Literature DB >> 34221870

HYD-PEP06 suppresses hepatocellular carcinoma metastasis, epithelial-mesenchymal transition and cancer stem cell-like properties by inhibiting PI3K/AKT and WNT/β-catenin signaling activation.

Wei Tian1, Jiatong Li1, Zhuo Wang1, Tong Zhang2, Ying Han1, Yanyan Liu3, Wenfeng Chu1, Yu Liu1, Baofeng Yang1.   

Abstract

HYD-PEP06, an endostatin-modified polypeptide, has been shown to produce effective anti-colorectal carcinoma effects through inhibiting epithelial-mesenchymal transition (EMT). However, whether HYD-PEP06 has similar suppressive effect on hepatocellular carcinoma (HCC) remained unknown. In this study, HYD-PEP06 inhibited metastasis and EMT but not proliferation in vitro. Cignal finder pathway reporter array and Western blot analysis revealed that HYD-PEP06 suppressed HCCLM3 cell metastasis and EMT by inhibiting the PI3K/AKT pathway. Moreover, HYD-PEP06 exerted anti-metastasis effects in HepG2 cancer stem-like cells (CSCs) via suppressing the WNT/β-catenin signaling pathway. Finally, in HCCLM3 tumor-bearing BALB/c nu/nu nude mice, HYD-PEP06 substantially suppressed tumor growth, lung metastasis and HCC progress. Our results suggest that HYD-PEP06 inhibits the metastasis and EMT of HCC and CSCs as well, and thus has the potential as an agent for HCC treatment.
© 2021 Chinese Pharmaceutical Association and Institute of Materia Medica, Chinese Academy of Medical Sciences. Production and hosting by Elsevier B.V.

Entities:  

Keywords:  Cancer stem-like cell; HYD-PEP06; Hepatocellular carcinoma; PI3K/AKT; WNT/β-catenin

Year:  2021        PMID: 34221870      PMCID: PMC8245914          DOI: 10.1016/j.apsb.2021.03.040

Source DB:  PubMed          Journal:  Acta Pharm Sin B        ISSN: 2211-3835            Impact factor:   11.413


Introduction

Hepatocellular carcinoma (HCC), as one of the most worldwide malignancies, makes up of 90% primary liver cancer and its incidence continues to rise worldwide. Surgical removal of nidus is the major strategy for HCC, accompanied by high recurrence rate and intrahepatic and extrahepatic metastasis. Sorafenib, a novel multi-targeted oral drug, was authorized as a unique target medicament for advanced HCC by the U.S. Food and Drug Administration in 2007, and it acts by attenuating tumor angiogenesis, delaying tumor progress and inducing apoptosis,. However, due to the development of resistance of HCC to sorafenib and the serious adverse reactions caused by this drug, the overall therapeutic effect of HCC is far from satisfactory,. Thus, it is imperative to explore new drugs for better treatment of HCC. HYD-PEP06 is an RGD-modified endostatin-derived synthetic polypeptide of 30 amino acids. The RGDRGD fragment attached at its N-terminus can specifically bind to different integrins in endothelial cells. HYD-PEP06 is designed and synthesized by our group and it has been demonstrated to exert anti-tumor effects on colorectal carcinoma and oral squamous cell carcinoma,. However, whether HYD-PEP06 can also suppress HCC progression and metastasis remained untested. Epithelial mesenchymal transition (EMT) is a critical mechanism for many pathological processes, including tumor invasion and metastasis. During EMT, epithelial cells discard their epithelial properties and acquire the properties of mesenchymal cells in both morphology and biological characteristics,. Typical EMT malignant tumor cells are characterized by increased migration, invasion, mesenchymal characteristics, along with downregulation of expression of cell adhesion molecules and upregulation of mesenchymal marker genes,. EMT plays a key role in conferring the metastatic and invasive properties of HCC,. Several signaling pathways, such as mitogen-activated protein kinase/extracellular regulated protein kinases (MAPK/ERK), nuclear factor kappa-B (NF-κB) and phosphatidylinositol-3-kinase/protein kinase B (PI3K/AKT), are known to regulate EMT14, 15, 16, of which, the PI3K/AKT pathway is of pivotal importance in controlling tumor invasion and metastasis. Moreover, the PI3K/AKT signaling pathway can induce EMT by dual mechanisms: increasing expression of matrix metalloproteinases and transcription factor Snail17, 18, 19, 20, 21. Cancer stem cells (CSCs) belong to a subgroup of tumor cells which possess self-regeneration capacity, extensive proliferation and high carcinogenic potential and are considered to be responsible for cancer occurrence, development, chemo-resistance, metastasis and recurrence. Additionally, CSCs have been identified in several types of human cancers including HCC. Accumulating evidence suggests that tumor cells acquire CSC-like characteristics through activating EMT,. It has been proposed that eliminating CSCs may be a more efficient approach for cancer therapy. Indeed, the self-proliferation and expansion of liver CSCs can activate the WNT signaling pathway to enhance tumor aggressiveness and resistance to chemo-therapeutic agents,. WNT signaling pathway promotes EMT and metastasis, being considered as a significant mediator of HCC metastasis and a marker of poor prognosis as well,. The aims of the present study are to characterize the effects of HYD-PEP06 on EMT and metastasis of HCC with both in vitro and in vivo models and to delineate the underlying signaling mechanisms. Our results indicate that HYD-PEP06 is an anti-HCC agent suppressing metastasis and EMT via inhibiting the PI3K/AKT and WNT/β-catenin signaling pathways. The findings suggest that HYD-PEP06 might be considered as a novel short-peptide agent for HCC therapy.

Materials and methods

Cell lines, culture conditions and reagents

Human HCC cell line HCCLM3 was purchased from Cell Bank of Type Culture Collection of Chinese Academy of Sciences (Shanghai, China). Human HCC cell line HepG2 and human umbilical vein endothelial cells (HUVEC) were purchased from the American Type Culture Collection (ATCC). Cells were cultured in Dulbecco's modified Eagle's medium (DMEM; Hyclone, Utah, USA) with 10% fetal bovine serum (FBS) and 1% antibiotic in 5% CO2 cell incubator at 37 °C. HYD-PEP06 (RGDRGDMHSHRDFQPVLHLVALQSPLSGGM) was synthesized by Shengnuo Tech Co., Ltd. (Chengdu, China). HYD-PEP06 was dissolved in 5% glucose solution (GS) and filtered. 5-Fluorouracil (5-Fu) was obtained from Tianjin Jinyao Amino Acid Co., Ltd. (Tianjin, China).

Evaluation of cell viability by CCK8 assay

Cell Counting Kit-8 (CCK-8, MCE, USA) assay was used to evaluate cell viability. HCCLM3 and HepG2 cells (5 × 103/well) were plated into 96-well plates. After the cells had reached 80% confluence, they were starved for 6 h and incubated with different concentrations of HYD-PEP06 for 24 and 48 h. After drug treatment, 10 μL CCK8 was added to each well of the 96-well plate and incubated for 1.5 h. Then the absorbance value was measured at 450 nm by using PowerWave HT microplate spectrophotometer (BioTek, USA). The data of each group was normalized to that of the control group.

In vitro cell migration assay

Wound healing and Transwell assays were conducted to evaluate tumor cell migration in vitro. For wound healing, HCCLM3 and HepG2 cells (5 × 105/mL) were planted onto a 6-well plate. Then, the cells were incubated with different concentrations of HYD-PEP06 for 24 h. A dense monolayer of cells was scraped from the 6-well plate, and the floating cells were washed with PBS. GS was used as a negative control. Photographs were obtained with a digital Single Lens Reflex Camera. Cell migration area was analyzed by Image J software. Each measurement was conducted at least five times. Transwell filter chambers (Costar, Corning, NY, USA) were used for migration analysis. HCCLM3, HepG2 and cancer stem-like cells (5 × 104/well) were planted into upper chambers in basal medium without serum. Then, 600 μL serum was added to the lower chambers. After 24 h culturing, the chambers were covered with methanol for 30 min, followed by staining with 0.1% crystal violet for 20 min. The area of stained cells was photographed under a microscope. For each group, five randomly selected microscopic fields were enumerated and analyzed. Each measurement was conducted in triplicate.

Western blot analysis

Cells were harvested from cultured flask and lysed in a RIPA lysis buffer (Solarbio, China) containing protease and phosphatase inhibitors (MCE, USA). Protein concentration was determined using BCA Protein Assay Kit (Beyotime, China). Cell lysates of 100 μg per lane were separated on a 10% Tris-Tricine SDS-PAGE gel and transferred onto nitrocellulose membranes (PALL, Germany) for 90 min. The blotted membranes were blocked with 5% skimmed milk for 1.5 h and then incubated with primary antibodies at 4 °C overnight. The antibodies against E-cadherin (#14472), N-cadherin (#13116), Vimentin (#5741), phospho-AKT (#4060), pan-AKT (#4691), β-catenin (#8480), Axin2 (#2151), phospho-GSK-3β (#5558), and GSK-3β (#9832) were purchased from Cell Signaling Technology (Boston, MA, USA). The antibodies against α-catenin (ab52227, Abcam, Cambridge, UK), CD133 (WL02586, Wanlei, China), CD44 (WL03531, Wanlei, China) and GAPDH (1E6D9, Protein tech) were used. AKT inhibitor MK2206 (MCE, USA) and activator SC79 (MCE, USA) were obtained from Med Chem Express (Monmouth Junction, NJ, USA). The blotted membranes were scanned by Odyssey Infrared Imaging System (Li-COR, USA) after incubation with secondary antibody. Band densitometry was quantified by using Image J software, and the values were normalized to GAPDH as an internal control.

Immunofluorescence (IF) assay

IF staining was conducted to analyze the effects of HYD-PEP06 on EMT and cancer stem-like cells. HCCLM3, HepG2 and cancer stem-like cells were seeded on the sterile coverslips laid on 24-well plate, incubated with HYD-PEP06 at 200 μg/mL for 24 h, and then fixed in 4% PFA for 10 min followed by penetration with 0.5% Triton X-100 (Leagene, China) for 15 min and subsequent blocking with goat serum for 1 h. Next, the cells were incubated with primary antibodies against E-cadherin, vimentin, β-catenin or GSK-3β at 4 °C overnight. CD133 (AF5120, Affinity Biosciences, China) and CD44 (DF6392, Affinity Biosciences, China) were used to identify and verify cancer stem-like cells. Then, the cells were incubated with secondary antibody, Alexa Fluor 488 or Alexa Fluor 594 (Invitrogen Thermo Fisher, USA) for 1 h. Cell nuclei were stained with 4,6-diamidino-2-phenylindole (DAPI) at room temperature for 20 min. Finally, images were obtained under a fluorescence microscope (Zeiss, Jena, Germany). All measurements were performed in triplicate.

Cignal finder pathway reporter array

Cignal Finder Reporter Array (Qiagen, Dusseldorf, Germany) was carried out to investigate the signaling pathways mediating the effects of HYD-PEP06 in HCCLM3 cells and cancer stem-like cells. Briefly, adherent cells (1 × 105/well) were digested from logarithmic growth phase in 96-well plates for 16 h. The cells were transfected with transcription factor responsive reporter constructs of different signaling pathways. Next, the culture medium was replaced by the fresh medium supplemented with 0.5% FBS and 1% antibiotics. After 24 h, 200 μg/mL HYD-PEP06 was added into 96-well plates. To study the effect of HYD-PEP06 on HCC, luciferase assay was performed by using the Dual-Luciferase Reporter Assay System (Promega, WI, USA) following the instruction handbook. Firstly, a volume of 100 μL Dual-Glo Reagent was added to each well of the 96-well plate after it was removed from the incubator. Waiting for at least 10 min, cell lysis was allowed to occur. Then the firefly luminescence was measured in a luminometer. After that, a volume of 100 μL Dual-Glo Stop & Glo Reagent was added. Waiting for at least another 10 min, Renilla luminescence was measured and the luminescence ratio of HYD-PEP06 group to the control group was calculated. Finally, relative response ratios were calculated from the normalized ratios.

Tube network formation

Tube formation assay was conducted in Matrigel for assessing angiogenesis in vitro. The 24-well plate was covered with growth-factor reduced Matrigel (250 μL/well) under cooling condition and incubated for coagulation at 37 °C for 30 min. Serum starved HUVEC cells (1.5 × 105/mL) were resuspended in Endothelial Basal Medium-2 supplemented with 0.5% FBS or in tumor stem cell enrichment medium, and then seeded onto Matrigel-coated well after incubation with 200 μg/mL HYD-PEP06 for 8 h. Next, the morphological changes of the tube formation were imaged in multiple fields per well under a microscope (Olympus, Tokyo, Japan). Mean capillary tube length and the number of branching nodes were quantified by Image J software at three random fields for 5 times.

Culture and isolation of hepatocellular cancer stem-like cells

HepG2 cells were cultured with DMEM medium containing 10% FBS, 1% penicillin and streptomycin in 5% CO2 at 37 °C. At the logarithmic growth phase, the cells were trypsinization collected by centrifugation and resuspended in FBS-free CSC culture medium Dulbecco's modified Eagle's medium/Nutrient Mixture F-12 (DMEM/F12, Hyclone, UT, USA) containing 20 ng/mL basic fibroblast growth factor, 20 ng/mL epidermal growth factor (PeproTech, Rocky Hill, NJ, USA), 4 μg/mL heparin sodium, 20 μL/mL B27 serum substitute supplement, and 1% antibiotic. Then the cells were seeded into polyhydroxy ethyl meth-acrylate pretreatment cell culture flask for two weeks. The adherent cells were discarded. Then the suspending cells were collected and cultured in stem cell culture medium. Cell digestion and passage were conducted every 10 days, the sphere formation was observed under the microscope every 3 days. The cells without the efficient sphere-forming capacity deposited at the bottom of ultra-low attachment surface plates were discard carefully, sphere-like cells were collected for further use when spheroids reached a diameter of 100 μm in about 2 weeks.

Formation and proliferation of 3D spheroids

Cancer stem-like cells (1 × 104/well) were planted onto Ultra-low adhesion 96-well plates (S-BIO, New Hampshire, USA). Three-dimensional (3D) spheroids were photographed every 24 h, and sphere area was measured with Image J software. To evaluate 3D spheroid proliferation in the presence of HYD-PEP06, the photographs were taken under a microscope (Olympus, Tokyo, Japan) and analyzed using Image J software.

Postsurgical residual tumor xenograft models and anti-tumor effect assay

Adult female 6–8 weeks old athymic BALB/c nu/nu nude mice (15–20 g) were obtained from Beijing Vital River Laboratory Animal Technology Co., Ltd. [Certificate No. SCXK(Jing) 2016-0006]. The animals were raised in a constant temperature of 23 ± 2 °C under a 12 h day and night cycle by feeding with sterilized food and sterile water. A mouse model of postsurgical residual tumor was used to imitate the recurrence of solid tumor, and HCCLM3 cells were digested and collected. First, a traditional tumor xenograft nude mouse model was established by injecting 200 μL 1 × 106/mL HCCLM3 cell suspension subcutaneously into the right axillary of mice. Once the average volume of tumors had reached 1000–1500 mm3, they were aseptically removed from the mice and cut into small pieces. Then, the tumor chunks were subcutaneously inoculated to the tumor xenograft nude mice. After the average volume of the tumors had reached to 300–350 mm3, the mice were intravenously injected 1.2% avertin solution for anesthetization. Residual tumor model of average volume 60–100 mm3 was aseptically constructed by removing parts of tumors. After 24 h, mice were categorized into four groups (n = 10) based on tumor volume, which included the control groups, a low concentration of 5 mg/kg HYD-PEP06, a medium concentration of 10 mg/kg HYD-PEP06 and a high concentration of 20 mg/kg HYD-PEP06. Each group was daily injected with either GS or HYD-PEP06 intravenously for 14 days. The width and length of tumors were calculated by caliper every other day. Tumor volume was calculated on the basic of the width and length of tumors. On Day 14 after injection of HYD-PEP06, the groups were euthanized. Then the tumors were cut, weighted, and immersed in 4% paraformaldehyde at 37 °C for Western blot analysis. The tumor volume inhibitory rate was calculated according to Eq. (1): where V0 presents the control tumor volume and V is the HYD-PEP06 groups tumor volume. The tumor weight inhibitory rate was calculated according to Eq. (2):where W and W0 presented the tumor weights of the HYD-PEP06 groups and control groups. The protocols for animal experiments were approved by the Institution Animal Care and Use Committee of Harbin Medical University (Harbin, China), and the procedures conformed to the Guide for the Care and Use of Laboratory Animals, and exactly following with the People's Republic of China Legislation Regarding the Use and Care of Laboratory Animals.

Mouse model of hepatocellular cancer pulmonary metastasis

Adult female 4 weeks old athymic BALB/c nu/nu nude mice (15–20 g) were purchased from Beijing Vital River Laboratory Animal Technology Co., Ltd. [Certificate No. SCXK (Jing) 2016-0011 (No.11400700230989)]. The animals were raised in a controlled aseptic environment as described above. HCCLM3 cells were cultured in DMEM medium (Hyclone, Utah, USA) added with 10% FBS and 1% antibotic at 37 °C in 5% CO2. HCCLM3 cells were transfected by self-inactivated lentiviral vector pCDH-luc2-GFP, then added 1 μg/mL puromycin (ThermoFisher Scientific, MA, USA) to the medium to establish a cell line which stably expressed luciferase 2 and green fluorescent protein (HCCLM3-Luc2-GFP). A total of 1.5 × 106 stable expression vector cells suspension in 200 μL saline were gently injected through tail vein. After 5 min the anaesthetized mice were intraperitoneal injection with 150 mg/kg d-luciferin, and imaged by IVIS Spectrum CT platform (Pekin Elmer, MA, USA). Data was analyzed by living image 4.3.1 software. The percentage of tumor growth was calculated according to Eq. (3): To test HYD-PEP06 on the efficacy of the HCC tumor pulmonary metastasis model, mice were randomly categorized into four groups after injecting HCCLM3 tumor cells 5 min ago. Based on the bioluminescence imaging (BLI) signals, the mice (n = 40) were categorized into four groups: control group, 5 mg/kg, 10 mg/kg and 20 mg/kg HYD-PEP06-treated groups. Each group was daily administered with either GS or HYD-PEP06 by intravenous injection for 28 days. The mice were euthanized on the last day and then the main internal organs were collected for BLI imaging in vitro which included brain, stomach, lung, heart, colon, kidney, spleen and small intestine.

Statistical analysis

Data are presented as mean ± standard error of mean (SEM) for three independent experiments. One-way ANOVA followed by the Tukey procedure was used by comparing the mean values in multiple groups. P < 0.05 indicates statistical significance. Statistical significances between two groups were performed with Student t-test. Kaplan–Meier technique was performed to plot survival curves. Results were performed for three times. Statistical analysis was conducted by Prism 7.0c GraphPad Software (GraphPad; San Diego, CA, USA).

Results

HYD-PEP06 inhibits hepatocellular carcinoma metastasis in vitro

The mechanism for anti-tumor drugs can be various, including killing dividing cancer cells, suppressing cell proliferation and blocking the spread of cancer cells,. To investigate the effect of HYD-PEP06 on cancer cells, CCK8 assay was used to assess the viability of HCCLM3 and HepG2 cell lines. There were no significant differences of the cell viability after treatment with either glucose or HYD-PEP06 at concentrations from 12.5 to 400 μg/mL. In contrast, the viability of HCCLM3 and HepG2 cells was significantly reduced by 5-fluorouracil (5-FU, Fig. 1A–D).
Figure 1

HYD-PEP06 does not affect cell viability of HCCLM3 and HepG2 cells. (A)–(D) HCCLM3 and HepG2 cells were treated with various concentrations of HYD-PEP06 (12.5, 25, 50, 100, 200 and 400 μg/mL) for 24 or 48 h, and cell viability was determined by Cell Counting Kit-8 (CCK8) assay. Glucose solution (GS) was used as a solvent control and 5-fluorouracil (5-FU) as a positive control. Data were calculated from three independent experiments and are presented as mean ± SEM; ∗∗∗P < 0.001 by one-way ANOVA followed by Tukey's test.

HYD-PEP06 does not affect cell viability of HCCLM3 and HepG2 cells. (A)–(D) HCCLM3 and HepG2 cells were treated with various concentrations of HYD-PEP06 (12.5, 25, 50, 100, 200 and 400 μg/mL) for 24 or 48 h, and cell viability was determined by Cell Counting Kit-8 (CCK8) assay. Glucose solution (GS) was used as a solvent control and 5-fluorouracil (5-FU) as a positive control. Data were calculated from three independent experiments and are presented as mean ± SEM; ∗∗∗P < 0.001 by one-way ANOVA followed by Tukey's test. Next, wound-healing and Transwell migration assays were performed to investigate the effects of HYD-PEP06 on metastasis of HCC. As depicted in Fig. 2A and B, treatment of different concentrations of HYD-PEP06 (50, 100 and 200 μg/mL) for 24 h inhibited the migration of both HCCLM3 and HepG2 cells in a dose-dependent fashion (P < 0.001, Fig. 2C). Similar results were observed with the Transwell migration assay: HYD-PEP06 (200 μg/mL) reduced the migration of HCCLM3 and HepG2 cells by 72.1% and 82.1%, respectively (Fig. 2D and E). These data suggest that HYD-PEP06 inhibits metastasis without affecting viability in HCC.
Figure 2

Inhibitory effects of HYD-PEP06 on the migration potential in hepatocellular carcinoma cells HCCLM3 and HepG2. HYD-PEP06 dramatically suppressed the metastasis of (A) HCCLM3 and (B) HepG2 cells in wound healing assay. Magnification: 400 ×. (C) The wound healing results show the concentration-dependent inhibition of metastasis by HYD-PEP06. Data are expressed as mean ± SEM; ∗P < 0.05, ∗∗P < 0.01, ∗∗∗P < 0.001 vs. Control. (D) Migration of HCCLM3 and HepG2 cells was decreased by HYD-PEP06 in Transwell assay. Scale bar: 100 μm. Five independent experiments were examined, and representative images are presented here. (E) Transwell assay shows the concentration-dependent inhibitory effect of HYD-PEP06 on migration. The data are expressed as mean ± SEM; ∗P < 0.05, ∗∗∗P < 0.001 vs. Control.

Inhibitory effects of HYD-PEP06 on the migration potential in hepatocellular carcinoma cells HCCLM3 and HepG2. HYD-PEP06 dramatically suppressed the metastasis of (A) HCCLM3 and (B) HepG2 cells in wound healing assay. Magnification: 400 ×. (C) The wound healing results show the concentration-dependent inhibition of metastasis by HYD-PEP06. Data are expressed as mean ± SEM; ∗P < 0.05, ∗∗P < 0.01, ∗∗∗P < 0.001 vs. Control. (D) Migration of HCCLM3 and HepG2 cells was decreased by HYD-PEP06 in Transwell assay. Scale bar: 100 μm. Five independent experiments were examined, and representative images are presented here. (E) Transwell assay shows the concentration-dependent inhibitory effect of HYD-PEP06 on migration. The data are expressed as mean ± SEM; ∗P < 0.05, ∗∗∗P < 0.001 vs. Control.

HYD-PEP06 suppresses HCC metastasis by inhibiting epithelial mesenchymal (EMT) transition in HCC cells

It is known that EMT enables non-metastatic tumor cells to infiltrate into surrounding tissues and eventually metastasizes to distant sites. In this process, cells change from their epithelial “cobblestone” phenotype to the spindle-shaped morphological characteristics of mesenchymal cells, causing enhanced motility and invasion,. Western blot results show that the expression of epithelial markers E-cadherin and α-catenin was significantly increased, along with concomitant downregulation of mesenchymal markers N-cadherin and vimentin after HYD-PEP06 treatment in HCCLM3 (Fig. 3A–E). Similar results were found in HepG2 cells (Fig. 3F–J). In addition, immunofluorescent staining demonstrated that vimentin expression was significantly decreased by HYD-PEP06 (200 μg/mL) treatment for 24 h, whereas E-cadherin expression was increased (Fig. 3K and L).
Figure 3

HYD-PEP06 inhibits the transition between epithelial and mesenchymal phenotypes in HCC cells. (A) Western blot results illustrating the effects of HYD-PEP06 (50, 100, and 200 μg/mL) for 24 h on the protein expression of the epithelial and mesenchymal markers in HCCLM3 cells. (B)–(E) HYD-PEP06 increased the levels of epithelial marker proteins and decreased the levels of mesenchymal marker proteins in HCCLM3 cells compared with control. (F) Western blot data demonstrating the effects of HYD-PEP06 (50, 100, and 200 μg/mL) for 24 h on the protein expression of the epithelial and mesenchymal markers in HepG2 cells. (G)–(J) HYD-PEP06 increased the epithelial markers protein levels and decreased the mesenchymal markers protein levels in HepG2 cells compared with control. Data are expressed as mean ± SEM; ∗P < 0.05, ∗∗P < 0.01, ∗∗∗P < 0.001, compared with Control. (K) and (L) Effects of HYD-PEP06 (200 μg/mL) on the expression of the classical epithelial and mesenchymal markers were evaluated by immunofluorescence assay. Blue represents 4′,6-diamidino-2-phenylindole (DAPI) for nucleus; green represents E-cadherin; red represents vimentin. Magnification: 400 ×.

HYD-PEP06 inhibits the transition between epithelial and mesenchymal phenotypes in HCC cells. (A) Western blot results illustrating the effects of HYD-PEP06 (50, 100, and 200 μg/mL) for 24 h on the protein expression of the epithelial and mesenchymal markers in HCCLM3 cells. (B)–(E) HYD-PEP06 increased the levels of epithelial marker proteins and decreased the levels of mesenchymal marker proteins in HCCLM3 cells compared with control. (F) Western blot data demonstrating the effects of HYD-PEP06 (50, 100, and 200 μg/mL) for 24 h on the protein expression of the epithelial and mesenchymal markers in HepG2 cells. (G)–(J) HYD-PEP06 increased the epithelial markers protein levels and decreased the mesenchymal markers protein levels in HepG2 cells compared with control. Data are expressed as mean ± SEM; ∗P < 0.05, ∗∗P < 0.01, ∗∗∗P < 0.001, compared with Control. (K) and (L) Effects of HYD-PEP06 (200 μg/mL) on the expression of the classical epithelial and mesenchymal markers were evaluated by immunofluorescence assay. Blue represents 4′,6-diamidino-2-phenylindole (DAPI) for nucleus; green represents E-cadherin; red represents vimentin. Magnification: 400 ×.

HYD-PEP06 inhibits tumor metastasis and EMT in human HCC by blocking the PI3K/AKT pathway

To decipher the mechanisms by which HYD-PEP06 suppresses HCC metastasis and EMT, we conducted the Cignal Finder Reporter Arrays for the comprehensive analysis of 10 signaling pathways to pinpoint the pathways perturbed by 200 μg/mL HYD-PEP06 in HCCLM3 cells after 24 h treatment. Using a cut-off fold change >1.5 and P-value ≤0.05 criteria, we identified the PI3K/AKT reporter gene to be a negatively regulated signaling pathway (reduced by approximately 4-fold, Fig. 4A). Moreover, Western blot results reveal that HYD-PEP06 significantly decreased the protein level of active or phosphorylated AKT (p-AKT) in HCCLM3 cells without altering the total AKT protein level (Fig. 4B and C). Furthermore, HYD-PEP06 substantially inhibited the phosphorylation of AKT after adding to AKT inhibitor MK2206 (10 μmol/L). Meanwhile, MK2206 exacerbated the effects of HYD-PEP06 in greater downregulation of vimentin and N-cadherin protein expression, along with greater up-regulation of α-cadherin and E-cadherin protein expression in HCCLM3 cells (Fig. 4D–I). Conversely, SC79 (an AKT activator) reversed the downregulation of the mesenchymal markers and upregulation of the epithelial markers induced by HYD-PEP06 (Fig. 4J–O).
Figure 4

HYD-PEP06 attenuated EMT phenotype in HCCLM3 though inhibiting PI3K/AKT signaling pathway. (A) The levels of transcription activities of HYD-PEP06 (200 μg/mL) treated or untreated HCCLM3 cells by Cignal Finder Reporter Pathway Arrays. PI3K/AKT signaling was significantly downregulated in HCCLM3 cells after HYD-PEP06 treatment for 24 h, while other signaling pathways indicated no significant difference. (B) Western blot results of p-AKT and AKT expression levels after adding 200 μg/mL HYD-PEP06 to HCCLM3 cells for 24 h. (C) The densitometry of p-AKT and AKT proteins assessed by Western blot analysis. (D) HCCLM3 cells were pretreated with or without 10 μmol/L MK2206 (a PI3K/AKT inhibitor) and then with HYD-PEP06 (200 μg/mL) for 24 h. The protein expression of p-AKT, AKT, the epithelial and mesenchymal markers was determined by Western blot. (E)–(I) The protein expression of p-AKT, AKT, the epithelial and mesenchymal markers was assessed by adding the AKT inhibitor MK2206 (10 μmol/L). (J) HCCLM3 cells were pretreated with or without 10 μmol/L SC79 (a PI3K/AKT agonist) and then with or without HYD-PEP06 (200 μg/mL) for 24 h. The protein expression of p-AKT, AKT, the epithelial and mesenchymal markers were semi-quantified by Western blot. (K)–(O) The protein levels of p-AKT, AKT, the epithelial and mesenchymal markers were examined in the presence of an AKT agonist SC79 (10 μmol/L). All the Western blot data are presented as mean ± SEM; ∗P < 0.05, ∗∗P < 0.01, ∗∗∗P < 0.001 vs. Control; #P < 0.05, ##P < 0.01 vs. HYD-PEP06 (200 μg/mL).

HYD-PEP06 attenuated EMT phenotype in HCCLM3 though inhibiting PI3K/AKT signaling pathway. (A) The levels of transcription activities of HYD-PEP06 (200 μg/mL) treated or untreated HCCLM3 cells by Cignal Finder Reporter Pathway Arrays. PI3K/AKT signaling was significantly downregulated in HCCLM3 cells after HYD-PEP06 treatment for 24 h, while other signaling pathways indicated no significant difference. (B) Western blot results of p-AKT and AKT expression levels after adding 200 μg/mL HYD-PEP06 to HCCLM3 cells for 24 h. (C) The densitometry of p-AKT and AKT proteins assessed by Western blot analysis. (D) HCCLM3 cells were pretreated with or without 10 μmol/L MK2206 (a PI3K/AKT inhibitor) and then with HYD-PEP06 (200 μg/mL) for 24 h. The protein expression of p-AKT, AKT, the epithelial and mesenchymal markers was determined by Western blot. (E)–(I) The protein expression of p-AKT, AKT, the epithelial and mesenchymal markers was assessed by adding the AKT inhibitor MK2206 (10 μmol/L). (J) HCCLM3 cells were pretreated with or without 10 μmol/L SC79 (a PI3K/AKT agonist) and then with or without HYD-PEP06 (200 μg/mL) for 24 h. The protein expression of p-AKT, AKT, the epithelial and mesenchymal markers were semi-quantified by Western blot. (K)–(O) The protein levels of p-AKT, AKT, the epithelial and mesenchymal markers were examined in the presence of an AKT agonist SC79 (10 μmol/L). All the Western blot data are presented as mean ± SEM; ∗P < 0.05, ∗∗P < 0.01, ∗∗∗P < 0.001 vs. Control; #P < 0.05, ##P < 0.01 vs. HYD-PEP06 (200 μg/mL).

HYD-PEP06 attenuates the metastatic potential of cancer stem-like cells isolated from HepG2 cells

Cancer stem cells (CSCs) contribute to HCC metastasis, progression and recurrence after therapy, by inducing EMT34, 35, 36, 37. We therefore continued to investigate whether HYD-PEP06 has any effects on CSCs. Our study reveals that HepG2 cells expressed higher levels of CSC markers CD133 and CD44 than HCCLM3 cells (Fig. 5A–C), suggesting that the former possesses high-stemness ability than the latter. Thus, we isolated stem-like cells from HepG2 cells for the subsequent experiments. Cancer 3D spheroid culture is a widely used model for studying CSCs. In the medium with serum, HepG2 cells were polygonal morphology. The tumor spheres were obtained from HepG2 cells, which suspended in FBS-free DMEM/F12. Cells cultured for 10 days demonstrated round shape with few cells exhibiting epithelial-like morphology. We observed the size of the sphere under the microscope on Days 0, 3, 5, 7 and 10. HepG2 cells with stem-like properties have efficient sphere-forming capacity under serum-free conditions, and three-dimensional (3D) spheres growth over time (Fig. 5D). Cells without the efficient sphere-forming capacity deposited at the bottom of ultra-low attachment surface plates were discard carefully. When the suspension of spheres reached a diameter of 100 μm, the sphere-forming efficiency was calculated. And spheres were collected for further experiments. CSC population in solid tumors is identified by typical markers such as CD133/CD44 and characterized by high tumorigenicity and invasiveness. The isolated stem-like cells expressed higher protein levels of both CD133 and CD44 than HepG2 cells, as determined by Western blot analysis (Fig. 5E–G) and immunofluorescence staining (Fig. 5H). Moreover, while HepG2 cells formed smaller tumors in mouse xenograft model, the isolated tumor spheres xenotransplants generated impressively larger tumors (Fig. 5I). The xenograft tumors derived from HepG2 cells and the isolated CSCs were harvested two weeks after subcutaneous inoculation in nude mice. The Western blot results demonstrate that the xenograft tumors derived from CSCs expressing higher levels of CD133 and CD44 than those derived from HepG2 cells (Fig. 5J–L).
Figure 5

Tumor spheres isolated from hepatocellular carcinoma HepG2 cells obtained the characteristics of cancer stem cells. (A) Comparison of the protein levels of CD133 and CD44 in HCCLM3 and HepG2 cells. The protein expression of (B) CD133 and (C) CD44 was dramatically increased in HepG2 cells compared with those in HCCLM3 cells. ∗P < 0.05, compared with the HCCLM3 cells. (D) The images of 3D tumor spheroids were captured using the fluorescence microscope on Day 0 in attachment surface plates and Days 0, 3, 5, 7, and 10 in ultra-low attachment surface plates with CSC medium (magnification 200 ×); scale bar: 20 μm. (E) The protein expression of CD133 and CD44 was analyzed by Western blot in HepG2 and CSC-like cells. The protein expression of (F) CD133 and (G) CD44 was dramatically increased in CSC-like cells compared with HepG2 cells. Data are presented as mean ± SEM; ∗P < 0.05, ∗∗P < 0.01. (H) The expression of CD133 and CD44 were assessed by immunofluorescence staining in HepG2 and tumor sphere cells. Blue represents DAPI; green represents CD44; red represents CD133. Magnification: 400 ×. (I) CSC augments tumor-initiating in vivo. Representative xenograft tumors derived from CSC-like cells compared to HepG2 cells after two weeks subcutaneous injection in nude mice (n = 3). Left panel: HepG2 cells; right: CSCs. (J) The protein levels of CD133 and CD44 were analyzed by Western blot in the tumor tissues isolated from xenograft models. GAPDH served as a sample loading control. The protein levels of CSC markers (K) CD133 and (L) CD44 were dramatically upregulated in right tissues compared with left tissues. Data are presented as mean ± SEM; ∗P < 0.05, ∗∗∗P < 0.001.

Tumor spheres isolated from hepatocellular carcinoma HepG2 cells obtained the characteristics of cancer stem cells. (A) Comparison of the protein levels of CD133 and CD44 in HCCLM3 and HepG2 cells. The protein expression of (B) CD133 and (C) CD44 was dramatically increased in HepG2 cells compared with those in HCCLM3 cells. ∗P < 0.05, compared with the HCCLM3 cells. (D) The images of 3D tumor spheroids were captured using the fluorescence microscope on Day 0 in attachment surface plates and Days 0, 3, 5, 7, and 10 in ultra-low attachment surface plates with CSC medium (magnification 200 ×); scale bar: 20 μm. (E) The protein expression of CD133 and CD44 was analyzed by Western blot in HepG2 and CSC-like cells. The protein expression of (F) CD133 and (G) CD44 was dramatically increased in CSC-like cells compared with HepG2 cells. Data are presented as mean ± SEM; ∗P < 0.05, ∗∗P < 0.01. (H) The expression of CD133 and CD44 were assessed by immunofluorescence staining in HepG2 and tumor sphere cells. Blue represents DAPI; green represents CD44; red represents CD133. Magnification: 400 ×. (I) CSC augments tumor-initiating in vivo. Representative xenograft tumors derived from CSC-like cells compared to HepG2 cells after two weeks subcutaneous injection in nude mice (n = 3). Left panel: HepG2 cells; right: CSCs. (J) The protein levels of CD133 and CD44 were analyzed by Western blot in the tumor tissues isolated from xenograft models. GAPDH served as a sample loading control. The protein levels of CSC markers (K) CD133 and (L) CD44 were dramatically upregulated in right tissues compared with left tissues. Data are presented as mean ± SEM; ∗P < 0.05, ∗∗∗P < 0.001. Moreover, 3D spheroids formation assay demonstrated treatment of HYD-PEP06 for 24 and 48 h inhibited the formation of 3D tumor spheroids compared with control or glucose solution (GS) group, indicating inhibitory effect of the poly-peptide 30 on cancer stemness (Fig. 6A and B). In addition, Transwell assay exhibited remarkable reduction of CSCs migration in the presence of HYD-PEP06 (Fig. 6C and D). Furthermore, the effects of HYD-PEP06 on tube formation were evaluated in HUVEC cells. The culture medium collected from CSCs was more favorable to form tube formation relative to that of regular HepG2 cells, as indicated by more dense meshwork of branching capillary-like tubules formed by connection between neighboring cells (Fig. 6E–G). Strikingly, the intercellular tube formation was considerably abrogated by HYD-PEP06 as HUVEC cells being failed to form tubes and essentially staying as separate spherical bodies. These findings indicate that HYD-PEP06 suppresses the angiogenesis by manipulating CSC-like cells.
Figure 6

HYD-PEP06 restricted CSC migration behaviors in the CSC isolated from HepG2 cells. (A) Inhibitory efficacy of HYD-PEP06 on migration of 3D tumor spheroids after 24 and 48 h. The cell imaging was performed using the fluorescence microscope every 24 h (magnification 80 ×); scale bar: 100 μm. (B) HYD-PEP06 has no significant effect on the area of the tumor sphere compared with control. Data are presented as mean ± SEM; ∗∗∗P < 0.001. (C) and (D) Representative images and the number of migration cells in the CSCs. Data are presented as mean ± SEM; ∗∗P < 0.01 compared with control. (E)–(G) Typical diagrams and quantitative analysis of capillary tubes formation in HUVECs followed by treating with conditioned medium obtained from the CSCs and HYD-PEP06 (200 μg/mL). Data are presented as mean ± SEM; ∗P < 0.05, ∗∗P < 0.01 vs. control; ##P < 0.01, ###P < 0.001 vs. the CSC group.

HYD-PEP06 restricted CSC migration behaviors in the CSC isolated from HepG2 cells. (A) Inhibitory efficacy of HYD-PEP06 on migration of 3D tumor spheroids after 24 and 48 h. The cell imaging was performed using the fluorescence microscope every 24 h (magnification 80 ×); scale bar: 100 μm. (B) HYD-PEP06 has no significant effect on the area of the tumor sphere compared with control. Data are presented as mean ± SEM; ∗∗∗P < 0.001. (C) and (D) Representative images and the number of migration cells in the CSCs. Data are presented as mean ± SEM; ∗∗P < 0.01 compared with control. (E)–(G) Typical diagrams and quantitative analysis of capillary tubes formation in HUVECs followed by treating with conditioned medium obtained from the CSCs and HYD-PEP06 (200 μg/mL). Data are presented as mean ± SEM; ∗P < 0.05, ∗∗P < 0.01 vs. control; ##P < 0.01, ###P < 0.001 vs. the CSC group.

HYD-PEP06 inhibits the metastatic potential of CSC-like cells by suppressing the canonical WNT/β-catenin pathway

To investigate the mechanisms by which HYD-PEP06 suppresses the metastatic potential of CSCs, we conducted the Cignal Finder Reporter Arrays. As illustrated in Fig. 7A, WNT was substantially down-regulated in CSC-like cells after treatment with 200 μg/mL HYD-PEP06 for 24 h. We therefore hypothesized that HYD-PEP06 might attenuate CSC metastasis via the WNT/β-catenin pathway. To test this notion, we measured the protein levels of β-catenin, axin2, p-GSK-3β and total GSK-3β, the mediators of the WNT/β-catenin signaling pathway. As illustrated in Fig. 7B–E, HYD-PEP06 significantly downregulated the expression of β-catenin, axin2, and p-GSK-3β in CSC-like cells. Considering that accumulated β-catenin can be translocated to the nucleus, we conducted immunofluorescent staining to analyze the expression and subcellular distribution of β-catenin in the presence of HYD-PEP06. As expected, CSC-like cells in control group exhibited even distributions of β-catenin in cytoplasm and nucleus, whereas in the presence of HYD-PEP06, β-catenin appeared more restricted to the localization close to cytoplasmic membrane while nuclear β-catenin protein substantially decreased (Fig. 7F). The level of total GSK-3β protein didn't change after HYD-PEP06 treatment (Fig. 7G). These results suggest that the anti-metastasis effect of HYD-PEP06 in CSC-like cells might be attributable to its ability to regulate the canonical WNT/β-catenin pathway.
Figure 7

HYD-PEP06 inhibited migration of CSC-like cells via downregulating WNT/β-catenin signaling pathway. (A) Differential expression of genes in HYD-PEP06 (200 μg/mL)-treated CSCs and non-treated ones by signal finder reporter pathway array. WNT/β-catenin signaling was significantly downregulated by > 4-fold in CSC after treating HYD-PEP06 (200 μg/mL) for 24 h while the other signaling pathways remained unaltered. (B) HYD-PEP06 (200 μg/mL) inhibited the activation of the WNT/β-catenin signal pathway. The main components/mediators of the WNT/β-catenin signaling pathway were found downregulated at the protein level, including β-catenin, axin2, and p-GSK-3β in CSC-like cells after 24 h HYD-PEP06 treatment, as compared with those in non-treated CSC-like cells. GAPDH act as an internal control. (C)–(E) The averaged Western blot band densities of β-catenin, axin2 and p-GSK-3β proteins. HYD-PEP06 significantly reduced the band densities. ∗P < 0.05, ∗∗P < 0.01 vs. control. (F) and (G) The expression of β-catenin and GSK-3β was assessed by immunofluorescence assay. Blue represents DAPI; green represents β-catenin; red represents GSK-3β. Scale bar: 10 μm.

HYD-PEP06 inhibited migration of CSC-like cells via downregulating WNT/β-catenin signaling pathway. (A) Differential expression of genes in HYD-PEP06 (200 μg/mL)-treated CSCs and non-treated ones by signal finder reporter pathway array. WNT/β-catenin signaling was significantly downregulated by > 4-fold in CSC after treating HYD-PEP06 (200 μg/mL) for 24 h while the other signaling pathways remained unaltered. (B) HYD-PEP06 (200 μg/mL) inhibited the activation of the WNT/β-catenin signal pathway. The main components/mediators of the WNT/β-catenin signaling pathway were found downregulated at the protein level, including β-catenin, axin2, and p-GSK-3β in CSC-like cells after 24 h HYD-PEP06 treatment, as compared with those in non-treated CSC-like cells. GAPDH act as an internal control. (C)–(E) The averaged Western blot band densities of β-catenin, axin2 and p-GSK-3β proteins. HYD-PEP06 significantly reduced the band densities. ∗P < 0.05, ∗∗P < 0.01 vs. control. (F) and (G) The expression of β-catenin and GSK-3β was assessed by immunofluorescence assay. Blue represents DAPI; green represents β-catenin; red represents GSK-3β. Scale bar: 10 μm.

HYD-PEP06 suppresses HCC tumor growth in a postsurgical residual tumor xenograft model

Recurrence caused by metastatic spreads from the primary tumor usually peaks in the first two years after tumor resection and carries a poor prognosis. Additionally, surgical resection may promote the growth of residual tumor. Therefore, a mouse model of postoperative recurrent tumor was constructed to assess the effect of HYD-PEP06 on tumor suppression. Clinical postoperative recurrence model was mimicked by surgically excising a part of the primary HCC tumors with a section of 60 mm3 tumor tissue. The average tumor width, length and body weights were measured every 2–3 days. Administration of different dosages of HYD-PEP06 (5, 10, and 20 mg/kg) through tail vein injection significantly suppressed HCC tumor growth in xenograft mice, as reported by substantial decrease of residue tumor growth compared with the control group (Fig. 8A–D). Specifically, HYD-PEP06 at 5, 10 and 20 mg/kg resulted in 18.0%, 24.1% and 31.4% decreases in tumor weight, respectively. Consistently, HYD-PEP06 caused dose-dependent reduction of HCC tumor volume (20.59%, 31.17%, and 39.18%, respectively; Table 1). Moreover, the anti-tumor effect of HYD-PEP06 was also supported by a slower increase of the tumor volume. The body weight of the mice was unaffected by the peptide (Fig. 8E). Consistent with the above results, Western blot results indicate that the epithelial protein markers were upregulated while the mesenchymal protein markers were downregulated in the tumor specimens from mice treated with HYD-PEP06 relative to the control group (Fig. 8F–J).
Figure 8

HYD-PEP06 inhibits HCC growth in vivo. (A) Images of HCCLM3 residual tumor xenografts treated with GS and HYD-PEP06 (5, 10, and 20 mg/kg). Scale bar: 1 cm. (B) and (C) Tumor growth scatter plots; (D) and (E) curve suggest the inhibitory growth of HCCLM3 residual tumor and the average body weight of the mouse by HYD-PEP06 in a xenograft mouse model. Data are presented as mean ± SEM; ∗P < 0.05, ∗∗P < 0.01, ∗∗∗P < 0.001 vs. control by unpaired t test. (F) The expression of EMT markers were assessed by Western blot. (G)–(J) Western blot results show that HYD-PEP06 inhibited the expression of the mesenchymal markers, while increasing the levels of the epithelial markers. Data are presented as mean ± SEM; ∗P < 0.05, ∗∗P < 0.01, ∗∗∗P < 0.001 vs. control.

Table 1

Antitumor activity of HYD-PEP06 on postsurgical residual tumor xenografts of human hepatocellular cell in nude mice.

Drug administration
Toxicity
Anticancer activity
GroupDose (mg/kg)aAverage body weight (g)
DeathTumor weight (g)IR (%)Tumor volume (mm³)IR (%)
StartStop
Control22.55 ± 0.3925.08 ± 0.630/101.0153 ± 0.13381511.89 ± 208.21
HYD-PEP062022.03 ± 0.3822.48 ± 1.150/100.6962 ± 0.108231.44919.53 ± 122.09∗∗39.18
HYD-PEP061024.42 ± 0.4823.60 ± 0.090/100.7708 ± 0.108624.091040.61 ± 132.77∗∗∗31.17
HYD-PEP06522.19 ± 0.2724.09 ± 0.440/100.8323 ± 0.208618.021200.64 ± 161.5420.59

The significance of differences (vs. control) was determined by one-way ANOVA and Student's t-test. Data are presented as mean ± SEM, n = 10; ∗∗P < 0.01, ∗∗∗P < 0.001.

QD × 14 days, iv. QD, every day; IR, inhibitory rate; iv represents vein injection daily.

HYD-PEP06 inhibits HCC growth in vivo. (A) Images of HCCLM3 residual tumor xenografts treated with GS and HYD-PEP06 (5, 10, and 20 mg/kg). Scale bar: 1 cm. (B) and (C) Tumor growth scatter plots; (D) and (E) curve suggest the inhibitory growth of HCCLM3 residual tumor and the average body weight of the mouse by HYD-PEP06 in a xenograft mouse model. Data are presented as mean ± SEM; ∗P < 0.05, ∗∗P < 0.01, ∗∗∗P < 0.001 vs. control by unpaired t test. (F) The expression of EMT markers were assessed by Western blot. (G)–(J) Western blot results show that HYD-PEP06 inhibited the expression of the mesenchymal markers, while increasing the levels of the epithelial markers. Data are presented as mean ± SEM; ∗P < 0.05, ∗∗P < 0.01, ∗∗∗P < 0.001 vs. control. Antitumor activity of HYD-PEP06 on postsurgical residual tumor xenografts of human hepatocellular cell in nude mice. The significance of differences (vs. control) was determined by one-way ANOVA and Student's t-test. Data are presented as mean ± SEM, n = 10; ∗∗P < 0.01, ∗∗∗P < 0.001. QD × 14 days, iv. QD, every day; IR, inhibitory rate; iv represents vein injection daily.

HYD-PEP06 inhibited pulmonary metastasis of HCC in a mice model

To evaluate the efficacy of HYD-PEP06 in inhibiting the metastasis potential of HCC in vivo, the metastatic tumor growth in a mouse model of HCC was investigated by bioluminescence imaging. The accumulation of GFP-Luc2-transfected HCCLM3 cells in mouse lungs was verified by BLI images after intravenous injection for 5 min. The mice were evenly assigned into four groups (n = 10 per group) on the basic of equal mean BLI signal intensities. Most tumor cells were cleared by the immune system of the animals on the first seven days with a loss of BLI signals in all groups. However, the control group showed certain conspicuous bioluminescent signals in the lung on Day 14. Concomitantly, only few mice treated with HYD-PEP06 developed obvious signals. From Days 21–28, HYD-PEP06 dramatically decreased the accumulation of BLI signals in the lung (Fig. 9A and B, and Supporting Information Fig. S1). On the last day (Day 28), the mean BLI signal intensity of the control group was 7.9-fold higher than that on Day 1, while that of the HYD-PEP06 (5, 10 and 20 mg/kg) groups was all markedly lower than on Day 1 (0.31-, 0.24-, and 0.17-fold, respectively; Table 2). The ex vivo organ images also supported that HYD-PEP06 inhibited the formation of lung metastasis with an inhibition rate of 87.8%, 92.7% and 95.3% at the dosage of 5, 10 and 20 mg/kg, respectively (Fig. 9C). In addition, HYD-PEP06 did not show any appreciable adverse effects with a stable increase in body weight of mice during the whole course of experiment (Fig. 9D). Of note, two mice of the control group died on Day 22 and three died on Day 26, while the HYD-PEP06 groups all survived to the end. That is, HYD-PEP06 prolonged the survival time of mice bearing tumors (Fig. 9E).
Figure 9

HYD-PEP06 suppresses HCC lung metastasis in vivo and increases survival time. (A) Representative BLI of tumor development in mice after injecting GFP-Luc2-transfected HCCLM3 cells after GS and HYD-PEP06 intravenous injection. (B) The statistical graph of the bioluminescent signal intensities. The integrated flux of photons (photons/s) was automatically generated by the Living Image processing software. The lung metastasis of HCCLM3 cells was dramatically suppressed in the HYD-PEP06 group. BLI signals intensities were calculated by the IVIS imaging system. Data are presented as mean ± SEM; ∗∗∗P < 0.001 vs. control. (C) Representative BLI images of the major internal organs photographed by using the IVIS system on Day 28. (D) The relative mouse body weight curves of the HYD-PEP06 groups and the control group. Data are presented as mean ± SEM; ∗∗∗P < 0.001 by two-way ANOVA. (E) Animal survival curve and the survival duration of mice.

Table 2

Antitumor activity of HYD-PEP06 on mouse model of hepatocellular cancer pulmonary metastasis in nude mice.

GroupBLI flux ( × 106 p/s)
IR (%)
Day 1Day 14Day 21Day 28Day 14Day 21Day 28
Control28.12 ± 2.358.46 ± 2.5781.01 ± 30.79236.88 ± 88.10
HYD-PEP06 5 mg/kg28.67 ± 1.970.68 ± 0.121.25 ± 0.40∗9.83 ± 5.58∗∗∗91.998.595.8
HYD-PEP06 10 mg/kg28.69 ± 2.310.69 ± 0.230.87 ± 0.26∗6.67 ± 2.78∗∗∗91.998.997.2
HYD-PEP06 20 mg/kg28.32 ± 2.250.61 ± 0.110.51 ± 0.10∗4.77 ± 2.07∗∗∗92.799.498.0

The significance of differences (vs. control) was determined by two-way ANOVA followed by the Bonferroni procedure. Data are presented as mean ± SEM, n = 10; ∗P < 0.05, ∗∗∗P < 0.001.

IR, inhibitory rate.

HYD-PEP06 suppresses HCC lung metastasis in vivo and increases survival time. (A) Representative BLI of tumor development in mice after injecting GFP-Luc2-transfected HCCLM3 cells after GS and HYD-PEP06 intravenous injection. (B) The statistical graph of the bioluminescent signal intensities. The integrated flux of photons (photons/s) was automatically generated by the Living Image processing software. The lung metastasis of HCCLM3 cells was dramatically suppressed in the HYD-PEP06 group. BLI signals intensities were calculated by the IVIS imaging system. Data are presented as mean ± SEM; ∗∗∗P < 0.001 vs. control. (C) Representative BLI images of the major internal organs photographed by using the IVIS system on Day 28. (D) The relative mouse body weight curves of the HYD-PEP06 groups and the control group. Data are presented as mean ± SEM; ∗∗∗P < 0.001 by two-way ANOVA. (E) Animal survival curve and the survival duration of mice. Antitumor activity of HYD-PEP06 on mouse model of hepatocellular cancer pulmonary metastasis in nude mice. The significance of differences (vs. control) was determined by two-way ANOVA followed by the Bonferroni procedure. Data are presented as mean ± SEM, n = 10; ∗P < 0.05, ∗∗∗P < 0.001. IR, inhibitory rate.

Discussion

In the present study, we provided strong evidence for the anti-HCC and lung metastasis-suppressing effects of HYD-PEP06 both in vivo with mouse models of tumor metastasis and postsurgical residual tumor xenograft and in vitro cellular models. Mechanically, HYD-PEP06 inhibited HCCLM3 cell metastasis and EMT likely by attenuating the PI3K/AKT pathway and hepatocellular CSC-like cells metastasis via suppressing the WNT/β-catenin signaling pathway. These findings suggest the potential of HYD-PEP06 as a novel therapeutic agent for HCC (Fig. 10).
Figure 10

Mechanism diagram elaborating the underlying mechanism for the antitumor efficacy of HYD-PEP06 on HCC. HYD-PEP06 suppresses HCCLM3 metastasis via inhibiting EMT through suppressing the PI3K/AKT signaling pathway and increases survival time of lung metastasis. HYD-PEP06 attenuated metastasis capability and EMT of hepatocellular CSC-like cells via suppressing the WNT/β-catenin signaling pathway.

Mechanism diagram elaborating the underlying mechanism for the antitumor efficacy of HYD-PEP06 on HCC. HYD-PEP06 suppresses HCCLM3 metastasis via inhibiting EMT through suppressing the PI3K/AKT signaling pathway and increases survival time of lung metastasis. HYD-PEP06 attenuated metastasis capability and EMT of hepatocellular CSC-like cells via suppressing the WNT/β-catenin signaling pathway. HYD-PEP06 is an endostatin-derived synthetic polypeptide consisting of 30 amino acids engineered to attach RGD sequences to the N-terminus. Previous studies have demonstrated that HYD-PEP06 exhibits potent anti-tumor activity in diverse malignancies and is currently undergoing phase I clinical trial for evaluation of its safety and efficacy. Tuguzbaeva et al. reported that HYD-PEP06 could inhibit the αv integrin/FAK/SRC signaling pathway and eliminate the cluster-driven metastasis of oral squamous cell carcinoma. Our previous study revealed that HYD-PEP06 significantly decreases the expression of miR-146b-5p through binding to integrin αvβ3 with its RGD domain and inactivates the miR-146b-5p-Smad4 cascade to suppress colorectal carcinoma (CRC) pulmonary metastasis and residual tumor growth and increases the survival rate of tumor-bearing mice,. Endostatin, the prototype of HYD-PEP06, has been demonstrated to decrease the phosphorylation of AKT and inhibit growth and cell invasion in non-small cell lung cancer cells, breast cancer cells and esophagus cancer cells41, 42, 43. It is known that integrins can recognize RGD motif to affect cell adhesion through regulating the connection between cells and their microenvironment, which is one of the mechanisms by which HYD-PEP06 suppresses tumor metastasis. Mounting evidence supports that HCC invasion and metastasis are positively regulated by multiple subtypes of integrins (αvβ3, α3β1, and α6β1) through multiple mechanisms, including cell adhesion, cell migration and cell invasion,. Moreover, the β subunit of integrin regulates the activity of AKT. For instance, inhibition of integrin αvβ3 significantly prevents the cathepsin B-induced activation of PI3K/AKT thereby the progression of HCC. Ma et al. reported that integrin αvβ3 suppresses HCC progression via targeting PI3K/AKT signaling. It is therefore possible that integrins underlies the inhibitory effects of HYD-PEP06 on HCC metastasis and EMT via inhibiting the PI3K/AKT pathway. Epithelial to mesenchymal transition is a process tightly linked to CSC biology, including stemness, immune escape and resistance to radio- and chemotherapy. When EMT is aberrantly activated, cancer cells can gain the stem cell-like characteristics attaining self-renewal capabilities and the potential to differentiate into literally all different cell types. The resulting cancer stem cells attain phenotypes of cancer including replicative immortality, resistance to cell death, and invasiveness. Tumor cells in the non-CSC subpopulation can spontaneously undergo EMT-like changes expressing CSC-like cell-surface marker genes and promoting tumor spread. EMT and mesenchymal to epithelial transition (MET) are mutually reversible in cancer cells, enabling the conversions between the CSCs and non-CSCs. In our present study, we suggest that a subset of HepG2 cells displayed CSC-like biochemical and functional characteristics, leading to recurrence, metastasis and chemo-resistance of HCC. Besides, hyperactivity of the WNT/β-catenin signaling pathway is established as a cause of tumor development in some human malignancies. WNT/β-catenin also regulates the self-renewal of cancer stem-like cells and is involved in tumor progression and chemotherapy resistance. This study also revealed that HYD-PEP06 inhibited liver CSCs by suppressing WNT/β-catenin signaling pathway. CSCs, constituting <1% of the cellular population in the most solid tumors, are a rare subpopulation of highly self-renewal cells with intense tumorigenic potency and resistance to radio- and chemotherapy. Various oncogenic signaling pathways have been implicated in maintaining and regulating the function of CSCs in malignancies. Particularly, the dysregulated signaling pathways such as WNT/β-catenin, Notch, transformation growth factor β (TGF-β), hedgehog, Janus kinase/signal transducers and activators of transcription (JAK/STAT), PI3K/AKT, and NF-κB, have been well elucidated. Interestingly, miRNAs can modulate the expression and functioning of genes and their products associated with the abovementioned signaling pathways for the maintenance, growth, and function of CSCs. Upregulation of miR-19, miR-501-5p, and miR-744 stimulates the activation of β-catenin52, 53, 54. Conversely, upregulation of miR-708-5p and miR-142-3p inhibits β-catenin activation and prevents its accumulation in the cytoplasm,. Furthermore, upregulation of miR-21 and miR-23a stimulates the activation of the AKT/PI3K pathway, whereas upregulation of miR-128 inhibits its activation57, 58, 59. In addition, upregulation of miR-106b is found to act on TGF-β through targeting SMAD. Downregulation of miR-200c stimulates the activation of Notch pathways and, hence, enhances CSC features. Further, downregulation of miR-136 stimulates CSCs as a result of activating various signals including NF-κB, survivin, cyclin D1, and BCL2. Taken together, stem cell features can be stimulated or suppressed by miRNA-regulated expression of signaling proteins. Our previous study has demonstrated that HYD-PEP06 significantly inhibited miR-146b-5p-SMAD4 cascade to suppressed CRC pulmonary metastasis. And this study showed that HYD-PEP06 suppressed HCC by inhibiting the PI3K/AKT pathway. Moreover, HYD-PEP06 exerted anti-metastasis effects in hepatocellular CSCs via suppressing WNT/β-catenin signaling pathway. However, whether miR-146b-5p also exerted therapeutic effect on HCC cells or regulate the stem cell features through these pathways needs further investigation.

Conclusions

This study uncovered that HYD-PEP06 possessed potent anti-HCC and anti-CSC metastasis effects by inhibiting EMT through downregulating the PI3K/AKT and WNT/β-catenin signal pathways. Our findings indicate that HYD-PEP06 might be considered as a potential drug for HCC treatment.
  62 in total

Review 1.  Wnt signaling and hepatocarcinogenesis: molecular targets for the development of innovative anticancer drugs.

Authors:  Floriane Pez; Anaïs Lopez; Miran Kim; Jack R Wands; Claude Caron de Fromentel; Philippe Merle
Journal:  J Hepatol       Date:  2013-07-05       Impact factor: 25.083

Review 2.  RGD and other recognition sequences for integrins.

Authors:  E Ruoslahti
Journal:  Annu Rev Cell Dev Biol       Date:  1996       Impact factor: 13.827

Review 3.  The cancer stem cell: premises, promises and challenges.

Authors:  Hans Clevers
Journal:  Nat Med       Date:  2011-03       Impact factor: 53.440

4.  Consumption of high-fat diet induces tumor progression and epithelial-mesenchymal transition of colorectal cancer in a mouse xenograft model.

Authors:  Feng-Yao Tang; Man-Hui Pai; En-Pei Isabel Chiang
Journal:  J Nutr Biochem       Date:  2012-01-04       Impact factor: 6.048

Review 5.  Cancer stem cell (CSC) resistance drivers.

Authors:  Masoud Najafi; Keywan Mortezaee; Jamal Majidpoor
Journal:  Life Sci       Date:  2019-08-17       Impact factor: 5.037

Review 6.  Metastasis and AKT activation.

Authors:  Meng Qiao; Shijie Sheng; Arthur B Pardee
Journal:  Cell Cycle       Date:  2008-10-13       Impact factor: 4.534

Review 7.  Epithelial-mesenchymal Transition and Cancer Stem Cells: At the Crossroads of Differentiation and Dedifferentiation.

Authors:  Hanmin Wang; Juli J Unternaehrer
Journal:  Dev Dyn       Date:  2018-11-22       Impact factor: 3.780

8.  Upregulation of miR-501-5p activates the wnt/β-catenin signaling pathway and enhances stem cell-like phenotype in gastric cancer.

Authors:  Dongmei Fan; Baoqi Ren; Xiaojun Yang; Jia Liu; Zhengzheng Zhang
Journal:  J Exp Clin Cancer Res       Date:  2016-11-15

9.  Up-regulation of glycolysis promotes the stemness and EMT phenotypes in gemcitabine-resistant pancreatic cancer cells.

Authors:  Hengqiang Zhao; Qingke Duan; Zhengle Zhang; Hehe Li; Heshui Wu; Qiang Shen; Chunyou Wang; Tao Yin
Journal:  J Cell Mol Med       Date:  2017-02-28       Impact factor: 5.310

10.  Novel ADAM-17 inhibitor ZLDI-8 enhances the in vitro and in vivo chemotherapeutic effects of Sorafenib on hepatocellular carcinoma cells.

Authors:  Yingshi Zhang; Dandan Li; Qiyu Jiang; Shuang Cao; Huiwei Sun; Yantao Chai; Xiaojuan Li; Tianshu Ren; Ruichuang Yang; Fan Feng; Bo-An Li; Qingchun Zhao
Journal:  Cell Death Dis       Date:  2018-07-03       Impact factor: 8.469

View more
  3 in total

1.  Identification of an Endoplasmic Reticulum Stress-Related Gene Signature to Evaluate the Immune Status and Predict the Prognosis of Hepatocellular Carcinoma.

Authors:  Dingli Song; Zhenyu Zhou; Dai Zhang; Jie Wu; Qian Hao; Lili Zhao; Hong Ren; Boxiang Zhang
Journal:  Front Genet       Date:  2022-05-27       Impact factor: 4.772

2.  The cell cycle inhibitor P21 promotes the development of pulmonary fibrosis by suppressing lung alveolar regeneration.

Authors:  Xiaoxi Lv; Chang Liu; Shanshan Liu; Yunxuan Li; Wanyu Wang; Ke Li; Fang Hua; Bing Cui; Xiaowei Zhang; Jiaojiao Yu; Jinmei Yu; ZhuoWei Hu
Journal:  Acta Pharm Sin B       Date:  2021-07-23       Impact factor: 11.413

3.  FAM126A interacted with ENO1 mediates proliferation and metastasis in pancreatic cancer via PI3K/AKT signaling pathway.

Authors:  Yongning Li; Ying Li; Jun Luo; Xueqin Fu; Peng Liu; Songbai Liu; Yaozhen Pan
Journal:  Cell Death Discov       Date:  2022-05-05
  3 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.