV and SARS-CoV-2 with their respective AMPs

Fig. 3

Molecular docking simulation using Autodock Vina and interacting bonds (conventional hydrogen bonds: green; hydrophobic interactions: pink). A SARS nucleocapsid strain docked with AP00180, B SARS nucleocapsid strain docked with AP00223, C SARS-CoV-2 nucleocapsid strain docked with AP01061, D SARS-CoV-2 nucleocapsid strain docked with AP00549

Fig. 4

Molecular dynamic simulation of SARS with AP00180and SARS- CoV-2 with AP00549, (A, D) number of hydrogen bonds and pairs within 0.35 nm, (B, E) Distribution of H bonds across the interaction, (C, F) RMSD of the docked complex

Amino acid interactions of receptor nucleocapsid protein and their respective antimicrobial peptides Total count of most frequent interactions of SARS-CoV and SARS-CoV-2 with their respective AMPs Molecular docking simulation using Autodock Vina and interacting bonds (conventional hydrogen bonds: green; hydrophobic interactions: pink). A SARS nucleocapsid strain docked with AP00180, B SARS nucleocapsid strain docked with AP00223, C SARS-CoV-2 nucleocapsid strain docked with AP01061, D SARS-CoV-2 nucleocapsid strain docked with AP00549 Molecular dynamic simulation of SARS with AP00180and SARS- CoV-2 with AP00549, (A, D) number of hydrogen bonds and pairs within 0.35 nm, (B, E) Distribution of H bonds across the interaction, (C, F) RMSD of the docked complex

Molecular dynamic simulation analysis

Taking the ClusPro weighted scores as well as Prodigy ΔG values of the four shortlisted AMPs, the two AMPs- one for SARS and one for SARS-COV-2 were further filtered and analysed for molecular dynamic simulation. MD simulation is an appropriate step to ensure the stability of the nucleocapsid protein-AMP complex. SARS -AP00180 complex achieved the force and potential energy in 1840 steps with the energy drift of − 469,527 kJ/mol, whereas SARS -AP00549 achieved the same in 1758 steps with the energy drift of − 254,944 kJ/mol. Potential energies are given in Table 5 and Fig. 5. Constant temperature, pressure and density were maintained for 100 ps (Fig. 6). The final MD simulation was done for 50 ns.
Table 5

Energy minimization values of the final two docked complexes

Viral strainAPD3 IDSteepest Descents converged to Fmax < 1000Potential Energy (kJ/mol)Maximum forceNorm of force
SARSAP001801840 steps− 4.4924025e + 069.9176465e + 02 on atom 95441.1767879e + 01
SARS-CoV-2AP005491758 steps− 2.7867188e + 069.3732727e + 02 on atom 18801.1762753e + 01
Fig. 5

Molecular dynamic simulation plots by GROMACS. RMSD, RMSF, Radius of gyration and Energy Minimization for SARS-AP00180 (A–D) and SARS-CoV-2-AP00549 (E–H) respectively

Fig. 6

Molecular dynamic simulation plots by GROMACS. Temperature, pressure, and density for SARS-AP00180 (A–C), SARS-CoV-2- AP00549 (D–F) respectively

Energy minimization values of the final two docked complexes Molecular dynamic simulation plots by GROMACS. RMSD, RMSF, Radius of gyration and Energy Minimization for SARS-AP00180 (A–D) and SARS-CoV-2-AP00549 (E–H) respectively Molecular dynamic simulation plots by GROMACS. Temperature, pressure, and density for SARS-AP00180 (A–C), SARS-CoV-2- AP00549 (D–F) respectively The stability of the molecules was examined based on the RMSD, RMSF and Rg values. The average, maximum and minimum RMSD, RMSF, and Rg are presented in Table 6. The RMSD values of each frame corresponding to time are given in Fig. 4b. RMSD values indicated that both the systems achieved equilibrium in an early phase of a 50 ns trajectory. The difference between the highest and lowest RMSD values of SARS -AP00180 was 1.424 nm, which was quite close to the average value (2.273 nm), demonstrating that the backbone of the SARS -AP00180 complex did not fluctuate much. On the other hand, the SARS-CoV-2 -AP00549 complex system showed a similar rate of RMSD. The difference of the highest and lowest RMSD values of SARS-CoV-2 -AP00549 was 1.473 nm, which was close to the average value (2.887 nm), demonstrating the stability of the SARS-CoV-2 -AP00549 complex throughout the 50 ns MD simulation.
Table 6

Maximum, minimum, and average values of SARS and SARS-CoV-2

RMSD (nm)RMSF (nm)Rg (nm)
SARS-CoV-2Maximum3.4993.0821.805
Minimum2.0260.0691.646
Average2.8870.3861.744
SARSMaximum2.7811.3542.693
Minimum1.3570.0692.527
Average2.2730.3622.634
Maximum, minimum, and average values of SARS and SARS-CoV-2 RMSF determine the flexibility of any residue in the SARS -AP00180 and SARS-CoV-2 -AP00549 complex system. The fluctuation of the individual atom explained based on the RMSF values obtained from the 50 ns MD simulation of both the complex systems. The maximum, minimum, and average RMSF values for SARS -AP00180 were 1.354, 0.069 and 0.362 nm, respectively whereas, the maximum, minimum, and average RMSF values for SARS-CoV-2 -AP00549 were 3.08,0.069 and 0.386 nm, respectively can be seen in Table 5. The low average RMSF value suggested that individual atom exhibited stability in the dynamic state of both the systems throughout the MD simulation. The plot of the RMSF values vs. the atom number is shown in Fig. 5. The figures indicate that atoms of the SARS -AP00180 complex system at the positions of about 1500 ~ 3000 and 6500–7000 and, atoms of SARS-CoV-2 -AP00549 complex system at the positions of about 7500 ~ 9000 fluctuated somewhat relative to the others. The remaining atoms in both the complex systems were found to be quite stable during the MD simulation. Rg for the SARS -AP00180 complex and SARS-CoV-2 -AP00549 complex were 2.634 nm and 1.744 nm, respectively. Rg values showed no change from the beginning of the simulation to the end of the simulation, demonstrating that both the complexes remain stable throughout the 50 ns trajectory. The Rg values corresponding to the simulation shown in Fig. 5 were used to facilitate the interpretation of the secondary structure. The hydrogen bonds were stable during the 15 ns run as seen in Fig. 7.
Fig. 7

Molecular Dynamic simulation of SARS-CoV and SARS-CoV-2: Hydrogen bonds of the docked complexes represent the number of hydrogen bonds as a function of time. Pairs within 0.35 nm represent—the number of atom pairs that satisfy the distance criterion but not the angle criterion for hydrogen bonding

Molecular Dynamic simulation of SARS-CoV and SARS-CoV-2: Hydrogen bonds of the docked complexes represent the number of hydrogen bonds as a function of time. Pairs within 0.35 nm represent—the number of atom pairs that satisfy the distance criterion but not the angle criterion for hydrogen bonding

Conclusion

In the current work, we have employed a docking, scoring algorithm and dynamic simulation for combined peptide-protein binding search using an AMPs database. Our computational study confirms to provide two most suitable antimicrobial peptides which show positive interaction with nucleocapsid protein and may potentially hinder the activity of the viral protein. This nucleocapsid protein plays a major role in infecting a cell by RNA packaging and replication of the virus. Plectasin (AP00549) showed the lowest energy score (− 1183 kcal/mol) and highest favourability percentage (76.7%) making it efficient for SARS-CoV-2 viral intervention. Human Defensin-5 (AP00180) showed the lowest energy score (− 1063.7) and highest favourability percentage (92.9%) making it efficient for SARS. From our results, it may confirm that these AMPs may be suitable for inhibiting SARS-CoV-2, and SARS virus infection. With the simulation studies, we tried to create a natural environment for the peptide to interact with the protein. The stability of the molecules was examined based on the RMSD, RMSF and radius of gyration values. The difference between the highest and lowest RMSD values of the SARS-CoV-2-AP00549 complex and SARS-AP00180 complex determined that the backbone did not fluctuate throughout the 50 ns MD simulation. For RMSF, the maximum, minimum and average values were used to determine the overall stability of the docked structure and as for Rg values, the complexes exhibited no change from the beginning of the simulation to the end of the simulation, demonstrating the stability of both the complexes throughout the 50 ns trajectory. In-silico studies suggest a potent and successful interaction with the active site of nucleocapsid with the antimicrobial peptide. These molecules can be further taken for the next step of research and all in vitro experiments will be carried out at room temperature that is the reason for conducting MD simulations at room temperature. Other complementary experiments also carried out at the same temperature so that the structures and energies from different MD simulations can be collected into a single ensemble for analysis. The structure and interaction insights with the AMPs provided in this study may provide a deep understanding for developing anti-SARS-CoV-2 inhibitors. However, the results are preliminary and certainly need experimental validation using in vitro and in vivo studies. Specific assays are needed to confirm the mechanism of action. Below is the link to the electronic supplementary material. Supplementary file1 (DOCX 750 KB)
  31 in total

1.  Identification of a novel coronavirus in patients with severe acute respiratory syndrome.

Authors:  Christian Drosten; Stephan Günther; Wolfgang Preiser; Sylvie van der Werf; Hans-Reinhard Brodt; Stephan Becker; Holger Rabenau; Marcus Panning; Larissa Kolesnikova; Ron A M Fouchier; Annemarie Berger; Ana-Maria Burguière; Jindrich Cinatl; Markus Eickmann; Nicolas Escriou; Klaus Grywna; Stefanie Kramme; Jean-Claude Manuguerra; Stefanie Müller; Volker Rickerts; Martin Stürmer; Simon Vieth; Hans-Dieter Klenk; Albert D M E Osterhaus; Herbert Schmitz; Hans Wilhelm Doerr
Journal:  N Engl J Med       Date:  2003-04-10       Impact factor: 91.245

2.  The coronavirus nucleocapsid protein is dynamically associated with the replication-transcription complexes.

Authors:  Monique H Verheije; Marne C Hagemeijer; Mustafa Ulasli; Fulvio Reggiori; Peter J M Rottier; Paul S Masters; Cornelis A M de Haan
Journal:  J Virol       Date:  2010-08-25       Impact factor: 5.103

3.  AutoDock Vina: improving the speed and accuracy of docking with a new scoring function, efficient optimization, and multithreading.

Authors:  Oleg Trott; Arthur J Olson
Journal:  J Comput Chem       Date:  2010-01-30       Impact factor: 3.376

Review 4.  MERS-CoV spike protein: a key target for antivirals.

Authors:  Lanying Du; Yang Yang; Yusen Zhou; Lu Lu; Fang Li; Shibo Jiang
Journal:  Expert Opin Ther Targets       Date:  2016-12-21       Impact factor: 6.902

Review 5.  The next generation of antimicrobial peptides (AMPs) as molecular therapeutic tools for the treatment of diseases with social and economic impacts.

Authors:  Nicolau B da Cunha; Nicole B Cobacho; Juliane F C Viana; Loiane A Lima; Kamila B O Sampaio; Stephan S M Dohms; Arthur C R Ferreira; César de la Fuente-Núñez; Fabrício F Costa; Octávio L Franco; Simoni C Dias
Journal:  Drug Discov Today       Date:  2016-11-23       Impact factor: 7.851

Review 6.  The SARS coronavirus nucleocapsid protein--forms and functions.

Authors:  Chung-ke Chang; Ming-Hon Hou; Chi-Fon Chang; Chwan-Deng Hsiao; Tai-huang Huang
Journal:  Antiviral Res       Date:  2014-01-11       Impact factor: 5.970

7.  Nucleocapsid Protein Recruitment to Replication-Transcription Complexes Plays a Crucial Role in Coronaviral Life Cycle.

Authors:  Yingying Cong; Mustafa Ulasli; Hein Schepers; Mario Mauthe; Philip V'kovski; Franziska Kriegenburg; Volker Thiel; Cornelis A M de Haan; Fulvio Reggiori
Journal:  J Virol       Date:  2020-01-31       Impact factor: 5.103

8.  APD3: the antimicrobial peptide database as a tool for research and education.

Authors:  Guangshun Wang; Xia Li; Zhe Wang
Journal:  Nucleic Acids Res       Date:  2015-11-23       Impact factor: 16.971

9.  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) and coronavirus disease-2019 (COVID-19): The epidemic and the challenges.

Authors:  Chih-Cheng Lai; Tzu-Ping Shih; Wen-Chien Ko; Hung-Jen Tang; Po-Ren Hsueh
Journal:  Int J Antimicrob Agents       Date:  2020-02-17       Impact factor: 5.283

View more
  3 in total

Review 1.  Methodology-Centered Review of Molecular Modeling, Simulation, and Prediction of SARS-CoV-2.

Authors:  Kaifu Gao; Rui Wang; Jiahui Chen; Limei Cheng; Jaclyn Frishcosy; Yuta Huzumi; Yuchi Qiu; Tom Schluckbier; Xiaoqi Wei; Guo-Wei Wei
Journal:  Chem Rev       Date:  2022-05-20       Impact factor: 72.087

Review 2.  Antimicrobial Mechanisms and Clinical Application Prospects of Antimicrobial Peptides.

Authors:  Xin Li; Siyao Zuo; Bin Wang; Kaiyu Zhang; Yang Wang
Journal:  Molecules       Date:  2022-04-21       Impact factor: 4.927

3.  Molecular Docking and In-Silico Analysis of Natural Biomolecules against Dengue, Ebola, Zika, SARS-CoV-2 Variants of Concern and Monkeypox Virus.

Authors:  Mackingsley Kushan Dassanayake; Teng-Jin Khoo; Chien Hwa Chong; Patrick Di Martino
Journal:  Int J Mol Sci       Date:  2022-09-22       Impact factor: 6.208

  3 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.