Literature DB >> 33797838

Visualization of neurofibrillary tangle maturity in Alzheimer's disease: A clinicopathologic perspective for biomarker research.

Christina M Moloney1, Val J Lowe2, Melissa E Murray1.   

Abstract

Neurofibrillary tangles, one of the neuropathologic hallmarks of Alzheimer's disease, have a dynamic lifespan of maturity that associates with progressive neuronal dysfunction and cognitive deficits. As neurofibrillary tangles mature, the biology of the neuron undergoes extensive changes that may impact biomarker recognition and therapeutic targeting. Neurofibrillary tangle maturity encompasses three levels: pretangles, mature tangles, and ghost tangles. In this review, we detail distinct and overlapping characteristics observed in the human brain regarding morphologic changes the neuron undergoes, conversion from intracellular to extracellular space, tau immunostaining patterns, and tau isoform expression changes across the lifespan of the neurofibrillary tangle. Post-translational modifications of tau such as phosphorylation, ubiquitination, conformational events, and truncations are discussed to contextualize tau immunostaining patterns. We summarize accumulated and emerging knowledge of neurofibrillary tangle maturity, discuss the current tools used to interpret the dynamic nature in the postmortem brain, and consider implications for cognitive dysfunction and tau biomarkers.
© 2021 The Authors. Alzheimer's & Dementia published by Wiley Periodicals LLC on behalf of Alzheimer's Association.

Entities:  

Keywords:  Alzheimer's disease; neurofibrillary tangles; neuropathology; tau; tau positron emission tomography

Mesh:

Substances:

Year:  2021        PMID: 33797838      PMCID: PMC8478697          DOI: 10.1002/alz.12321

Source DB:  PubMed          Journal:  Alzheimers Dement        ISSN: 1552-5260            Impact factor:   21.566


NARRATIVE

There are many ways to approach science and even more ways to answering the unanswered questions of the brain. A particular fascination is how specific cells of the brain are selectively vulnerable to the devastation of disease, but do not become affected until later in life. Alzheimer's disease (AD) is a prime example, as targeted populations of neurons undergo degenerative changes that lead to cognitive dysfunction and brain volume loss. To study these changes in the postmortem brain, an array of specialized stains and antibody‐based methods are used to uncover lesion types and patterns of involvement. AD is defined by the abnormal accumulation of two proteins, amyloid beta (Aβ) and hyperphosphorylated tau. Microscopic inspection of Aβ plaque pathology is observed to accumulate outside of neurons, where plaques interfere with their ability to communicate. Aβ plaque deposition is highly predictable and is quite useful in monitoring the disease course using targeted positron emission tomography (PET) or cerebrospinal fluid (CSF) measures. In contrast, hyperphosphorylated tau accumulates inside of neurons through a series of maturity levels. During this maturation process, neurofibrillary tangles (NFTs) form inside the affected neuron resulting in axonal instability that impairs transport of nutrients and cell signal communication. Advances in PET imaging allow for the detection of abnormal tau accumulation in the living brain. This is complemented by blood and CSF biomarker studies on tau that hold great promise for identifying early changes in asymptomatic individuals and mild cognitive impairment patients. Several PET radioligands and fluid biomarkers have recently emerged that target various aspects of abnormal tau accumulation. To understand differences in tau PET patterns using different radioligands or the temporal sequence of fluid biomarkers, it may be helpful to gain a broad perspective of NFT maturity and tau biology. Neurofibrillary references the appearance of tau fibers that form in the neuron and tangle refers to the twisted nature of these fibers into a mass that builds up inside the neuron. Tau functions to stabilize microtubules, which enables smooth transport of nutrients and messages passed from neuron to neuron. As abnormal tau undergoes many modifications, it accumulates and becomes unable to stabilize microtubules, leading to the death of the neuron. NFTs have a lifespan that is defined through three levels of maturity, which mark the changes that the neuron undergoes as abnormal tau accumulates. At first, the abnormal tau deposits in tiny granular accumulations outside the nucleus of the cell. There is debate whether this initial maturity level, called pretangles, may even be a protective state during which the neuron is defending itself from becoming imbalanced. The neuron's attempt to offset the imbalance may eventually lead to an ill‐fated rescue attempt as abnormal tau begins to overwhelm the neuron. The granular accumulations form into fibers that fill the neuron, which develops into the mature tangle. The nucleus of the mature tangle‐bearing neuron becomes displaced and shrunken as transport machinery fails. As time passes the neuron dies, but the tau fibers remain as a tombstone forming a ghost tangle. Although the process of NFT maturity is dynamic, investigating the postmortem brain under the microscope is like seeing a still frame of a movie. The goal of histologic evaluation, much like Mary Shelley's Dr. Frankenstein, is to bring life back to the postmortem brain. Although not in the literal sense, the “life” brought to the histologic observer in the context of NFT maturity is the understanding of where in the lifespan of maturity was a neuron at the time of the patient's death. This may be especially important in neuroimaging studies investigating the relationship between tau pathology and structural changes. Although one may observe tau accumulation in the medial temporal lobe, atrophy may not be expected if all that is observed is pretangle pathology. In contrast, if a tau PET radioligand only recognizes ghost tangles, the tau PET signal would not be expected early in a patient's disease course. The goal of this review is to highlight the dynamic nature of the NFT by discussing changes that occur along its lifespan. Morphologic changes at each maturity level are first discussed to provide distinct aspects of pretangles, mature tangles, and ghost tangles. Next, commonly used and historically relevant visualization techniques are reviewed to provide confidence when examining changes under the microscope. Importantly, these visualization techniques recognize a small window in the NFT lifespan and there are currently no markers that recognize a single NFT maturity level. One key element of NFT maturity is that it occurs over time, suggesting a therapeutic window of opportunity early in the development. To outline the changes in tau biology in the context of NFT maturity, post‐translational events and isoform dominance are reviewed. Last, the implications of NFT maturity in disease progression are brought into the context of neuroimaging and fluid biomarkers. A holistic knowledge of the dynamic changes to the neuron, rather than considering a tangle as a binary object that exists or does not exist, may have far‐reaching implications for the development of treatments to aid in preventing AD and associated syndromes.

INTRODUCTION

Alzheimer's disease (AD) is a multiproteinopathy that is characterized by the abnormal accumulation of two hallmark neuropathologies: amyloid beta (Aβ) plaques and NFTs composed of tau. , Aβ plaques form in the extracellular space and contribute to synaptic dysfunction, whereas NFTs accumulate progressively in the intracellular space and associate with the death of the neuron. , , Studies in transgenic mice showed Aβ plaques forming within 24‐hour time periods using in vivo multiphoton imaging and generally remained morphologically stable for up to 5 months. In contrast, modeling in human brains showed neurons can survive 20 years with NFTs with functional capabilities that suggest a protracted viability of tangle‐bearing neurons. The inherent cross‐sectional design of human autopsy studies somewhat limits our ability to interpret the dynamic nature of NFTs. Thus, a neuropathologist relies upon morphologic distinctions paired with histology and immunohistochemical markers to interpret the still frame captured at the time of death. Three distinct, but overlapping forms of NFT maturities exist along a continuum: intracellular pretangles, intracellular mature tangles, and extracellular ghost tangles. This suggests the existence of a window in which the AD brain may have (1) different molecular markers to identify various NFT maturities, (2) different peripheral and central biomarkers present throughout the NFT lifespan, and (3) the potential for targeted treatment early in tangle formation to minimize neurodegenerative effects and minimize neuronal loss. The major goal of this review is to provide a historic and modern perspective on NFT maturity in the context of AD. We will emphasize the utility of histologic methods and tau markers used to reveal the level of NFT maturity. As such, we will provide an overview of concepts that demonstrate the dynamic nature of NFT pathology for the tau biomarker community and those new to the AD field. For further information regarding Aβ neuropathology in AD, we direct the reader to the review by Sadigh‐Eteghad et al.

Alzheimer's disease

AD is a progressive neurodegenerative disease first reported by Dr. Alois Alzheimer in a patient who experienced dementia, memory loss, and delusions. , Postmortem analysis of the brain revealed mature tangles and Aβ plaques, which became the recommended hallmark neuropathologies for the eponymous disorder, as first discussed by Khachaturian criteria in 1985. Currently, AD is confirmed postmortem using guidelines provided by the National Institute on Aging and Alzheimer's Association (NIA‐AA). , The NIA‐AA recommends the use of three different measures including Thal amyloid phase (A; Aβ plaques ), Braak tangle stage (B; NFTs ), and modified Consortium to Establish a Registry for Alzheimer's Disease (CERAD, C; neuritic plaques ) to obtain an “ABC” score. , Ante mortem diagnoses of AD dementia can be made using medical history, family history, cognitive testing, biofluid testing, and neuroimaging.

Microtubule‐associated protein tau

The tau protein was first discovered in 1975 (Figure 1) and plays a major role in microtubule stabilization. The gene encoding the protein tau, microtubule associated protein tau (MAPT), was later localized to chromosome 17q21 in 1986 (Figure 1). Tau is an intrinsically disordered protein that generally does not adopt a secondary structure (for a review, see Avila et al. ). Through regulation by phosphorylation, the tau protein's major functions are to promote tubulin polymerization and to stabilize microtubules. , Once tau is phosphorylated, it is released from the microtubules and promotes microtubule disassembly. Diseases that are characterized by accumulations of filamentous and hyperphosphorylated tau are termed tauopathies, first coined by Dr. Bernardino Ghetti in collaboration with Dr. Maria Grazia Spillantini. Tauopathies include AD and frontotemporal lobar degeneration with tau (e.g., Pick's disease, corticobasal degeneration, progressive supranuclear palsy; for a review, see Murray and DeTure, Kovacs,28,29 Götz et al.,30 and Murray et al. ).
FIGURE 1

Historical overview of special stains, antibody development, biomarkers, and Alzheimer's disease (AD)/neurofibrillary tangle maturity research milestones from 1875 to 2020. Blue, staining technique developed; purple, milestone research for AD; orange, antibody development; green, biomarker development. Tick marks denote 1‐year interval.

Historical overview of special stains, antibody development, biomarkers, and Alzheimer's disease (AD)/neurofibrillary tangle maturity research milestones from 1875 to 2020. Blue, staining technique developed; purple, milestone research for AD; orange, antibody development; green, biomarker development. Tick marks denote 1‐year interval. MAPT mRNA (hereafter referred to as tau mRNA) is alternatively spliced at the amino terminus (N‐terminus) and carboxy‐terminus (C‐terminus). Zero, one, or two inserts (0N, 1N, 2N) may be alternatively spliced at the N‐terminus of tau mRNA (Figure 2). Additionally, exon ten at the C‐terminus of tau mRNA can be alternatively spliced, resulting in the inclusion or exclusion of the second microtubule‐binding repeat region (3R, 4R). 4R tau protein binds to microtubules with higher affinity compared to 3R tau and turns over faster than 3R tau. In the human adult brain, 3R and 4R tau proteins are found at approximately equal levels. However, 3R tau mRNA is between two and three times more abundant than 4R tau mRNA. Alternative splicing of tau is a developmentally regulated process as fetal brain contains only 0N3R tau, while the adult brain contains all six isoforms. Isoforms are differentially expressed within different neuronal types in the nervous system. For example, in the hippocampus granule cells in the dentate gyrus express only 3R tau mRNA, whereas some pyramidal cells of Ammon's horn expressed 3R and 4R tau mRNA.
FIGURE 2

Tau structure mapped with tau antibody epitopes. Diagonal stripe denotes alternatively spliced region. Within each subheading the named tau antibody is placed corresponding to its recognition motif with associated references.

Tau structure mapped with tau antibody epitopes. Diagonal stripe denotes alternatively spliced region. Within each subheading the named tau antibody is placed corresponding to its recognition motif with associated references.

Nomenclature

We will use the term “NFT” to encompass all maturity levels including pretangles, mature tangles, and ghost tangles. Historically, the term “stage” is used to describe NFT maturities. , However, to disentangle “stage” from Braak tangle staging, we instead recommend the use of “levels” to describe the NFT maturities across their lifespan. We acknowledge that although NFT maturity levels can be morphologically distinguished, they encompass a dynamic range in which intermediaries exist between each defined maturity level.

HIGHLIGHTS

Neurofibrillary tangles (NFTs) mature through three levels: pretangles, mature tangles, and ghost tangles. NFT maturity levels differ in their morphology, tau isoform predilection, and post‐translational modifications. Visualization techniques recognize a range of the NFT maturity levels and rarely if ever capture the entire NFT lifespan.

RESEARCH IN CONTEXT

Systematic review: The authors searched PubMed and Google Scholar for literature on Alzheimer's disease (AD), tau, neurofibrillary tangles (NFTs), and tau biomarkers. Interpretation: The NFT is a dynamic neuronal lesion that transforms through three defined maturity levels in AD: pretangle, mature tangle, and ghost tangle. There is a wide array of staining techniques used to interpret tau pathology that are reflective of earlier or advanced aspects of NFT maturity. Based on accumulated knowledge, we hypothesize that tau biomarker recognition of early or advanced maturation levels will impact their interpretation. Future directions: We recommend quantitative characterization of tau markers in the context of NFT maturity to guide interpretation of functional deficits both in and outside of the medial temporal lobe. Future studies are needed to test the hypothesis that the pretangle begins as a protective response to identify whether a therapeutic window exists to prevent the death of tangle‐bearing neurons.

MORPHOLOGIES

Pretangles

The concept of a NFT maturity level that precedes mature tangles was discussed during the characterization of the monoclonal tau antibody Alz‐50. , Further characterization of “stage 0 tangles” preceding mature tangles was provided by Bancher et al. in 1989, but it was not until 1991 that Bancher et al. coined the term “pretangles” (Figure 1). Pretangles reside in morphologically normal neurons with a healthy nucleus and diffuse or fine granular cytoplasmic and/or perinuclear immunostaining of tau in the neuron , , (Figure 3). Ultrastructural studies demonstrated that pretangles contain diffusely scattered abnormal fibers including paired helical filaments (PHF), straight filaments, and small bundles of aggregated filaments (for more discussion, refer to section 4.2). Correlative light and electron microscopy (EM) also revealed perinuclear tau was composed of straight filaments that were associated with the nuclear membrane. Additionally, pretangles are devoid of ubiquitin immunostaining. , Pretangles are generally not argyrophilic, , although Gallyas silver staining was reported to visualize pretangles. , Gallyas silver staining has a predilection for tau including exon 10 (4R tau, for more discussion, refer to section 4.3) of which pretangles are primarily composed. , Using AT8 immunohistochemistry, early accumulation of pretangle neuropathology in brainstem nuclei was observed in individuals younger than 30 years of age. ,
FIGURE 3

Neurofibrillary tangle (NFT) maturity level and neuritic morphologies in the CA1 subsector of the hippocampus. Pretangles have perinuclear accumulation of tau, in addition to a diffuse or granular staining pattern. Mature tangles assume the shape of the neuron in which they reside (e.g., “flame‐shaped”) and are composed of tightly packed bundles of fibers. The neuron has a dislocated and/or shrunken nucleus. Ghost tangles are loosely arranged bundles of fibers with no associated nucleus as they are the remnants of mature tangles once the neuron has died. Neuropil threads are the thread‐like staining pattern outside of the soma. Neuritic plaques are the accumulation of dystrophic neurites and are larger than a neuron. Tangle associated neuritic clusters (TANCs) are the accumulation of neurites around a ghost tangle and are around the same size as a neuron. AT8 was used for pretangle, neuropil threads, and TANCs. PHF‐1 was used for mature tangles and neuritic plaques. Ab39 was used for ghost tangles. It is important to note that these antibodies recognize a range of the NFT maturity levels. Immunohistochemistry was counterstained with hematoxylin. Arrows point to the labeled pathology. Bracket includes the entire neuritic plaque structure. Scale bar measures 25 μm.

Neurofibrillary tangle (NFT) maturity level and neuritic morphologies in the CA1 subsector of the hippocampus. Pretangles have perinuclear accumulation of tau, in addition to a diffuse or granular staining pattern. Mature tangles assume the shape of the neuron in which they reside (e.g., “flame‐shaped”) and are composed of tightly packed bundles of fibers. The neuron has a dislocated and/or shrunken nucleus. Ghost tangles are loosely arranged bundles of fibers with no associated nucleus as they are the remnants of mature tangles once the neuron has died. Neuropil threads are the thread‐like staining pattern outside of the soma. Neuritic plaques are the accumulation of dystrophic neurites and are larger than a neuron. Tangle associated neuritic clusters (TANCs) are the accumulation of neurites around a ghost tangle and are around the same size as a neuron. AT8 was used for pretangle, neuropil threads, and TANCs. PHF‐1 was used for mature tangles and neuritic plaques. Ab39 was used for ghost tangles. It is important to note that these antibodies recognize a range of the NFT maturity levels. Immunohistochemistry was counterstained with hematoxylin. Arrows point to the labeled pathology. Bracket includes the entire neuritic plaque structure. Scale bar measures 25 μm.

Mature tangles

Although yet to be termed, mature tangles (Figure 3) were first reported by Alzheimer in 1907 as thick argyrophilic fibers in neurons. , Mature tangles reside in neurons with a shrunken and/or displaced nucleus, with argyrophilic fibrils that appear in a “basket‐like or sling‐like” shape replacing the cytoplasm. NFTs assume the shape of the neuron they occupy, thus mature tangles in pyramidal neurons generally have a flame‐like shape. In addition to their argyrophilic nature, , , mature tangles are ubiquitin positive , and are readily stained by a variety of tau antibodies, which is further discussed in section 3.

Ghost tangles

Ghost tangles, the more advanced level of NFT maturity (Figure 3), were first described by Alzheimer as the remaining fibrils after disintegration of the neuron and nucleus. , These extracellular tangles are less argyrophilic and appear more loosely bundled than mature tangles. , , Additionally, ghost tangles appear eosinophilic by hematoxylin and eosin (H&E) compared to the basophilic properties of intracellular mature tangles. Ghost tangles are ubiquitin positive and can also be infiltrated with glial processes. , As there is more neuronal death than ghost tangles in AD brains, contribution of co‐existing pathologies should be considered when evaluating the relationship between NFT accumulation and neuronal death. ,

Morphology in context

NFTs mature through three defined levels: pretangles, mature tangles, and ghost tangles (Figure 3). Pretangles and mature tangles form intracellularly, whereas ghost tangles become remnants in the extracellular space. While pretangle‐bearing neurons appear morphologically normal with an intact nucleus, there is evidence of transcriptional changes compared to healthy neurons. Protein quality control genes are upregulated in pretangle‐bearing neurons, suggesting a disruption of protein homeostasis. This may parallel the observation of increased phospho‐ubiquitin and granulovacuolar degeneration accumulation in pretangle‐bearing neurons, which becomes less frequently observed in mature tangle‐bearing neurons and may implicate a disruption in the protective role of the mitochondrial quality control pathway. These early changes may initiate a protective response to the accumulation of misfolded proteins, as the unfolded protein response (UPR) becomes activated in pretangle‐bearing neurons, yet these UPR activation markers (e.g., pPERK) are diminished as the mature tangle forms. However, UPR activation induces kinase activity (i.e., GSK‐3β) that may overwhelm the neuron as tau becomes hyperphosphorylated leading to inhibition of anterograde (kinesin‐dependent) fast axonal transport. , GSK‐3β immunoreactivity is strongly present in pretangles, present to a lesser extent in mature tangles, but is not visible in ghost tangles suggesting a precipitous decline in hyperphosphorylation as the neuron dies. Further support for a functional distinction between pretangle‐ and mature tangle–bearing neurons is the emergence of ubiquitin‐labeled proteins in neurons with mature tangles and ghost tangles, but not pretangles suggesting proteolytic degradation attempts are made later in tangle formation. It is important to note that these NFT levels are not static, and intermediaries exist between pretangles, mature tangles, and ghost tangles.

VISUALIZATION OF NFTs

For more than a century, many stains and antibodies were developed and used to visualize neuropathology in AD brains. Here we review staining techniques that were historically relevant in identifying AD neuropathology prior to the discovery of the tau protein. We will further expand upon tau immunohistochemical methods that are particularly relevant to NFT maturity, many of which are now commercially available. While there are numerous tau antibodies available, here we review those of historical relevance and those that are of particular importance to our growing understanding of NFT maturity levels.

Staining techniques pre‐dating the discovery of the tau protein

Hematoxylin, created in the 1840s, is a positively charged basic dye. Eosin, created in 1871, is a negatively charged acidic dye. H&E were first used together between 1875 and 1878 (Table 1, Figure 1) as a morphologic stain in which hematoxylin stains nuclei blue (basophilic) and eosin stains the cytoplasm and extracellular matrix pink (eosinophilic; Figure 4). H&E is a routine stain used by many labs to visualize neuronal loss, as well as mature tangles and ghost tangles in AD. , , , Mature tangles appear basophilic compared to unaffected neurons, whereas ghost tangles are eosinophilic due to infiltration by astroglial processes.
TABLE 1

Tinctorial dye, silver stains, and fluorescent dyes used to identify neurofibrillary tangles with references

Neuropil threadsPretanglesMature tanglesGhost tanglesReference(s)
Tinctorial dye
H&ENoNoYesYes 50
Congo redYesNoYesYes 68
Silver staining 70
BielschowskyYesNoYesYes 70 , 195
BodianYesNoYesYes 70
GallyasYesNo/YesYesYes 70
Campbell‐SwitzerYesNoYesYes 70
Fluorescent dye
Thioflavin‐SYesNoYesYes 73
Thiazin redYesNoYesYes 91 , 92
FIGURE 4

Special stains and tau immunohistochemistry for neurofibrillary tangle (NFT) maturity levels. Representative images for each staining technique were taken at the CA1 sector of the hippocampus in Alzheimer's disease (AD) brains. Routine and special stains include Bielschowsky silver stain, H&E, Congo red, thioflavin‐S (Thio‐S), and thiazin red. All routine and special stains recognized mature tangles and ghost tangles. For immunohistochemistry, Alz‐50, MC‐1, CP13, AT8, PHF‐1, pS396, TauC3, GT‐38, Ab39, and MN423 were used. Tau antibodies recognized a range of NFT maturity levels. Immunohistochemistry was counterstained with hematoxylin. We thank Dr. García‐Sierra for the thiazin red image. Arrow head, pretangles; closed arrow, mature tangles; open arrow, ghost tangles. Scale bar measures 25 μm.

Tinctorial dye, silver stains, and fluorescent dyes used to identify neurofibrillary tangles with references Special stains and tau immunohistochemistry for neurofibrillary tangle (NFT) maturity levels. Representative images for each staining technique were taken at the CA1 sector of the hippocampus in Alzheimer's disease (AD) brains. Routine and special stains include Bielschowsky silver stain, H&E, Congo red, thioflavin‐S (Thio‐S), and thiazin red. All routine and special stains recognized mature tangles and ghost tangles. For immunohistochemistry, Alz‐50, MC‐1, CP13, AT8, PHF‐1, pS396, TauC3, GT‐38, Ab39, and MN423 were used. Tau antibodies recognized a range of NFT maturity levels. Immunohistochemistry was counterstained with hematoxylin. We thank Dr. García‐Sierra for the thiazin red image. Arrow head, pretangles; closed arrow, mature tangles; open arrow, ghost tangles. Scale bar measures 25 μm. Congo red (Table 1, Figure 4) is a tinctorial stain originally created for the textile industry as a cotton dye in 1884 (Figure 1). This dye will exhibit birefringence, in which there are two refractive indices depending upon the orientation of polarized light. Thus, using polarized light microscopy, Congo red shows anomalous colors that are traditionally “apple green,” under cross‐polarization. In 1886, Congo red was first used to stain axons. By 1922, Congo red was used to visualize amyloid in tissue sections where it binds to β‐pleated sheets. , This is due to Congo red's ability to self‐assemble into ribbons that are compatible with the β‐conformation of these protein structures. For over 50 years, this dye was used to visualize AD neuropathology, including mature tangles and ghost tangles. Congo red does not stain pretangles likely owing to the lack of fibrillar structure. Silver staining (Table 1) was the first technique used to visualize AD neuropathology. Specifically, the Bielschowsky silver staining method was first used by Alzheimer to visualize the neuropathology of his first patient , , (Figure 4). This method was created by Bielschowsky in 1902 (Figure 1), and has endured through the modern era, with modified Bielschowsky silver stain protocols routinely used all over the world. Additional silver staining techniques were developed, including Bodian, Gallyas, and Campbell‐Switzer (for a review, see Uchihara ), which are all also used to this day. Positive silver staining is termed argyrophilic and will appear darker compared to non‐argyrophilic structures. This is due to the reduction of silver ions to metallic particles, which can then be visualized through light microscopy (for a review, see Uchihara ). Although both mature tangles and ghost tangles are argyrophilic, ghost tangles are less intensely stained than mature tangles (Figure 4). There are a variety of modifications to silver staining methods, which influences the predilection for 3R/4R neuropathology. Gallyas silver staining has a predilection for 4R tau neuropathology, whereas Campbell‐Switzer has a preference for 3R tau neuropathology. This may explain why Gallyas silver staining reportedly stained pretangles, , because these are predominantly composed of 4R tau. , , , Thioflavins are a group of fluorescent dyes developed in the 1950s (Figure 1) that, like Congo red, will bind to β‐pleated sheets. Thioflavin‐S (Table 1, Figure 4) is excited at 440 nm and is visualized over a wavelength range of 455 to 600 nm allowing detection of Aβ plaques and advanced tangles in the AD brain. As Aβ plaques and NFTs are both visualized by thioflavin‐S, morphologic characteristics are used to differentiate between the pathologies. Specifically, Aβ plaques are round, extracellular accumulations that may contain dystrophic neurites that appear either bulbous or thread‐like; whereas NFTs take the shape of the neuron in the intracellular domain and, once the neuron has died, may remain as a remnant in the extracellular space. Comparing modified Bielschowsky and Bodian silver staining methods with thioflavin‐S, all techniques identified both plaques and NFTs. However, the modified Bielschowsky silver stain and thioflavin‐S performed better than Bodian silver staining at recognizing neuritic plaques. Pretangles are not readily visualized with thioflavin‐S as they do not contain β‐pleated sheets.

Staining techniques developed after the discovery of the tau protein

In April 1985, Yen et al. reported the mouse monoclonal antibody Ab39, which was developed in an effort to identify NFT pathology (Table 2, Figure 1). The study reported that the Ab39 antibody recognized the majority of mature tangles in AD brains. The epitope is currently unknown, but it is believed to recognize a conformational epitope specific to NFTs. Ab39 has since been used to identify ghost tangles in addition to mature tangles (Figure 4). This antibody was available through Dr. Shu‐Hui Yen, but is no longer produced or distributed. In October of the same year, Binder et al. reported the mouse monoclonal Tau‐1 antibody (Table 2, Figure 1), which was developed to determine the localization of tau in the mammalian central nervous system. The epitope for this antibody is amino acids 162–210 (Table 2, Figure 2) with a core sequence encompassing amino acids 192–204 , and is available through Millipore Sigma (catalog # MAB3420). Tau‐1 recognizes mature tangles and to a lesser extent ghost tangles and pretangles after dephosphorylation of AD brain tissue sections. ,
TABLE 2

Tau antibodies and their specifications discussed in this review. The antibodies are either historically relevant or important in understanding the makeup of the neurofibrillary tangle maturity levels

AntibodyEpitopeImmunogenSpeciesClonalityIsotypeSource Catalog #Ref.
4R‐tauaa 275‐291 VQIIDKKLDLSNVQSKCsynthetic N279D 4R‐tau peptide VQIIDKKLDLSNVQSKCRabbitPolyclonalIgGCosmo Bio CAC‐TIP‐4RT‐P01 112
Ab39ConformationalTangle pellets from AD brain homogenateMouseMonoclonalIgG1Shu‐Hui Yen 76 , 77
Alz‐50aa 2‐10, 312‐342AD ventral forebrain homogenateMouseMonoclonalIgM(Davies) 37 , 80
AT8pS202, pT205PHF‐containing pellet from AD frontal and temporal homogenateMouseMonoclonalIgG1Thermo Fisher Scientific MN1020 96
CP13pS202MouseMonoclonalIgG1(Davies) 105
GT‐38ConformationalTau PHFs from AD brainsMouseMonoclonalIgG1Abcam ab246808 114
MC‐1aa 7‐9, 312‐322Alz‐50 immunoaffinity purified PHFs from AD brain homogenateMouseMonoclonalIgG1(Davies) 84
MN423aa 387‐391 DHGAE, truncation at E391Pronase treated neurofibrillary tangle preparationsMouseMonoclonalIgG2bNicholas Kannan (Novak) 85 , 86 , 87 , 120
PHF‐1pS396, pS404Non‐aggregated PHFs from AD brainMouseMonoclonalIgG1(Davies) 94
pS396pS396Synthetic corresponding to human tau aa 350 to the C‐terminus.RabbitMonoclonalIgGAbcam ab109390
RD3aa 267‐274, 306‐316 continuous KHQPGGGKVQIVYKPVKHQPGGGKVQIVYKPVMouseMonoclonalIgGMillipore Sigma 05‐803 104
RD4aa 275‐291 VQIINKKLDLSNVQSKCVQIINKKLDLSNVQSKCMouseMonoclonalIgGMillipore Sigma 05‐804 104
TauC3aa 412‐421 CSSTGSIDMVDCSSTGSIDMVD peptideMouseMonoclonalIgG1Nicholas Kannan (Binder) 113
Tau‐1aa 162‐210Bovine heat‐stable microtubule associated proteinsMouseMonoclonalIgG2aMillipore Sigma MAB3420 79 , 80 , 81 , 82
Tau‐66aa 155‐244, 305‐314Recombinant 2N3R polymers tauMouseMonoclonalIgMNicholas Kannan (Binder) 109
TG‐3pT231Purified PHFsMouseMonoclonalIgM(Davies) 106

Abbreviations: AD, Alzheimer's disease; IgG, immunoglobulin; PHF, paired helical filaments.

Tau antibodies and their specifications discussed in this review. The antibodies are either historically relevant or important in understanding the makeup of the neurofibrillary tangle maturity levels Abbreviations: AD, Alzheimer's disease; IgG, immunoglobulin; PHF, paired helical filaments. In 1986, Wolozin et al. reported the mouse monoclonal antibody Alz‐50 (Table 2, Figure 1), which was designed to investigate NFT pathology in the cholinergic neurons of the ventral forebrain. The discontinuous epitope maps to amino acids 2–10, and 312–342 (Figure 2). Alz‐50 immunopositive neurons were interpreted to “recognize a precursor to tangle formation” (i.e., pretangles) as they lacked thioflavin‐S co‐staining (Figure 4). Alz‐50 also recognizes mature tangles, but does not label ghost tangles (Figure 4). Thus, Alz‐50 is considered useful as an early marker of NFT maturity. In 1997, Jicha et al. generated the mouse monoclonal antibody MC‐1 (Figure 1) to create an antibody with a similar epitope to Alz‐50 that would not react with the Alz‐50 positive protein, FAC1. The epitope for MC‐1 is amino acids 7–9 and 312–322 (Figure 2). Similar to Alz‐50, MC‐1 recognizes primarily pretangles and mature tangles (Figure 4). Alz‐50 and MC‐1 were previously produced by Dr. Peter Davies. In 1988, Wischik et al. reported the mouse monoclonal antibody 423 (mAb 423, MN423) (Table 2, Figure 1), which was developed to identify the PHF core. This antibody recognizes amino acids 387–391 of tau truncated at glutamic acid (E) 391 in the core of PHFs. , MN423 primarily identifies ghost tangles and mature tangles. , , MN423 recognizes even advanced forms of ghost tangles in the hippocampus that display a spherical, end‐stage morphology (Figure 4). MN423 is significant in the scientific understanding of AD in that it identified truncated tau in the PHF core. This antibody was originally produced by Dr. Michal Novak. Thiazin red (Table 1) is a fluorescent stain that binds to β‐pleated sheets and was first used to identify plaques and tangles in AD in 1988 (Figure 1). Thiazin red visualizes mature tangles and ghost tangles, but not pretangles because they do not contain fibrils (Figure 4). Additionally, ghost tangles stain less intensely than mature tangles. When excited at 418 nm, thiazin red is visualized at wavelengths > 520 nm. Unlike thioflavin‐S, thiazin red can be used to stain frozen‐thawed AD brain tissue. PHF‐1 is a mouse monoclonal antibody developed in 1989 (Table 2, Figure 1) in an effort to recognize PHF proteins. This is a commonly used antibody that recognizes tau phosphorylated at serine (S) 396 and S404 (Figure 2) and predominantly immunostains mature tangles, with reduced immunostaining of pretangles and ghost tangles (Figure 4). PHF‐1 was previously produced by Dr. Peter Davies; however, Abcam's pS396 antibody (catalogue # ab109390) may be an acceptable commercial alternative as it shares the phosphorylated S396 epitope with PHF‐1 (Table 2, Figure 2). Like PHF‐1, this antibody primarily stains mature tangles and ghost tangles (Figure 4). In 1992, Mercken et al. generated the mouse monoclonal antibody AT8 (Table 2, Figure 1), which recognizes tau phosphorylated at S202 , and threonine (T) 205 (Figure 2). AT8 is an important antibody in the AD field due to its versatility for multiple methods including immunoblotting, , immunohistochemistry, and immuno‐EM. AT8 generally immunostains pretangles and mature tangles , , , , , , , , , (Figure 4). Ghost tangles are not readily recognized by AT8; however, neuritic pathology can accumulate around them in the form of tangle‐associated neuritic clusters (TANCs; Figure 3). In contrast, there are previous reports of AT8 immunostaining primarily in mature tangles and ghost tangles. , AT8 is a commercially available antibody (Thermo Fisher Scientific, catalogue # MN1020) with a comparable non‐commercial mouse monoclonal antibody previously produced by Dr. Peter Davies, CP13. CP13 was first reported in 1999 by Jicha et al. (Table 2, Figure 1). This widely used antibody recognizes tau phosphorylated at S202 (Figure 2) and primarily stains pretangles and mature tangles (Figure 4). TG‐3 is an antibody first reported in 1996 by Vincent et al. (Figure 1). This antibody recognizes a regional conformational change with a phosphorylation site at T231 (Table 2). A study by Luna‐Muñoz et al. characterized TG‐3 immunostaining and found this antibody to recognize both fibrillar and non‐fibrillar tau, as reported with thiazin red co‐staining. This antibody recognizes pretangles and mature tangles, but with mixed reports on predilection for ghost tangles. , TG‐3 was previously produced by Dr. Peter Davies. Tau‐66 is a mouse monoclonal antibody reported in 2001 by Ghoshal et al. in an effort to investigate other conformational changes observed in tau (Table 2, Figure 1). This antibody recognizes a conformational change of tau in which the proline‐rich region interacts with the microtubule binding domain repeat 3 (discontinuous epitope of amino acids 155–244, 305–314) (Figure 2). Upon initial characterization, mature tangles were immunostained by Tau‐66 in the superior temporal gyrus and hippocampus. The Tau‐66 antibody has played a crucial role in the development of the hypothesis of sequential conformational states of tau pathology (for more discussion, refer to section 4.1). This antibody was originally produced by Dr. Lester Binder at Northwestern University and provided by Dr. Nicholas Kanaan at Michigan State University. De Silva et al. developed mouse monoclonal antibodies RD3 (Millipore Sigma, catalogue # 05‐803) and RD4 (Millipore Sigma, catalogue # 05‐804; Table 2) in 2002 (Figure 1), which recognize 3R and 4R tau, respectively. The putative epitope for RD3 contains continuous amino acids 267–274 and 306–316 and the RD4 epitope contains amino acids 275–291 (Figure 2). Pretangles predominately immunostain with RD4, mature tangles immunostain with RD3 and RD4, and ghost tangles predominately immunostain with RD3. , , , , , To simplify double immunostaining procedures, a rabbit polyclonal 4R‐tau antibody was generated in 2013 (Cosmo Bio, catalogue # CAC‐TIP‐4RT‐P01). The rabbit polyclonal 4R‐tau antibody shares the same epitope as RD4 (Table 2, Figure 1 and 4), and enabled comparison to RD3 by eliminating host species redundancy. Overall, RD3 and RD4 antibodies are the first highly specific antibodies to 3R and 4R isoforms, allowing investigators to study isoform changes in AD. Mouse monoclonal antibody TauC3 was developed in 2003 (Figure 1) and originally produced by Dr. Lester Binder at Northwestern University. This antibody labels tau truncated at aspartic acid (D) 421 recognizing amino acids 412–421 (Table 2, Figure 2). This antibody immunostained both mature tangles and ghost tangles (Figure 4), providing evidence that NFTs contain tau that is truncated at a cleavage site. Gibbons et al. reported the mouse monoclonal antibody GT‐38 (Table 2) in 2018 (Figure 1) in an effort to identify AD‐specific tau neuropathology. The exact epitope is unknown, but is considered to recognize a conformational species of tau. This antibody immunostains both mature tangles and early ghost tangles (Figure 4). GT‐38 did not recognize tau pathology in the context of corticobasal degeneration and progressive supranuclear palsy. Instead, the antibody is shown to be specific for NFT pathology in mixed 3R/4R tauopathies, such as AD, instead of only 3R or 4R primary tauopathies, such as Pick's disease and progressive supranuclear palsy. GT‐38 is now available through Abcam (catalogue # ab246808).

NFT visualization in context

NFTs are visualized through a variety of special stains, as well as antibody‐based immunohistochemistry. H&E can be used to identify mature tangles and ghost tangles by their tinctorial properties: mature tangles are basophilic and appear blue, whereas ghost tangles are eosinophilic and appear pink. The majority of the special stains discussed (thioflavin‐S, Congo red, thiazin red) will bind to the β‐pleated structure formed by fibrils of the mature tangles and ghost tangles. , , , Additionally, mature tangles and ghost tangles are argyrophilic. Immunohistochemistry is a highly effective method of visualizing NFTs. , , , , , , , , , , , Pretangles are primarily visualized with AT8, CP13, Alz‐50, and MC‐1. Mature tangles are primarily visualized with PHF‐1, pS396, Tau‐66, and TauC3, and can also be visualized with AT8, CP13, Alz‐50, and MC‐1. Ghost tangles are primarily visualized with GT‐38, Ab39, TauC3, and MN423. Importantly, antibodies do not solely recognize one NFT maturity level, but will recognize a small range on the spectrum along the NFT lifespan (Figure 5). A point of consideration with any antibody‐based approach relates to the loss of the epitope, whether an effect of conformational events or other post‐translational modifications that affect antibody recognition.
FIGURE 5

Summary of neurofibrillary tangle (NFT) maturity levels from early to advanced forms. Intermediaries exist between the defined NFT maturity levels. NFTs in intermediary 1 will have focal accumulation of fibrillar tau that does not completely fill the neuron, which was previously speculated to be nucleation sites. Intermediary 2 will have intense staining of the NFT without a nucleus. There is a shift in NFT localization, as pretangles and mature tangles are intracellular and ghost tangles are extracellular. Additionally, there is a shift in isoform expression, as pretangles predominantly express 4R tau and ghost tangles predominantly express 3R tau. Staining methods will label a range of NFT maturity levels, as identified by the dark blue triangles. Thioflavin‐S (Thio‐S) and thiazin red recognize primarily mature tangle sand ghost tangles. CP13, AT8, Alz‐50, and MC‐1 primarily recognize primarily earlier NFT maturity levels. PHF‐1, pS396, and TauC3 primarily recognize a middling NFT maturity level. Finally, Ab39, GT‐38, and MN423 primarily recognize advanced NFT maturity levels. Scale bar measures 25 μm.

Summary of neurofibrillary tangle (NFT) maturity levels from early to advanced forms. Intermediaries exist between the defined NFT maturity levels. NFTs in intermediary 1 will have focal accumulation of fibrillar tau that does not completely fill the neuron, which was previously speculated to be nucleation sites. Intermediary 2 will have intense staining of the NFT without a nucleus. There is a shift in NFT localization, as pretangles and mature tangles are intracellular and ghost tangles are extracellular. Additionally, there is a shift in isoform expression, as pretangles predominantly express 4R tau and ghost tangles predominantly express 3R tau. Staining methods will label a range of NFT maturity levels, as identified by the dark blue triangles. Thioflavin‐S (Thio‐S) and thiazin red recognize primarily mature tangle sand ghost tangles. CP13, AT8, Alz‐50, and MC‐1 primarily recognize primarily earlier NFT maturity levels. PHF‐1, pS396, and TauC3 primarily recognize a middling NFT maturity level. Finally, Ab39, GT‐38, and MN423 primarily recognize advanced NFT maturity levels. Scale bar measures 25 μm. Immunohistochemistry and light microscopy are powerful tools to investigate AD neuropathology; however, these methods are not without their limitations. One of the defining criteria to determine NFT maturity level is the presence and shape of the nucleus. Upon sectioning, nuclei can be out of plane to the neuropathology observed, complicating the classification of the NFT maturity level. As previously mentioned, another limitation to microscopic methods is that there are currently no markers available to recognize a single NFT maturity level. This is because the NFT maturity levels are not static entities, but rather dynamic structures that exist along a spectrum of the NFT lifespan. For example, the intermediary between pretangles and mature tangles (intermediary 1, Figure 5) shows focal puncta or fibrils that are intensely stained for tau, but does not fill the entire neuron. This level was described previously as neurons with bead‐shaped structures that were speculated to be nucleation sites. The intermediary between mature tangles and ghost tangles (intermediary 2, Figure 5) shows intense immunostaining of tau throughout the neuron without a nucleus. With the advent of multiplexing technology to reveal multiple protein targets, future studies are encouraged to evaluate shifting profiles along the dynamic spectrum of NFT maturity.

NEUROFIBRILLARY CHANGES IN AD

Post‐translational modifications of tau

Post‐translational modifications are alterations that occur after mRNA has been translated to protein and can affect a protein's function and/or downstream signaling. Examples include phosphorylation, ubiquitination, truncation, and conformational changes. For a detailed review of post‐translational modifications of tau in AD, please refer to Martin et al. Below, we highlight the utility of immunohistochemical markers of post‐translational modifications that provide keen insight into our understanding of the temporal sequence of events related to NFT maturity. Phosphorylation occurs naturally to release tau from microtubules and to promote depolymerization. All six isoforms of tau in PHFs exhibit abnormal phosphorylation on S, T, and tyrosine sites. Phosphorylated tau is observed at each level of NFT maturity. In comparison, ubiquitinated tau is found in mature tangles and ghost tangles, but not in pretangles. , Additionally, dystrophic neurites radiating from the neuritic plaques are largely found to be ubiquitin‐positive, although a subset of ubiquitin‐negative neurites was also reported. , The truncated form of tau was first identified in the PHF core in 1988. , This truncation event occurs at E391 and is recognized by the antibody MN423 , , (Table 2). Truncation at E391 is identified primarily in mature tangles and ghost tangles. , In 2003, another C‐truncation event at D421, recognized by the antibody TauC3 (Table 2), was identified and occurs at a caspase cleavage site. , , , , Truncation at D421 was identified in pretangles and mature tangles , providing a framework for the interpretation in the context of NFT maturity. C‐terminal truncations correlate with N‐terminal truncations. Immunoblotting of the insoluble fraction containing mature tangles and ghost tangles identified the lack of an amino terminal that is recognized by the Alz‐50 antibody. Additionally, immunohistochemistry and immunofluorescence experiments also provide evidence for a truncated N‐terminus of tau in mature tangles and ghost tangles. , In vitro experiments identified a caspase‐6 cleavage site at D13 and antibodies that span across this site recognized tau in pretangles and mature tangles, but not ghost tangles. This provides further evidence that the N‐terminus is truncated in advanced levels of NFT maturity. The “post‐translational sequence of events” hypothesis is summarized in Figure 6 (adapted from Binder et al. ).
FIGURE 6

Proposed tau conformational and truncation events hypothesized along the neurofibrillary tangle (NFT) lifespan. First, the N‐terminus binds to the microtubule binding region (MTBR), as recognized by Alz‐50. Next, the C‐terminus is truncated at D421, as recognized by Tau‐C3. Next, the N‐terminus is truncated, and the proline‐rich region will bind to the microtubule binding region, as recognized by TauC3. Then, tau is truncated at E391, as recognized by MN423. Finally, the proline‐rich region is further cleaved. These conformational and truncation events occur through the NFT lifespan. For example, pretangles are predominantly Alz‐50 positive, but not MN423 positive. Mature tangles are positive for Alz‐50, TauC3, Tau‐66, and MN423. Ghost tangles are predominantly positive for TauC3, Tau‐66, and MN423. Sequence of events figure reprinted from Biochim Biophys Acta, 1739, Binder et al., Tau, tangles, and Alzheimer's disease, 216‐223, Copyright (2005), with permission from Elsevier.

Proposed tau conformational and truncation events hypothesized along the neurofibrillary tangle (NFT) lifespan. First, the N‐terminus binds to the microtubule binding region (MTBR), as recognized by Alz‐50. Next, the C‐terminus is truncated at D421, as recognized by Tau‐C3. Next, the N‐terminus is truncated, and the proline‐rich region will bind to the microtubule binding region, as recognized by TauC3. Then, tau is truncated at E391, as recognized by MN423. Finally, the proline‐rich region is further cleaved. These conformational and truncation events occur through the NFT lifespan. For example, pretangles are predominantly Alz‐50 positive, but not MN423 positive. Mature tangles are positive for Alz‐50, TauC3, Tau‐66, and MN423. Ghost tangles are predominantly positive for TauC3, Tau‐66, and MN423. Sequence of events figure reprinted from Biochim Biophys Acta, 1739, Binder et al., Tau, tangles, and Alzheimer's disease, 216‐223, Copyright (2005), with permission from Elsevier. The earliest known structural conformational change in tau is identified by both the Alz‐50 and MC‐1 antibodies. The discontinuous epitope of these antibodies recognizes both the N‐terminus and the microtubule binding domain , (Table 2, Figure 2). Alz‐50 and MC‐1 were used to identify the earliest conformational change as it recognizes pretangles and mature tangles. , , The Tau‐66 antibody (Table 2) recognizes a subsequent conformational change, specific to the interaction of the proline‐rich region and the beginning of the third microtubule binding repeat (Figure 2). This antibody primarily recognizes mature tangles and ghost tangles , and may also recognize some pretangles determined by punctate immunostaining. However, Alz‐50 and Tau‐66 do not co‐localize, indicating these antibodies recognize different populations of mature tangles. Many additional post‐translational modifications, including glycosylation, , glycation, , nitration, and acetylation , are found on tau (for a review, see Martin et al. ). We have focused on available evidence for a sequence of conformational and truncation events especially as it pertains to phosphorylation, but there is a need to better understand the relevance of post‐translational modifications to NFT maturity. Does the slow accumulation of hyperphosphorylated tau prior to N‐terminal truncation account for the resilience of dendritic spines in the brains of individuals who died without overt cognitive symptoms? Do C‐terminal truncations of tau lead to defects in axonal transport machinery that are ultimately responsible for the death of the neuron? These questions and others are especially important in the context of neuronal health, synaptic function, and axonal transport as future studies are encouraged to examine these sequences of events in the context of NFT maturity.

Ultrastructural changes

In 1963, ultrastructural studies of mature tangles demonstrated accumulation of PHFs (Figure 1) composed of double helical structures. , X‐ray diffraction studies showed that PHFs conform to a β‐pleated sheet structure, which is a secondary structure of proteins composed of amino acid chains that are bound by hydrogen bonds to form sheets (for a review, see Taylor et al. ). The major component of PHFs is tau , , , , , , with a minor component composed of ubiquitin. , Immunostaining for both tau and ubiquitin mimicked observations of argyrophilic NFTs on silver stained sections. Straight filaments were also identified in mature NFTs by EM. However, straight filaments are not as abundant as PHFs in AD brains. Using cryogenic‐EM, Fitzpatrick et al. found that PHF cores and straight filament cores were composed of identical protofilaments; however, PHF and straight filament cores differ in how the protofilaments are packed. As cryo‐EM studies continue to advance our understanding of tau biology, it will be of great interest to characterize how protofilament packaging develops from pretangles to mature tangles and onto ghost tangles. Through careful structural visualization of filamentous changes in NFT maturity we may be able to better understand what antigen–antibody interface becomes unmasked sufficient for therapeutic targeting.

Tau isoforms

AD is considered a 3R/4R tauopathy, meaning the NFTs are composed of both isoforms with no predominance of one over the other. This is in contrast to primary tauopathies, which are classified as 3R‐predominant (e.g., Pick's disease) or 4R‐predominant (e.g., progressive supranuclear palsy, corticobasal degeneration). , Although AD is classified as a 3R/4R tauopathy, evidence suggests a shift in the tau isoform expression through the NFT maturity levels. Both 3R and 4R tau pathology have been mapped in the hippocampus according to NFT maturity using immunohistochemistry , , and immunofluorescence. , Pretangles contain predominantly 4R tau, mature tangles contain both 3R and 4R tau, and ghost tangles contain predominantly 3R tau. , , , , Even though there is a predominance of the tau isoforms in pretangles and ghost tangles, 3R and 4R tau can also be expressed in the opposite end of the NFT lifespan as well. There is also heterogeneity of tau isoform expression in neurons themselves, with 3R tau expressed in the dendrites and 3R/4R tau expressed in the soma of mature tangle‐bearing neurons. An increase in 3R tau through disease progression was reported in the brainstem of AD brains. The change from 4R to 3R tau is not a post‐translational modification, which indicates that possible mechanisms for this change in isoform expression in NFTs may be due to altered alternative splicing regulation or metabolism of the isoforms. In contrast, no change in tau protein isoform expression was observed in the frontal cortex, a region that accumulates NFTs later on in the disease course, of AD brains compared to controls. , Interestingly, some reports show the ratio between 4R:3R tau mRNA was increased in AD brains compared to controls, , , which may suggest an overcompensation of generating 4R tau mRNA due to the increased proportion of 3R tau protein in the neuron. There are currently no MAPT mutations identified that cause AD; however, several mutations were identified as causative for frontotemporal dementia (for a review, see Ghetti et al. ). Interestingly, different mutations confer predominance of 3R or 4R tau inclusions. For example, tau pathology in frontotemporal dementia patients with V337M and R406W mutations contain both 3R and 4R tau. Patients with these two mutations have PHFs and straight filaments, as well as pretangles, mature tangles, neuropil threads, and neuritic plaques that are similar to neuropathology observed in AD. , In contrast, there are numerous mutations that result in predominantly 3R or 4R tau pathology. The P301L and N279K are two examples of mutations causing predominantly 4R tau pathology in frontotemporal dementia. Considerations of mutation effects on tau isoform expression are important, especially for modeling tauopathies or biomarker evaluation of tau markers.

Neuritic pathology

Although the focus of this review is on NFTs, we would be remiss not to discuss neuritic pathologies as they are a consistent observation in AD brains. Neuritic pathologies encompass several forms including neuropil threads, neuritic plaques, and TANCs. Neuropil threads (Figure 3) were first described in 1986 (Figure 1) as argyrophilic, thread‐like structures outside of cell bodies (i.e., neuropil). Neuropil threads were identified in dendrites of tangle‐bearing neurons in AD brains using 100 μm thick silver stained sections, as well as serial tau immunostained sections. Additionally, neuropil threads were identified in axons by immuno‐EM on AD brains. Thus, neuritic pathology owing to axonal versus dendritic accumulation is not typically specified. Neuropil threads are observed in proximity to pretangles, mature tangles, and ghost tangles. They are primarily composed of PHFs and straight filaments, but may also include neurofilament. In fact, evidence suggests that PHFs and straight filaments replace neurofilament in the neurites. Multiple antibodies recognize neuropil threads, but this pathology is revealed to a much greater extent by antibodies that recognize hyperphosphorylated tau (e.g., CP13, AT8, and PHF‐1; Figure 3). Neuropil threads are not readily observed on H&E, but can be observed on silver‐stained sections and with Congo red or other fluorescent dyes (Table 1). Various subsets of neuropil threads can be revealed depending upon the antibody, stain, or dye used, which we speculate may reflect the maturity level of the originating NFT. Neuritic plaques (Figure 3) are generally larger than a neuron and are principally composed of extracellular Aβ deposits that contain bulbous and thread‐like dystrophic neurites. Neuritic plaques are composed of both dendrites and axons and preferentially form near microvasculature. , , Neuritic plaques are argyrophilic and can be stained with a variety of tau antibodies. The often‐overlooked form of neuritic pathology, TANCs (Figure 3) were first defined in 1992 (Figure 1) and are composed of neurites surrounding a ghost tangle. However, not all ghost tangles are associated with TANCs. TANCs are identified by silver staining and multiple tau antibodies, like AT8 and Alz‐50 , as well as other markers as exampled by the synaptic protein chromogranin A. Awareness of neuritic pathologies is especially relevant to digital pathology studies that use quantitative software to measure burden of pathology. Depending upon the tau marker of interest, neuritic pathologies may occupy a sizable portion of the annotated area. The specific contribution of increasing neuritic pathology may be difficult to disentangle from accumulation of NFTs themselves. Caution is warranted not to overinterpret their contribution as above and beyond that of NFTs depending on the marker used; as exampled by AT8, which may demonstrate rich staining of neuritic pathology disproportionate to the number of tangles as they may have matured past the point of being AT8‐immunopositive (e.g., ghost tangles).

CLINICOPATHOLOGIC CORRELATIONS

In 1991, Braak and Braak described neuropathologic staging of neurofibrillary changes in AD, which has become a widely accepted neuropathologic measure termed Braak tangle stage (Figure 1). They used a variety of silver staining methods to evaluate mature tangles, ghost tangles, and neuropil threads. Braak tangle stages I and II display initial neurofibrillary changes in the transentorhinal region in the pre‐α neurons and entorhinal cortex with minimal changes in the CA1 subsector of the hippocampus. Braak stages III and IV have further involvement of the entorhinal cortex and hippocampal subsectors with involvement of temporal cortex. During Braak stages V and VI ghost tangles are present in the transentorhinal region and mature tangles are present throughout the hippocampus and striatum. Association cortices become involved, with eventual involvement of primary cortices. A strong correlation exists between clinical symptoms of AD dementia and NFT accumulation. , , , , Cognitive deficits are not readily observed with the minimal neuropathology of Braak tangle stages I and II. However, by Braak stages III and IV with the involvement of the limbic system and temporal cortices, cognitive impairment and personality changes begin to show. , This agrees well with clinicopathologic observations from Delacourte biochemical staging of AD that identified mild cognitive changes in cases with hippocampal and temporal cortices involvement (stages 3‐6). By Braak stages V and VI, mature tangles and ghost tangles are identified throughout much of the brain, which is reflective of global cognitive impairment. Delacourte biochemical staging similarly reported striking cognitive impairment by stage 7, whereupon two or more polymodal association areas are affected. Taken together, the spatiotemporal patterning of these staging systems underscores the detrimental nature of cortical NFT involvement in the AD brain. Hierarchical staging provides a robust measure useful in interpretation of global tangle involvement, but more work is needed to understand the impact of NFT maturity admixture. Careful evaluation of the composition of NFT maturities (e.g., 90% pretangles with only 10% mature tangles) in the context of cognitive impact may have wide‐reaching implications for cognitive reserve. Perhaps the ability of an individual to withstand NFT pathology exists within the context of how fast or how slow pretangles become mature tangles. Primary age‐related tauopathy (PART) cases are a good example of how NFT admixture may affect cognition, as cases lie along a spectrum of severity. The majority of PART cases demonstrate mild cognitive impairment, but a subset with significant ghost tangles in medial temporal lobe structures make up the entity tangle‐predominant dementia. , As the name belies, the extensive involvement of ghost tangles even in the absence of significant cortical involvement confers a dementing syndrome.

BIOMARKER IMPLICATIONS

Understanding the lifespan of NFT maturity is critical to the study of how the disease progresses. In addition to investigating underlying molecular processes, NFT maturity also has implications for neuroimaging biomarkers. Neuroimaging techniques have become more common in assisting ante mortem diagnosis of AD dementia, especially within the context of a research framework. Since the early 2000s, multiple positron emission tomography (PET) tracers were developed to visualize tau in vivo. These tracers include FDDNP, PBB3, flortaucipir (T807, AV‐1451), and THK‐5351 (Figure 1). Flortaucipir is a Food and Drug Administration‐approved first‐generation tau PET tracer that can differentiate patients with AD from other tauopathies and healthy controls , , (Figure 7). MK‐6240 is a more recent tau PET tracer first characterized in 2016 that was identified through in vitro binding to PHFs from AD brain homogenates and closely reflects flortaucipir binding. Autoradiographic studies of flortaucipir demonstrate binding to more mature levels of NFT pathology, using disease states to make broad comparisons. As exampled by PART cases that can lie along a spectrum of mild pretangle involvement in the hippocampus to end‐stage ghost tangle involvement, flortaucipir binding was readily observed in mild PART cases, but binding was minimally observed in areas where extensive ghost tangles were identified. This and ongoing studies suggest that the composition of NFT maturity levels may influence tau PET signal. The field of tau PET tracers is expanding rapidly with new compounds being evaluated each year , (for a review of related tauopathies, please refer to Leuzy et al. ). Given the complex nature of tau, researchers have high hopes that PET tracers will also demonstrate some specificity for different isoforms of tau other than 3R/4R tau. Flortaucipir and PI‐2620, a more recently developed tau PET tracer, among others, have shown some PET signal in 4R predominant tauopathies. It is too early to know the full extent of tau PET tracer profiles for both tau severity and NFT maturity, but the opportunities are intriguing.
FIGURE 7

Tau positron emission tomography (PET) imaging of Alzheimer's type tau pathology and corresponding hippocampal tau pathology. Coronal and axial flortaucipir PET scans shown in the top panel were overlaid onto structural magnetic resonance imaging of two study participants who later came to autopsy. The left panel from a Braak stage III study participant diagnosed with diffuse Lewy body disease shows minimal flortaucipir uptake (below threshold) throughout the brain with slightly more prominence in white matter that is likely nonspecific. The corresponding histology image from PHF‐1 immunostained hippocampus revealed scattered pretangles, mature tangles, and rare ghost tangles. In contrast, the Braak VI study participant diagnosed with AD in the right panel demonstrated striking flortaucipir uptake with more intense tau PET signal (warmer red and orange color overlay) throughout the brain. The corresponding PHF‐1 immunostained hippocampus and parietal cortex reveals frequent mature tangles and ghost tangles compared to the Braak III patient. Neuritic pathology including neuropil threads and neuritic plaques is also readily observed in areas of tangle pathology. As the neuropathologic underpinnings of tau PET signal remains an intense area of investigation, the comparative contribution of tangles and neuritic pathology is still unknown. Immunohistochemistry was counterstained with hematoxylin. Black closed arrow, mature tangles; black open arrow, ghost tangles; white arrow head, neuropil thread; white closed arrow, neuritic plaque. Scale bar measures 50 μm.

Tau positron emission tomography (PET) imaging of Alzheimer's type tau pathology and corresponding hippocampal tau pathology. Coronal and axial flortaucipir PET scans shown in the top panel were overlaid onto structural magnetic resonance imaging of two study participants who later came to autopsy. The left panel from a Braak stage III study participant diagnosed with diffuse Lewy body disease shows minimal flortaucipir uptake (below threshold) throughout the brain with slightly more prominence in white matter that is likely nonspecific. The corresponding histology image from PHF‐1 immunostained hippocampus revealed scattered pretangles, mature tangles, and rare ghost tangles. In contrast, the Braak VI study participant diagnosed with AD in the right panel demonstrated striking flortaucipir uptake with more intense tau PET signal (warmer red and orange color overlay) throughout the brain. The corresponding PHF‐1 immunostained hippocampus and parietal cortex reveals frequent mature tangles and ghost tangles compared to the Braak III patient. Neuritic pathology including neuropil threads and neuritic plaques is also readily observed in areas of tangle pathology. As the neuropathologic underpinnings of tau PET signal remains an intense area of investigation, the comparative contribution of tangles and neuritic pathology is still unknown. Immunohistochemistry was counterstained with hematoxylin. Black closed arrow, mature tangles; black open arrow, ghost tangles; white arrow head, neuropil thread; white closed arrow, neuritic plaque. Scale bar measures 50 μm. Further understanding of NFT maturity may also be useful in identifying other blood or cerebrospinal fluid (CSF) biomarkers to aid diagnosis. As the technology continues to advance, molecular detection of above‐mentioned tau truncations and conformational events may be a viable target in CSF and plasma. Recent work demonstrates the hypothesized associations of serum and CSF biomarkers and AD neuropathology. Plasma tau pT181 is strongly associated with both Aβ and tau PET. Plasma tau pT181 better predicted elevated brain Aβ than total tau and was equal or enhanced compared to age and apolipoprotein E (APOE) ε4 carrier status combined. Others have shown an association between baseline CSF Aβ1‐42 and changes in CSF tau pT181 that was strongest in female APOE ε4 carriers, emphasizing the potential role of sex differences in AD pathology. Extension of NFT maturities to the temporal sequence of CSF tau or plasma‐based tau measures will be an invaluable contribution to our understanding of how to predict neuropathologic changes and their impact on cognition in preclinical patients. Does early detection of pT217 and pT181 correspond with the slow accumulation of pretangle pathology, whereas later recognition of pT205 corresponds to accumulation of significant mature tangle pathology? As the technology continues to advance, molecular detection of multiplexed tau truncations and conformational events in CSF and plasma may become the targeted biomarker capable of predicting change before neuronal death has occurred.

SPECULATION AND FUTURE DIRECTIONS

It may not be enough to have potential treatments remove NFT lesions. It may be more prudent to prevent them from maturing. To move forward, we must close this gap of knowledge concerning NFT maturity. This largely starts with deeper characterizations of the antibodies used to better answer scientific questions. There are many tau antibodies available to researchers that recognize different populations of tangles. For example, AT8 is widely used and suggested as a means to obtain Braak staging. , AT8 predominately visualizes pretangles and mature tangles, and rarely recognizes ghost tangles, excluding an entire maturity level from its studies. While AT8 may be an ideal antibody to study NFT formation, it lacks utility in neurons that are dying/dead from NFTs. Overwhelming evidence supports the concept of NFT maturation. However, given the cross‐sectional nature of postmortem studies, it is difficult, if not impossible, to observe NFTs maturing in the human brain in vivo. A critical knowledge gap concerning the shift in 4R to 3R tau isoform expression may represent differential dysregulation of tau throughout the NFT lifespan. , , , Because 4R positive pretangles lack fibrillar structure, it seems unlikely that they will serve as a seed through which PHF will form and aggregate. As such, we cannot exclude the possibility that pretangles, mature tangles, and ghost tangles are distinct lesions that occur in isolation. As discussed by Luna‐Muñoz et al., bead‐like structures were observed in neurons between pretangles and mature tangles. They speculated these structures to be nucleation sites, which may provide evidence for the maturation of pretangles into mature tangles through an intermediary 1 level (Figure 5). Regardless, there is a need to further understand pretangles and how mature tangles form as a distinct or minimally related structure compared to ghost tangles. AD researchers must also work to establish a more complete sequence of post‐translational events through the maturity levels. Some conformational and truncation events have been heavily investigated; however, phosphorylation at different sites, ubiquitination, and other post‐translational events have been less well characterized. Even though it is likely that many of these events occur outside of a temporal sequence, understanding the order of post‐translational events may allow for more targeted treatment options. There is a need for more studies concerning functional consequences of the NFT maturity levels, both within the neuron and in the neuronal network. More clarity is needed to determine why pretangles form, and if they are protective or toxic. Studies in mouse models have shown that neurons with NFTs remain functional in networks for a time, but do they become non‐functional? How long do NFT‐burdened neurons remain functional compared to not? We also suggest scientists in the biomarker field work more closely with neuropathologists. For neuroimagers, collaborating with a neuropathologist may lead to a better understanding under the microscope of what the PET ligand may be binding to. We cannot forget the lessons learned from tau antibody‐based studies that demonstrate post‐translational events will remove or add epitopes that allows for less or more binding of an antibody through the NFT lifespan. Why would the same not be true for PET ligands? It is possible that post‐translational events of tau in NFTs will open up or remove ligand binding sites that can influence PET imaging results. More must be done to better understand what these PET ligands are binding to and is signal lost as the NFT matures. For fluid biomarkers, working with a neuropathologist will allow a better understanding of where in the NFT lifespan the targets exist. These targets have been known for a significant number of years, yet we lack understanding of their temporal distribution in the NFT lifespan. For many years, we have known that certain populations of neurons are predominately vulnerable to NFT pathology, with many compelling follow‐up questions. Do NFTs in certain regions or neuronal populations in the brain mature at different rates? Additionally, does the tau isoform expression of neuronal populations predispose neurons to NFTs? Do NFT maturity levels affect the neuropil surrounding tangle‐burdened neurons? With the accumulated knowledge, we speculate that early events in the lifespan of NFT maturity begin as protective. The maladaptive response leads to an ill‐fated rescue attempt that overwhelms the neuron driving it to form a mature tangle. Neuroimaging biomarkers designed to target NFTs from tissue homogenates likely recognize the middling form whereupon the neuron begins to die. This may result in a lack of binding until sufficient tau has accumulated, which should correlate well with functional and structural changes. Circulating tau markers will likely benefit early diagnostics. As circulating markers do not provide regional specificity, pairing with neuroimaging measures should provide deeper insight as not all AD cases accumulate tau in the expected topographic pattern.

CONCLUSIONS

NFTs exist on a spectrum from early to advanced forms of three distinct, but overlapping, maturity levels (Figure 5). This spectrum spans the intracellular domain to the extracellular space. Pretangles are found in morphologically normal neurons and have a diffuse or granular tau immunostaining pattern that may also be hyperphosphorylated. Mature tangles occur in neurons that may have a dislocated or shrunken nucleus, and are composed of tightly packed fibrils of phosphorylated tau. Ghost tangles occur after the neuron has died, and are composed of loosely packed bundles of fibrils. As NFTs are not static entities, intermediaries of these levels can also be identified in patient tissue. The predominance of tau isoform changes from 4R in pretangles, to 3R/4R in mature tangles, and 3R in ghost tangles. Post‐translational modifications, including phosphorylation, acetylation, glycosylation, and ubiquitination, are present across NFT maturity levels. Truncation and conformational changes of tau occur throughout the lifespan of NFTs, which can be visualized using immunohistochemical techniques (Figure 4). A variety of other staining techniques are used to identify NFT maturity levels, including tinctorial dyes such as H&E and Congo red, and special stains such as silver staining and thioflavin‐S (Figure 4). There is more than 100 years of research on AD, , yet a large gap in knowledge regarding tau and NFTs still exists. It is well known that tau is hyperphosphorylated in AD, but the reason for this event is still unclear. It is also currently unknown why PHFs are not degraded even though they are ubiquitinated. Questions still remain as to whether therapeutic intervention could halt neuropathology at the pretangle level, thereby preventing neuronal death and cognitive decline. Much of our accumulated knowledge regarding NFT maturity derives from the hippocampus and was thus the focus of this review. NFT maturity studies in the entorhinal cortex , and nucleus basalis of Meynert , have greatly informed the biology. Future studies should consider evaluation of these critical areas and evaluation throughout the cortex to examine similarities and differences in the molecular profile of NFT maturities given heterogeneity of cell types. Moreover, the effect of underlying transcript differences that may confer selective vulnerability deserves further investigation in the context of NFT maturity to uncover timing of mRNA changes prior to formation of lesions or as a result. The accumulated knowledge and use of immunohistochemical techniques provides us with the ability to infer the dynamic aspects of NFT pathology. Molecular insights gleaned from animal modeling and postmortem human studies provide a broad perspective of the lifespan of NFT maturity. Coupled with modern biomarker readouts, the future holds great promise for identifying mechanisms of early accumulation of tau pathology that can be targeted prior to structural change and the eventual death of the neuron. Thus, the historic perspective of morphology has provided the basis for our understanding of NFT maturity. Through multi‐disciplinary approaches integrating next generation sequencing and innovative neuropathology techniques, we are well positioned to uncover the meaning of the lifespan of NFTs in AD.

CONFLICTS OF INTEREST

Dr. Moloney reports no disclosures. Dr. Lowe serves as a consultant for Bayer Schering Pharma, Philips Molecular Imaging, Piramal Imaging, AVID Radiopharmaceuticals, Eisai Inc., and GE Healthcare and receives research support from GE Healthcare, Siemens Molecular Imaging, AVID Radiopharmaceuticals, the NIH (NIA, NCI), and the MN Partnership for Biotechnology and Medical Genomics. Dr. Murray served as a paid consultant for AVID Radiopharmaceuticals.
  185 in total

1.  THE FINE STRUCTURE OF NEUROFIBRILLARY TANGLES IN ALZHEIMER'S DISEASE.

Authors:  R D TERRY
Journal:  J Neuropathol Exp Neurol       Date:  1963-10       Impact factor: 3.685

2.  The amino terminus of tau inhibits kinesin-dependent axonal transport: implications for filament toxicity.

Authors:  Nichole E LaPointe; Gerardo Morfini; Gustavo Pigino; Irina N Gaisina; Alan P Kozikowski; Lester I Binder; Scott T Brady
Journal:  J Neurosci Res       Date:  2009-02       Impact factor: 4.164

3.  On the histochemistry of azo group-free thiazole dyes.

Authors:  G Kelényi
Journal:  J Histochem Cytochem       Date:  1967-03       Impact factor: 2.479

4.  Diagnosis of Alzheimer's disease.

Authors:  Z S Khachaturian
Journal:  Arch Neurol       Date:  1985-11

5.  Phosphorylation affects the ability of tau protein to promote microtubule assembly.

Authors:  G Lindwall; R D Cole
Journal:  J Biol Chem       Date:  1984-04-25       Impact factor: 5.157

6.  Tau cleavage and dephosphorylation in cerebellar granule neurons undergoing apoptosis.

Authors:  N Canu; L Dus; C Barbato; M T Ciotti; C Brancolini; A M Rinaldi; M Novak; A Cattaneo; A Bradbury; P Calissano
Journal:  J Neurosci       Date:  1998-09-15       Impact factor: 6.167

7.  Cloning and sequencing of the cDNA encoding a core protein of the paired helical filament of Alzheimer disease: identification as the microtubule-associated protein tau.

Authors:  M Goedert; C M Wischik; R A Crowther; J E Walker; A Klug
Journal:  Proc Natl Acad Sci U S A       Date:  1988-06       Impact factor: 11.205

8.  Detection of Alzheimer Disease (AD)-Specific Tau Pathology in AD and NonAD Tauopathies by Immunohistochemistry With Novel Conformation-Selective Tau Antibodies.

Authors:  Garrett S Gibbons; Rachel A Banks; Bumjin Kim; Lakshmi Changolkar; Dawn M Riddle; Susan N Leight; David J Irwin; John Q Trojanowski; Virginia M Y Lee
Journal:  J Neuropathol Exp Neurol       Date:  2018-03-01       Impact factor: 3.685

Review 9.  Amyloid-beta: a crucial factor in Alzheimer's disease.

Authors:  Saeed Sadigh-Eteghad; Babak Sabermarouf; Alireza Majdi; Mahnaz Talebi; Mehdi Farhoudi; Javad Mahmoudi
Journal:  Med Princ Pract       Date:  2014-11-27       Impact factor: 1.927

10.  Autoradiography validation of novel tau PET tracer [F-18]-MK-6240 on human postmortem brain tissue.

Authors:  Cinthya Aguero; Maeva Dhaynaut; Marc D Normandin; Ana C Amaral; Nicolas J Guehl; Ramesh Neelamegam; Marta Marquie; Keith A Johnson; Georges El Fakhri; Matthew P Frosch; Teresa Gomez-Isla
Journal:  Acta Neuropathol Commun       Date:  2019-03-11       Impact factor: 7.801

View more
  19 in total

1.  CSF phosphorylated tau as an indicator of subsequent tau accumulation.

Authors:  Petrice M Cogswell; Heather J Wiste; Michelle M Mielke; Christopher G Schwarz; Stephen D Weigand; Val J Lowe; Terry M Therneau; David S Knopman; Jonathan Graff-Radford; Prashanthi Vemuri; Matthew L Senjem; Jeffrey L Gunter; Alicia Algeciras-Schimnich; Ronald C Petersen; Clifford R Jack
Journal:  Neurobiol Aging       Date:  2022-05-26       Impact factor: 5.133

2.  Alterations in a cross-hemispheric circuit associates with novelty discrimination deficits in mouse models of neurodegeneration.

Authors:  Chinnakkaruppan Adaikkan; Jun Wang; Karim Abdelaal; Steven J Middleton; P Lorenzo Bozzelli; Ian R Wickersham; Thomas J McHugh; Li-Huei Tsai
Journal:  Neuron       Date:  2022-08-19       Impact factor: 18.688

3.  Conserved age-related increases in hippocampal PDE11A4 cause unexpected proteinopathies and cognitive decline of social associative memories.

Authors:  Katy Pilarzyk; Latarsha Porcher; William R Capell; Steven D Burbano; Jeff Davis; Janet L Fisher; Nicole Gorny; Siena Petrolle; Michy P Kelly
Journal:  Aging Cell       Date:  2022-09-08       Impact factor: 11.005

4.  Truncated Tau caused by intron retention is enriched in Alzheimer's disease cortex and exhibits altered biochemical properties.

Authors:  Zhen-Kai Ngian; Yow-Yong Tan; Ching-Thong Choo; Wei-Qi Lin; Chao-Yong Leow; Shan-Jie Mah; Mitchell Kim-Peng Lai; Christopher Li-Hsian Chen; Chin-Tong Ong
Journal:  Proc Natl Acad Sci U S A       Date:  2022-09-06       Impact factor: 12.779

Review 5.  Aging: What We Can Learn From Elephants.

Authors:  Daniella E Chusyd; Nicole L Ackermans; Steven N Austad; Patrick R Hof; Michelle M Mielke; Chet C Sherwood; David B Allison
Journal:  Front Aging       Date:  2021-08-26

Review 6.  The Brilliance of the Zebrafish Model: Perception on Behavior and Alzheimer's Disease.

Authors:  Avinash Shenoy; Meheli Banerjee; Archana Upadhya; Siddhi Bagwe-Parab; Ginpreet Kaur
Journal:  Front Behav Neurosci       Date:  2022-06-13       Impact factor: 3.617

7.  Evidence of traumatic brain injury in headbutting bovids.

Authors:  Nicole L Ackermans; Merina Varghese; Terrie M Williams; Nicholas Grimaldi; Enna Selmanovic; Akbar Alipour; Priti Balchandani; Joy S Reidenberg; Patrick R Hof
Journal:  Acta Neuropathol       Date:  2022-05-17       Impact factor: 15.887

Review 8.  The informed road map to prevention of Alzheimer Disease: A call to arms.

Authors:  Eric McDade; Jorge J Llibre-Guerra; David M Holtzman; John C Morris; Randall J Bateman
Journal:  Mol Neurodegener       Date:  2021-07-21       Impact factor: 14.195

9.  Bezafibrate Exerts Neuroprotective Effects in a Rat Model of Sporadic Alzheimer's Disease.

Authors:  Li-Fan Lin; Yun-Ting Jhao; Chuang-Hsin Chiu; Lu-Han Sun; Ta-Kai Chou; Chyng-Yann Shiue; Cheng-Yi Cheng; Kuo-Hsing Ma
Journal:  Pharmaceuticals (Basel)       Date:  2022-01-18

Review 10.  Tau Seeding Mouse Models with Patient Brain-Derived Aggregates.

Authors:  Aiko Robert; Michael Schöll; Thomas Vogels
Journal:  Int J Mol Sci       Date:  2021-06-07       Impact factor: 5.923

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.