| Literature DB >> 33715301 |
Khadija Daoudi1,2, Christian Malosse3, Ayoub Lafnoune1,2, Bouchra Darkaoui1,2, Salma Chakir1, Jean-Marc Sabatier4, Julia Chamot-Rooke3, Rachida Cadi2, Naoual Oukkache1.
Abstract
Buthus occitanus (B. occitanus) is one of the most dangerous scorpions in the world. Despite the involvement of B. occitanus scorpion in severe cases of envenomation in Morocco, no study has focused yet on the proteomic composition of the Moroccan B. occitanus scorpion venom. Mass spectrometry-based proteomic techniques are commonly used in the study of scorpion venoms. The implementation of top-down and bottom-up approaches for proteomic analyses facilitates screening by allowing a global view of the structural aspects of such complex matrices. Here, we provide a partial overview of the venom of B. occitanus scorpion, in order to explore the diversity of its toxins and hereafter understand their effects. To this end, a combination of top-down and bottom-up approaches was applied using nano-high liquid chromatography coupled to nano-electrospray tandem mass spectrometry (nano-LC-ESI MS/MS). The LC-MS results showed that B. occitanus venom contains around 200 molecular masses ranging from 1868 to 16 720 Da, the most representative of which are those between 5000 and 8000 Da. Interestingly, combined top-down and bottom-up LC-MS/MS results allowed the identification of several toxins, which were mainly those acting on ion channels, including those targeting sodium (NaScTxs), potassium (KScTxs), chloride (ClScTxs), and calcium channels (CaScTx), as well as antimicrobial peptides (AMPs), amphipathic peptides, myotropic neuropeptides, and hypothetical secreted proteins. This study reveals the molecular diversity of B. occitanus scorpion venom and identifies components that may have useful pharmacological activities.Entities:
Keywords: Buthus occitanus scorpion; bottom-up; top-down; toxins; venom; venomic
Mesh:
Substances:
Year: 2021 PMID: 33715301 PMCID: PMC8255848 DOI: 10.1002/2211-5463.13143
Source DB: PubMed Journal: FEBS Open Bio ISSN: 2211-5463 Impact factor: 2.693
Fig. 1Experimental workflow performed in this study. At first, B. occitanus venom was milked by electrical stimulation and applied to a 30 kDa filter. For the top‐down venomic, the flow‐through containing toxins < 30 kDa was analyzed by the Thermo Scientific ™ Orbitrap Fusion Lumos Tribrid Mass Spectrometer. For the bottom‐up approach, two digest methods were achieved: 1) in‐solution digestion, the flow‐through containing toxin < 30 kDa was directly reduced with DTT, alkylated with IAA, and digested with trypsin; and 2) in‐gel digestion, the unstained gel was excised to small cubes, reduced, alkylated, and digested. The digest peptides were then desalted with ZipTip and applied to the Orbitrap Q‐Exactive mass spectrometer.
Fig. 2TIC of native B. occitanus venom filtrate, generated from top‐down mass spectrometry analysis (MS1). The x‐axis represents the relative abundance (%), and the y‐axis, the retention time (min). Spectra were deconvoluted, and generated monoisotopic masses were distributed according to their MW.
List of the 197 monoisotopic masses detected by the top‐down LC‐MS analysis.
| Retention time (min) | MW (Da) |
|---|---|
| 0–10 | N.D |
| 10–20 | 1868.0157 |
| 20–30 | 2208.2634; 2506.4634 |
| 30–40 | 2813.4212; 2851.4287; 2966.3848; 3124.4545; 3219.5691; 3233.4756; 3461.4966; 3486.7774;3538.283; 3550.4334; 3670.8935; 3718.7023; 3823.4412; 3937.8078; 4093.8732; 4321.8654; 4366.9752; 4366.986; 5731.6152; 5919.5155. |
| 40–50 | 3522.2898;3614.8741; 3807.4466; 3937.7725; 4333.933; 4366.9856; 4568.7172; 4572.9253; 5185.3781; 6148.8879; 6423.7104; 6439.6786; 6527.7246; 6539.6502; 6541.7326; 6595.7719; 6606.8166; 6610.768; 6611.7946; 6635.0442; 6744.712; 6829.8098; 6831.8926; 6832.876; 6860.9183; 6861.9012; 6872.9404; 6876.9037; 6877.9284; 6893.9821; 6940.948; 6952.1809; 6974.2357; 6979.0052; 6995.0399; 6997.024; 7014.2508; 7016.0204; 7022.0148; 7024.0653; 7107.2902; 7152.0763; 7162.3796; 7177.1647; 7218.3026; 7220.0387; 7220.2052; 7243.2414; 7297.2395; 7393.2604. |
| 50–60 | 6488.9021; 6609.8127; 6611.7977; 6629.8447; 6677.8651; 6749.8876; 6765.9533; 6779.2433;6807.922; 6823.1194; 6836.974; 6837.8837; 6862.9698; 6879.9966; 6907.3347; 6919.9628; 6972.7789; 7007.0404; 7011.1444; 7012.1231; 7020.055; 7028.0976; 7035.2491; 7024.1049; 7051.0799; 7061.1245; 7062.1114; 7069.1111; 7079.1299; 7082.3444; 7115.0302; 7115.2113; 7122.274; 7130.9674; 7143.0368; 7250.1077; 7262.1172; 7266.1721; 7268.152; 7283.1496; 7307.2070; 7328.1353; 7394.3224; 7394.5252; 7400.289; 7416.5358; 7435.2763; 7449.3831; 7468.4297; 7491.1348; 7506.1972; 7534.4067; 7607.5077; 7681.4621; 7777.5363; 7840.6401; 7894.5677; 7912.5297; 7924.5736; 7943.5256; 8174.6428; 8344.5958; 9875.9204; 6896.9694; 6880.9937; 7016.998; 7056.1905; 7074.1478; 7104.0354; 7122.2913; 7115.9848; 7175.0715; 7309.2612; 7414.4224; 7600.5; 7654.5083; 7798.6334; 7817.6424; 7832.6366; 7833.6635; 8140.6441; 8159.4822; 8345.5484; 9959.0054; 11068.3376; 11243.5823;16720.7335. |
| 60–70 | 6896.9694; 6880.9937; 7016.998; 7056.1905; 7074.1478; 7104.0354; 7122.2913; 7115.9848; 7175.0715; 7309.2612; 7414.4224; 7600.5; 7654.5083; 7798.6334; 7817.6424; 7832.6366; 7833.6635; 8140.6441; 8159.4822; 8345.5484; 9959.0054; 11068.3376; 16720.7335. |
| 70–80 | 6809.9307; 6857.9428; 6859.9368; 6865.9432; 6875.9565; 6880.9796; 6982.0159; 6913.9378; 7009.0523; 7104.9914; 7172.1987; 7200.1528; 7214.1558; 7316.2804; 7377.2599; 7300.0933; 7394.5084. |
| 80–90 | 7377.2678; 7301.1747; 9140.1069; 11377.1636; 12971.6074; 13004.7435. |
| 90–100 | 7390.4025; 7466.4483; 7482.4543; 7500.4753; 7704.4655; 7791.5128; 7792.5813; 8672.6993; 8882.0067; 8978.0645; 14577.4253. |
| 100–110 | 9302.1043; 12990.2825; 12985.6009. |
| 110–120 | N.D |
N.D: not determined.
Fig. 3Molecular mass distribution of the monoisotopic masses from MS1 spectra deconvolution. 197 components were detected, with their MW ranging from 1868 to 16 720 Da. These peptides distributed from 1000 to 17 000 Da with 1000 Da mass range windows. The x‐axis represents the MW in Da, and the y‐axis represents the percentage (%) based on total number counts.
List of the identified peptides by top‐down analysis of the reduced/alkylated B. occitanus venom filtrate. Data sets generated from the mass spectrometer were analyzed by the proteome discover 2.2 software, against UniProtKB/Swiss‐Prot database. The amino acids sequences colored in black were those detected by the analysis. Peptide entries in bold were identified by both top‐down and bottom‐up approaches.
| Category | Accession | Description | Identified Sequence | Coverage (%) | Measured MW (Da) | No. of peptides | No. of PSMs | No. of unique peptides | No. of protein groups | No. of AAs | calc.pI |
|---|---|---|---|---|---|---|---|---|---|---|---|
| NaScTx | P59356 | Alpha‐like toxin Lqh6 |
DGVKCHK | 98.46 | 6974.21 | 1 | 4 | 1 | 1 | 65 | 6.48 |
|
| Alpha‐like toxin Bom3 |
VPIVVGGEKCH | 98.5 | 7012.14 | 1 | 1 | 1 | 1 | 67 | 6.71 | |
| P56678 | Alpha‐like toxin Lqh3 |
GIIVEGEKCHS | 98.52 | 7215.31 | 1 | 22 | 1 | 1 | 68 | 6.48 | |
| Q9NJC4 | Chain (toxin BmKaTx17) [10–73] in toxin BmKaTx17 |
INLPDDKPIRIPGKC | 84 | 7062.13 | 1 | 1 | 1 | 1 | 75 | 7.58 | |
| Q4TUA4 | Chain (alpha‐toxin 4) [20–85] in alpha‐toxin 4 |
GVYGNACWCYKLPDKVPIRVPGRCNGG | 77.64 | 7218.31 | 1 | 1 | 0 | 0 | 85 | 7.5 | |
|
| Beta‐toxin BotIT2 |
TNTC | 98.36 | 6564.78 | 1 | 1 | 1 | 1 | 61 | 4.84 | |
| P60163 | Toxin Cg2 |
IPG | 88.4 | 6871.92 | 1 | 1 | 1 | 1 | 69 | 6.92 | |
| P60256 | Toxin Boma6b |
KVEGKCHRK | 98.5 | 7307.23 | 1 | 4 | 1 | 1 | 67 | 7.2 | |
|
| Chain(beta‐insect excitatory toxin BmK IT‐AP) [19–90] in beta‐insect excitatory toxin BmK IT‐AP |
YCFGLADDKPVLDIWDSTKNYCDVQIID | 80 | 7943.53 | 2 | 6 | 2 | 1 | 90 | 5.36 | |
|
| Toxin AaHIT4 |
NYKTNKCDL | 98.48 | 7791.58 | 1 | 6 | 1 | 1 | 66 | 8.46 | |
| P80962 | Beta‐insect depressant toxin BaIT2 |
MDGYIRRRDGCKVSCLFGNEGCDKECKAYGGSYGYCWTWGLACWCEGLPDDKTWKS ETNTCG | 100 | 6845.9 | 1 | 4 | 1 | 1 | 62 | 5.31 | |
|
| Alpha‐mammal toxin Bot3; chain (alpha‐mammal toxin Bot3) [10–73] in alpha‐mammal toxin Bot3 |
YKVPDHVRTKGPGRCN | 87.67 | 7289.18 | 1 | 5 | 1 | 1 | 73 | 7.53 | |
| Q86BW9 | Chain (Makatoxin‐2) [20–83] in Makatoxin‐2 |
RYGNACWCIDLPDKVPIRIPGPCR | 75.29 | 7062.11 | 1 | 4 | 1 | 1 | 85 | 5.25 | |
| G4V3T9 | Neurotoxin BmK AGAP‐SYPU2 |
PIRVPGRCNG | 98.48 | 7289.18 | 1 | 6 | 1 | 1 | 66 | 5.31 | |
| P84614 | Alpha‐toxin Bs‐Tx28 |
PIRIPGKCR | 98.48 | 7214.2 | 1 | 1 | 1 | 1 | 66 | 8.12 | |
| Q9BLM4 | Toxin AahP1005; Chain (toxin AahP1005) [20–83] in toxin AahP1005 |
SPYGNACYCYKLPDRVSTKKKGGCN | 75.29 | 7316.26 | 1 | 3 | 1 | 1 | 85 | 8.46 | |
| P86408 | Neurotoxin MeuNaTx‐1 |
VPIKVSGKCN | 98.46 | 7218.31 | 1 | 6 | 1 | 1 | 65 | 7.85 | |
|
| Toxin Boma6a |
PIKVEGKCHRK | 98.5 | 7221.18 | 1 | 12 | 1 | 1 | 67 | 7.09 | |
| P15225 | Neurotoxin Os3 |
VGVIVDGEKC | 98.52 | 6957.15 | 2 | 6 | 2 | 1 | 68 | 6.71 | |
| P45697 | Alpha‐like toxin BmK‐M1; Chain (alpha‐like toxin BmK‐M1) [20–83] in alpha‐like toxin BmK‐M1 |
GKYGNGCWCIELPDNVPIRVPGKCH | 76.19 | 7429.4 | 1 | 4 | 1 | 1 | 84 | 7.88 | |
| E4VP24 | Chain [20–85] in sodium channel neurotoxin MeuNaTxalpha‐1 |
AGQYGNACWCYKLPDKVPIKVSGKCNGR | 77.64 | 7336.32 | 1 | 1 | 1 | 1 | 85 | 7.85 | |
|
| Alpha‐insect toxin BotIT1 |
PIRIPGKCHS | 98.48 | 7345.15 | 1 | 2 | 1 | 1 | 66 | 7.55 | |
| E7CAU3 | Chain (neurotoxin BmK AGP‐SYPU1) [2–65] in neurotoxin BmK AGP‐SYPU1 |
CINLPDDKPIRIPGKCHRR | 98.5 | 7488.32 | 2 | 8 | 2 | 1 | 67 | 7.61 | |
| Q1I178 | Toxin Td9 |
LACYCYNMPNWAPIWNSATNSCGKGK | 86.48 | 7076.01 | 1 | 2 | 1 | 1 | 74 | 7.84 | |
| A0A146CJ90 | Chain [20–87] in Venom toxin meuNa32 |
SGYCQIFGKYGNACWCIDLPDKVPIRIPGKCHFA | 78.16 | 7690.37 | 1 | 1 | 1 | 1 | 87 | 7.53 | |
| P68410 | Alpha‐mammal toxin Ts2 |
PDHIKVWDYATNKC | 98.41 | 6655.84 | 1 | 6 | 1 | 1 | 63 | 7.61 | |
| P68726 | Chain (Insect toxin 2–53) [22–82] in Insect toxin 2–53 |
GYCWTWGLACWCEGLPDDKTWKSETNTCG | 71.76 | 6739.87 | 1 | 1 | 1 | 1 | 85 | 7.5 | |
| Q1I163 | Toxin Td8; chain (toxin Td8) [21–83] in toxin Td8 |
GKDGYCYAWLACYCYNMPNWAPIWNSATNRCR | 73.25 | 6986.05 | 1 | 3 | 1 | 1 | 86 | 8.34 | |
| P56569 | Makatoxin‐1 |
DLPDKVPIRISGSCR | 98.46 | 7240.24 | 1 | 2 | 0 | 0 | 65 | 7.5 | |
| D8UWD3 | Sodium channel neurotoxin MeuNaTxalpha‐7 |
YKLPDKVPIKVSGKCNGR | 98.5 | 7295.24 | 1 | 1 | 1 | 1 | 67 | 8.1 | |
| P0DMH9 | Chain (alpha‐toxin BmalphaTx47) [20–83] in alpha‐toxin BmalphaTx47 |
YCQWAGRYGNACWCIDLPDKVPIRISGSCR | 75.29 | 7240.24 | 1 | 1 | 0 | 0 | 85 | 7.87 | |
| P01483 | Neurotoxin Bot2 |
IDLPDKVPIRIEGKCHF | 98.48 | 7240.24 | 1 | 19 | 1 | 1 | 66 | 7.55 | |
|
| Chain (alpha‐insect toxin LqhaIT) [20–85] in alpha‐insect toxin LqhaIT |
GYCQWAGKYGNACWCYALPDNVPIRVPGKCHRK | 77.64 | 7173.2 | 1 | 12 | 1 | 1 | 85 | 8.12 | |
| P01496 | Chain (toxin‐3) [15–76] in toxin‐5 |
CYWVHILCYCYGLPDSEPTKTNGKC | 76.54 | 7105.03 | 1 | 20 | 1 | 1 | 81 | 7.49 | |
| Q1EG64 | Chain [20–85] in sodium toxin peptide BmKTb' |
GSCPYLGEHKFACYCKDLPDNVPIRVPGKCNGG | 77.64 | 7321.09 | 1 | 2 | 1 | 1 | 85 | 7.58 | |
|
| alpha‐toxin Bot1 |
KDLPDNVPIRIPGKCHF | 98.48 | 7074.14 | 1 | 3 | 1 | 1 | 66 | 6.92 | |
|
| Chain (neurotoxin BmK‐M9) [15–78] in neurotoxin BmK‐M9 |
GGRYGNACWCIKLPDRVPIRVPGKCH | 81.01 | 7015.19 | 1 | 1 | 1 | 1 | 79 | 7.88 | |
|
| Toxin Lqh4 |
IKLPDKVPIRIPGKCR | 98.48 | 7155.25 | 1 | 3 | 1 | 1 | 66 | 8.1 | |
| P01487 | Alpha‐insect toxin Lqq3 |
YALPDNVPIRVPGKCH | 98.5 | 6980.01 | 2 | 12 | 2 | 1 | 65 | 7.87 | |
| H1ZZI7 | Toxin Tpa6 |
DGKCDGWNSCYCFKVPDHIPVWGDPGTKPC | 74.41 | 7059.12 | 1 | 2 | 1 | 1 | 86 | 5.38 | |
| B8XGY6 | Chain [20–85] in Putative alpha‐toxin Tx17 |
CQWVGKYGNGCWCYALPDNVPIRVPGKCHSR | 77.64 | 7313.2 | 1 | 2 | 1 | 1 | 85 | 7.87 | |
|
| Insect toxin AaHIT5 |
KAWKSETNTCD | 98.38 | 6894.89 | 1 | 8 | 1 | 1 | 62 | 4.83 | |
| P68722 | Chain (beta‐insect excitatory toxin LqhIT1b) [19–88] in beta‐insect excitatory toxin LqhIT1b |
GYCCLLSCYCFGLNDDKKVLEISDTTKKYCDFTIIN | 79.54 | 7924.56 | 1 | 1 | 1 | 1 | 88 | 7.87 | |
| P60257 | Toxin Boma6c |
ALPDNVPIRIPGKCHR | 98.5 | 7308.21 | 2 | 14 | 2 | 1 | 67 | 8.31 | |
| M1J7U4 | Putative sodium channel alpha‐toxin Acra5 |
PDDVPVYGDRGVICRTR | 98.52 | 7741.51 | 1 | 1 | 1 | 1 | 68 | 7.5 | |
| Q9N682 | Chain (neurotoxin BmK‐M11) [20–83] in neurotoxin BmK‐M11 |
YCQWGGKYGNACWCIKLPDDVPIRVPGKCHR | 77.38 | 7179.21 | 2 | 2 | 2 | 1 | 84 | 7.09 | |
| P55903 | beta‐insect depressant toxin BotIT4 |
MDGYIRRRDGCKVSCLFGNEGCDKECKAYGGSYGYCWTWGLACWCEGLPDD KTWKSETNTCG | 100 | 6837.96 | 1 | 4 | 1 | 1 | 62 | 5.31 | |
| A0A0K0LBU9 | Chain [20–83] in sodium channel blocker AbNaTx26 |
WKLACWCDNIHDWVPTWSYATTKCRAK | 77.1 | 7505.2 | 1 | 1 | 1 | 1 | 83 | 8.31 | |
| P0C910 | Alpha‐toxin Amm3 |
PIKDPNDDCHK | 98.46 | 7011.14 | 1 | 1 | 1 | 1 | 65 | 7.09 | |
|
| Neurotoxin BmK‐II |
VRDAYIAKPHNCVYECARNEYCNDLCTKDGAKSGYCQWVGKYGNGCWCIELPDNV PIRIPGNCH | 100 | 7431.33 | 2 | 14 | 2 | 1 | 65 | 7.09 | |
| P81240 | Insect toxin LqhIT5 |
MDGYIRGGDGCKVSCVIDHVFCDNECKAAGGSYGYCWGWGLACWCEGLPADREWK YETNTCG | 100 | 6611,8 | 1 | 3 | 1 | 1 | 62 | 4.72 | |
| P01497 | Chain (beta‐insect excitatory toxin 1) [19–88] in beta‐insect excitatory toxin 1 |
SCYCFGLNDDKKVLEISDTRKSYCDTTIIN | 79.54 | 7928.54 | 1 | 10 | 1 | 1 | 88 | 7.53 | |
| V9P3B8 | Chain [23–82] in Chain [23–82] in Meutoxin‐3 |
FCRQPHCFCADMPDDYPTRPTTR | 73.17 | 7074.13 | 1 | 1 | 1 | 1 | 82 | 4.75 | |
| Q8T3T0 | Depressant insect toxin BmK ITa1 |
TWGLACWCEGLPDDKTWKSESNTC | 71.76 | 6632.71 | 1 | 18 | 1 | 1 | 85 | 6.38 | |
| Q9GQW3 | Chain (toxin BmKaIT1) [20–83] in toxin BmKaIT1 |
LGEHKFACYCKDLPDNVPIRVPGKC | 75.29 | 7012.23 | 1 | 3 | 1 | 1 | 85 | 8.12 | |
| Q95WX6 | Beta‐insect depressant toxin BmKITb |
TWGLACWCQGLPDDKTWKSESNTCG | 71.76 | 6775.93 | 1 | 4 | 1 | 1 | 85 | 7.85 | |
| P0C5H1 | Beta‐toxin Isom1 |
DTRKKYCDYTIIN | 98.59 | 7895.47 | 1 | 35 | 1 | 1 | 71 | 7.53 | |
| Q9GNG8 | Toxin BmKaTX15 |
AGVYGNACWCYKLPDKVPIRVPGKCNGG | 77.64 | 7211.14 | 1 | 1 | 1 | 1 | 85 | 6.4 | |
|
| Sodium channel alpha‐toxin Acra8 |
PIKEKGRCNGR | 98.5 | 7218.3 | 1 | 1 | 1 | 1 | 67 | 8.29 | |
| A0A0U4RDS7 | Chain [20–87] in sodium channel toxin NaTx4 |
SGHGSAWWCNDLPDKEGIIVDGKGCTR | 78.16 | 7243.29 | 2 | 4 | 2 | 1 | 87 | 7.66 | |
| P82814 | Insect toxin BsIT4 |
MDGYIKGNKGCKVSCVINNVFCNSMCKSSGGSYGYCWSWGLACWCEGLPAAKKWLY AATNTCG | 100 | 6954.15 | 1 | 1 | 1 | 1 | 63 | 8.31 | |
| B8XGX9 | Chain [20–87] in Putative alpha‐toxin Tx2 |
WLGQYGNACWCIKLPDRVPIRIPGKCRG | 78.16 | 7394.28 | 1 | 3 | 1 | 1 | 87 | 7.5 | |
|
| Alpha‐insect toxin Bot14 |
KSGHGSACWCKDLPDKVGIIVHGEKCHR | 78.82 | 7184.3 | 1 | 5 | 1 | 1 | 85 | 8.5 | |
| KScTx | A0A059UI30 | Chain (potassium channel toxin Meg‐beta‐KTx1) [28–91] in potassium channel toxin Meg‐beta‐KTx1 |
YQGYCDDHCQDIKKQEGFCHGFKCKCGIPMGF | 70.32 | 6889.3 | 1 | 9 | 1 | 1 | 91 | 8.76 |
|
| Potassium channel toxin BmTXK‐beta‐2 |
| 25.27 | 2506.46 | 1 | 1 | 1 | 1 | 91 | 8.57 | |
| AMP | A0A0A1I6E7 | AMP AcrAP1 |
| 24.32 | 1959.13 | 1 | 1 | 1 | 1 | 74 | 9.31 |
| Myotropic neuropeptide | F8THJ9 | Putative orcokinin |
| 16.96 | 3112.45 | 1 | 1 | 1 | 1 | 165 | 9.29 |
| Hypothetical secreted protein | F1CIZ9 | Hypothetical secreted protein |
TDFNSWNDKFRPGKK | 25.75 | 3939.79 | 1 | 1 | 1 | 1 | 132 | 7.99 |
Fig. 4The detected amino acid sequences of the five toxins identified with 100% coverage by the top‐down LC‐MS/MS; neurotoxin BmK‐II (P59360); beta‐insect depressant toxin BaIT2 (P80962); insect toxin BsIT4 (P82814); insect toxin LqhIT5 (P81240); and beta‐insect depressant toxin BotIT4 (P55903).
Fig. 5(A) Relative abundance of the different peptide categories identified in reduced/alkylated B. occitanus venom filtrate by the top‐down LC‐MS/MS analysis. Peptides were divided on the basis of their molecular functions into: neurotoxins active on sodium channels (NaScTxs), neurotoxins active on potassium channels (KScTxs), myotropic neuropeptide, AMP, and hypothetical secreted protein. (B) Relative abundance of the different peptide categories identified in reduced/alkylated and digested B. occitanus venom by bottom‐up LC‐MS/MS analysis. The peptides were divided on the basis of their molecular functions into: neurotoxins active on sodium channels (NaScTxs), neurotoxins active on potassium channels (KScTxs), neurotoxins active on chloride channels (ClScTxs), neurotoxins active on calcium channels (CaScTx), toxin Acra, and amphipathic peptide.
Bottom‐up data generated from in‐gel digestion of B. occitanus venom filtrate using nano‐LC‐MS/MS. Data sets generated from the mass spectrometer were analyzed by the proteome discover 2.2 software, against UniProtKB/Swiss‐Prot database.
| Category | Accession | Description | Score | Coverage | No. of proteins | No. of unique peptides | No. of peptides | No. of PSMs | No. of AAs | MW [kDa] | calc. pI |
|---|---|---|---|---|---|---|---|---|---|---|---|
| NaScTx |
| Toxin Aam2 OS = | 198.74 | 24.42% | 9 | 2 | 3 | 6 | 86 | 9.3 | 7.87 |
|
| Toxin AaHIT4 OS = | 85.81 | 29.23% | 2 | 1 | 2 | 5 | 65 | 7.8 | 8.46 | |
|
| Alpha‐like toxin Bom3 OS = | 169.75 | 56.06% | 2 | 3 | 3 | 15 | 66 | 6.9 | 6.71 | |
|
| Beta‐insect excitatory toxin LqhIT1a OS = | 54.81 | 10.23% | 2 | 1 | 2 | 3 | 88 | 9.9 | 8.09 | |
|
| Alpha‐toxin Bu1 OS = | 346.32 | 71.64% | 1 | 3 | 5 | 7 | 67 | 7.5 | 8.48 | |
| P86406 | Neurotoxin MeuNaTx‐6 OS = | 134.56 | 15.15% | 3 | 1 | 1 | 4 | 66 | 7.8 | 7.87 | |
|
| Toxin Lqh4 OS = | 305.53 | 46.15% | 8 | 1 | 3 | 7 | 65 | 7.2 | 8.1 | |
|
| Alpha‐toxin Lqq4 OS = | 531.95 | 86.15% | 9 | 2 | 5 | 11 | 65 | 7.2 | 8.1 | |
|
| Alpha‐toxin Bot11 OS = | 106.19 | 35.38% | 7 | 1 | 3 | 7 | 65 | 7.5 | 7.87 | |
|
| Toxin Boma6a OS = | 65.84 | 15.15% | 2 | 1 | 1 | 2 | 66 | 7.5 | 7.09 | |
|
| Alpha‐insect toxin LqhaIT OS = | 174.28 | 31.76% | 4 | 1 | 2 | 3 | 85 | 9.6 | 8.12 | |
|
| Neurotoxin 8 (Fragment) OS = | 202.83 | 72.22% | 2 | 2 | 2 | 4 | 36 | 4.1 | 6.24 | |
|
| Alpha‐insect toxin BotIT1 OS = | 211.59 | 41.54% | 2 | 1 | 2 | 4 | 65 | 7.3 | 7.55 | |
|
| Alpha‐toxin Bot1 OS = | 136.52 | 20.00% | 1 | 1 | 1 | 2 | 65 | 7.3 | 6.92 | |
|
| Insect toxin AaHIT5 OS = | 51.44 | 24.59% | 1 | 1 | 1 | 2 | 61 | 6.9 | 4.83 | |
|
| Beta‐toxin BotIT2 OS = | 109.66 | 43.33% | 1 | 2 | 2 | 3 | 60 | 6.9 | 4.84 | |
|
| Alpha‐insect toxin Bot14 OS = | 44.99 | 18.82% | 1 | 1 | 1 | 3 | 85 | 9.2 | 8.5 | |
| D5HR52 | Alpha‐toxin Ac3 (Fragment) OS = | 139.86 | 63.77% | 10 | 2 | 4 | 10 | 69 | 7.8 | 7.87 | |
| P55904 | Beta‐insect depressant toxin BotIT5 OS = | 64.67 | 27.87% | 21 | 2 | 2 | 9 | 61 | 6.8 | 5.31 | |
|
| Beta‐insect excitatory toxin BmK IT‐AP OS = | 126.26 | 17.78% | 8 | 2 | 2 | 4 | 90 | 10.2 | 5.36 | |
|
| Beta‐insect depressant toxin BotIT6 OS = | 32.37 | 11.29% | 1 | 1 | 1 | 1 | 62 | 7.3 | 8.1 | |
| P68723 | Beta‐insect excitatory toxin LqhIT1c OS = | 182.31 | 11.36% | 1 | 2 | 3 | 8 | 88 | 9.9 | 8.1 | |
|
| Neurotoxin BmK‐II OS = | 48.26 | 15.63% | 3 | 1 | 1 | 1 | 64 | 7.2 | 7.09 | |
| P15224 | Toxin Os1 OS = | 39.14 | 19.70% | 1 | 1 | 1 | 1 | 66 | 7.6 | 7.88 | |
| D5HR50 | Alpha‐toxin Ac1 (Fragment) OS = | 37.66 | 11.11% | 2 | 1 | 1 | 2 | 81 | 8.7 | 7.55 | |
| M1JMR8 | Sodium channel alpha‐toxin Acra8 OS = | 66.82 | 40.91% | 3 | 2 | 3 | 5 | 66 | 7.5 | 8.29 | |
| M1JBC0 | Sodium channel alpha‐toxin Acra4 OS = | 37.39 | 29.23% | 1 | 1 | 2 | 4 | 65 | 7.1 | 8.31 | |
| KScTx | P0C161 | Potassium channel toxin alpha‐KTx 2.8 OS = | 45.57 | 17.95% | 2 | 1 | 1 | 1 | 39 | 4.3 | 8.94 |
|
| Potassium channel toxin BmTXK‐beta OS = | 264.78 | 23.33% | 2 | 1 | 2 | 6 | 90 | 10.4 | 8.82 | |
| P59869 | Potassium channel toxin alpha‐KTx 5.4 OS = | 40.7 | 22.58% | 2 | 1 | 2 | 2 | 31 | 3.5 | 8.02 | |
| B8XH40 | Potassium channel toxin BuTXK‐beta OS = | 298.65 | 42.86% | 2 | 2 | 5 | 18 | 91 | 10.2 | 8.57 | |
|
| Potassium channel toxin BmTXK‐beta‐2 OS = | 230.62 | 42.86% | 2 | 1 | 4 | 13 | 91 | 10.2 | 8.57 | |
| B3EWX9 | Potassium channel toxin alpha‐KTx 9.11 OS = | 85.33 | 40.74% | 4 | 1 | 1 | 2 | 27 | 2.9 | 5.01 | |
| B8XH42 | Potassium channel toxin alpha‐KTx 16.6 OS = | 23.25 | 12.07% | 1 | 1 | 1 | 1 | 58 | 6.5 | 8.12 | |
| ClScTx |
| Chlorotoxin OS = | 41.56 | 38.89% | 1 | 1 | 1 | 3 | 36 | 4 | 8.13 |
|
| Chlorotoxin‐like peptide OS = | 290.9 | 44.12% | 1 | 1 | 1 | 7 | 34 | 3.6 | 8.34 |
Underlined peptide entries were identified by in‐gel and in‐solution digestion methods.
Bottom‐up data generated from in‐solution digestion of B. occitanus venom filtrate using nano‐LC‐MS/MS. Data sets generated from the mass spectrometer were analyzed by the proteome discover 2.2 software, against UniProtKB/Swiss‐Prot database.
| Category | Accession | Description | Score | Coverage | No. of proteins | No. of unique peptides | No. of peptides | No. of PSMs | No. of AAs | MW (kDa) | calc. pI |
|---|---|---|---|---|---|---|---|---|---|---|---|
| NaScTxs |
| Toxin Aam2 OS = | 250.68 | 24.42% | 8 | 2 | 4 | 15 | 86 | 9.3 | 7.87 |
|
| Toxin AaHIT4 OS = | 192.23 | 30.77% | 2 | 2 | 3 | 12 | 65 | 7.8 | 8.46 | |
| P01482 | Alpha‐toxin Amm5 OS = Androctonus mauretanicus mauretanicus PE = 1 SV = 1 ‐ [SCX5_ANDMA] | 96.57 | 28.13% | 1 | 1 | 1 | 2 | 64 | 7.3 | 7.5 | |
| P01481 | Alpha‐mammal toxin Lqq5 OS = | 77.71 | 25.00% | 2 | 1 | 2 | 4 | 64 | 7.3 | 8.1 | |
|
| Alpha‐like toxin Bom3 OS = | 155.6 | 59.09% | 2 | 2 | 4 | 18 | 66 | 6.9 | 6.71 | |
| P45698 | Neurotoxin BmK‐M9 OS = | 124.54 | 26.58% | 11 | 1 | 3 | 15 | 79 | 8.8 | 7.88 | |
|
| Beta‐insect excitatory toxin LqhIT1a OS = | 55.48 | 10.23% | 2 | 1 | 2 | 4 | 88 | 9.9 | 8.09 | |
|
| Alpha‐toxin Bu1 OS = | 272.84 | 71.64% | 1 | 2 | 4 | 9 | 67 | 7.5 | 8.48 | |
|
| Toxin Lqh4 OS = | 293.2 | 46.15% | 7 | 1 | 3 | 10 | 65 | 7.2 | 8.1 | |
|
| Alpha‐toxin Lqq4 OS = | 569.9 | 90.77% | 8 | 2 | 6 | 18 | 65 | 7.2 | 8.1 | |
|
| Alpha‐toxin Bot11 OS = | 76.63 | 35.38% | 2 | 1 | 3 | 7 | 65 | 7.5 | 7.87 | |
|
| Toxin Boma6a OS = | 46.01 | 15.15% | 2 | 1 | 1 | 2 | 66 | 7.5 | 7.09 | |
|
| Alpha‐insect toxin LqhaIT OS = | 369.61 | 51.76% | 4 | 2 | 5 | 13 | 85 | 9.6 | 8.12 | |
|
| Neurotoxin 8 (Fragment) OS = Buthus occitanus tunetanus PE = 1 SV = 1 ‐ [SCX8_BUTOC] | 536.34 | 77.78% | 2 | 3 | 3 | 13 | 36 | 4.1 | 6.24 | |
|
| Alpha‐insect toxin BotIT1 OS = | 296.35 | 61.54% | 1 | 1 | 3 | 9 | 65 | 7.3 | 7.55 | |
|
| Alpha‐toxin Bot1 OS = | 185.35 | 20.00% | 1 | 1 | 1 | 3 | 65 | 7.3 | 6.92 | |
|
| Insect toxin AaHIT5 OS = | 49.42 | 24.59% | 1 | 1 | 1 | 2 | 61 | 6.9 | 4.83 | |
| P01485 | Alpha‐mammal toxin Bot3 (Fragment) OS = | 436.17 | 61.11% | 3 | 2 | 5 | 61 | 72 | 8.1 | 7.53 | |
|
| Beta‐toxin BotIT2 OS = | 164.41 | 41.67% | 1 | 2 | 2 | 4 | 60 | 6.9 | 4.84 | |
|
| Alpha‐insect toxin Bot14 OS = | 91.78 | 18.82% | 1 | 1 | 1 | 9 | 85 | 9.2 | 8.5 | |
|
| Beta‐insect excitatory toxin BmK IT‐AP OS = | 50.93 | 17.78% | 8 | 1 | 2 | 5 | 90 | 10.2 | 5.36 | |
|
| Beta‐insect depressant toxin BotIT6 OS = | 78.83 | 53.23% | 1 | 2 | 3 | 7 | 62 | 7.3 | 8.1 | |
| P0C294 | Toxin Acra I‐3 OS = | 43.58 | 8.75% | 1 | 1 | 1 | 1 | 80 | 8.8 | 8.25 | |
|
| Neurotoxin BmK‐II OS = | 62.88 | 15.63% | 3 | 1 | 1 | 2 | 64 | 7.2 | 7.09 | |
| KScTxs | P0CC12 | Potassium channel toxin alpha‐KTx 8.5 OS = Odontobuthus doriae PE = 1 SV = 1 ‐ [KAX85_ODODO] | 86.25 | 48.28% | 2 | 1 | 1 | 2 | 29 | 3.2 | 5.1 |
| P83407 | Potassium channel toxin alpha‐KTx 19.1 OS = | 82.22 | 32.26% | 1 | 1 | 1 | 5 | 31 | 3.3 | 8.73 | |
| Q95NJ8 | Potassium channel toxin alpha‐KTx 17.1 OS = | 79.79 | 16.36% | 1 | 1 | 1 | 5 | 55 | 6.2 | 8 | |
| P80669 | Potassium channel toxin alpha‐KTx 9.3 OS = | 211.78 | 92.86% | 3 | 2 | 2 | 9 | 28 | 3 | 6.98 | |
|
| Potassium channel toxin BmTXK‐beta OS = | 135.05 | 27.78% | 2 | 2 | 2 | 3 | 90 | 10.4 | 8.82 | |
|
| Potassium channel toxin BmTXK‐beta‐2 OS = | 96.9 | 42.86% | 3 | 2 | 4 | 7 | 91 | 10.2 | 8.57 | |
| P86399 | Neurotoxin lamda‐MeuTx OS = | 262 | 25.00% | 2 | 1 | 1 | 8 | 64 | 7.2 | 7.12 | |
| P80670 | Toxin GaTx2 OS = | 86.02 | 48.28% | 2 | 1 | 1 | 2 | 29 | 3.2 | 5.1 | |
| CaScTxs | P83406 | Neurotoxin Tx‐2 OS = Buthotus judaicus PE = 1 SV = 1 ‐ [SCBT2_BUTJU] | 287.63 | 60.71% | 1 | 2 | 2 | 10 | 28 | 2.9 | 4.89 |
| ClScTxs |
| Chlorotoxin‐like peptide OS = | 993.18 | 67.65% | 1 | 3 | 3 | 65 | 34 | 3.6 | 8.34 |
|
| Chlorotoxin OS = | 588.38 | 38.89% | 1 | 2 | 2 | 38 | 36 | 4 | 8.13 | |
| P01498 | Neurotoxin P2 OS = Androctonus mauretanicus mauretanicus PE = 1 SV = 1 ‐ [SCXP_ANDMA] | 188.48 | 71.43% | 1 | 2 | 2 | 5 | 35 | 3.7 | 7.88 | |
| Amphipathic peptide | B8XH50 | Amphipathic peptide Tx348 OS = | 87.27 | 19.40% | 4 | 1 | 1 | 1 | 67 | 7.8 | 9.19 |
Underlined peptide entries were identified by in‐gel and in‐solution digestion methods.
List of the 50 peptides detected by the bottom‐up analysis of the reduced/alkylated B. occitanus venom filtrate. Data sets generated from the mass spectrometer were analyzed by the proteome discover 2.2 software, against UniProtKB/Swiss‐Prot database.
| Category | Accession | Description | MW (kDa) | Species | Digestion method |
|---|---|---|---|---|---|
| NaScTx | P86406 | Neurotoxin MeuNaTx‐6 | 7.8 |
| In‐gel digestion |
|
| Beta‐toxin BotIT2 | 6.9 |
| Both | |
| D5HR52 | Alpha‐toxin Ac3 (Fragment) | 7.8 |
| In‐gel digestion | |
| P55904 | Beta‐insect depressant toxin BotIT5 | 6.8 |
| In‐gel digestion | |
|
| Beta‐insect excitatory toxin BmK IT‐AP | 10.2 |
| Both | |
| P68723 | Beta‐insect excitatory toxin LqhIT1c | 9.9 |
| In‐gel digestion | |
|
| Neurotoxin BmK‐II | 7.2 |
| Both | |
| P15224 | Toxin Os1 | 7.6 |
| In‐gel digestion | |
| D5HR50 | Alpha‐toxin Ac1 (Fragment) | 8.7 |
| In‐gel digestion | |
|
| Sodium channel alpha‐toxin Acra8 | 7.5 |
| Both | |
| M1JBC0 | Sodium channel alpha‐toxin Acra4 | 7.1 |
| In‐gel digestion | |
| Q86SE0 | Toxin Aam2 | 9.3 |
| Both | |
|
| Toxin AaHIT4 | 7.8 |
| Both | |
| P01482 | Alpha‐toxin Amm5 | 7.3 |
| In‐solution digestion | |
| P01481 | Alpha‐mammal toxin Lqq5 | 7.3 |
| In‐solution digestion | |
|
| Alpha‐like toxin Bom3 | 6.9 |
| Both | |
|
| Neurotoxin BmK‐M9 | 8.8 |
| In‐solution digestion | |
| P68721 | Beta‐insect excitatory toxin LqhIT1a | 9.9 |
| Both | |
| P0DJH8 | Alpha‐toxin Bu1 | 7.5 |
| Both | |
|
| Toxin Lqh4 | 7.2 |
| Both | |
| P01489 | Alpha‐toxin Lqq4 | 7.2 |
| Both | |
| P01486 | Alpha‐toxin Bot11 | 7.5 |
| In‐solution digestion | |
|
| Toxin Boma6a | 7.5 |
| Both | |
|
| Alpha‐insect toxin LqhaIT | 9.6 |
| Both | |
| P04098 | Neurotoxin 8 (Fragment) | 4.1 |
| Both | |
|
| Alpha‐insect toxin BotIT1 | 7.3 |
| Both | |
|
| Alpha‐toxin Bot1 | 7.3 |
| Both | |
|
| Insect toxin AaHIT5 | 6.9 |
| Both | |
|
| Alpha‐mammal toxin Bot3 (Fragment) | 8.1 |
| In‐solution digestion | |
| P83406 | Neurotoxin Tx‐2 | 2.9 |
| In‐solution digestion | |
|
| Alpha‐insect toxin Bot14 | 9.2 |
| Both | |
| P59864 | Beta‐insect depressant toxin BotIT6 | 7.3 |
| In‐solution digestion | |
| P0C294 | Toxin Acra I‐3 | 8.8 |
| In‐solution digestion | |
| KScTx | B3EWX9 | Potassium channel toxin alpha‐KTx 9.11 | 2.9 |
| In‐gel digestion |
| P0C161 | Potassium channel toxin alpha‐KTx 2.8 | 4.3 |
| In‐gel digestion | |
| B8XH42 | Potassium channel toxin alpha‐KTx 16.6 | 6.5 |
| Both | |
| P0CC12 | Potassium channel toxin alpha‐KTx 8.5 | 3.2 |
| In‐solution digestion | |
| P59869 | Potassium channel toxin alpha‐KTx 5.4 | 3.5 |
| In‐gel digestion | |
| B8XH40 | Potassium channel toxin BuTXK‐beta | 10.2 |
| In‐gel digestion | |
| Q95NJ8 | Potassium channel toxin alpha‐KTx 17.1 | 6.2 |
| In‐solution digestion | |
| P83407 | Potassium channel toxin alpha‐KTx 19.1 | 3.3 |
| in‐solution digestion | |
| P80669 | Potassium channel toxin alpha‐KTx 9.3 | 3 |
| In‐solution digestion | |
| P86399 | Neurotoxin lamda‐MeuTx | 7.2 |
| In‐solution digestion | |
| Q9NJC6 | Potassium channel toxin BmTXK‐beta | 10.4 |
| Both | |
|
| Potassium channel toxin BmTXK‐beta‐2 | 10.2 |
| Both | |
| ClScTx | P01498 | Neurotoxin P2 | 3.7 |
| in‐solution digestion |
| P86436 | Chlorotoxin‐like peptide | 3.6 |
| Both | |
| P45639 | Chlorotoxin | 4 |
| Both | |
| P80670 | Toxin GaTx2 | 3.2 |
| In‐solution digestion | |
| Amphipathic peptide | B8XH50 | Amphipathic peptide Tx348 | 7.8 |
| In‐solution digestion |
Peptide entries in bold were identified by both top‐down and bottom‐up approaches.
Fig. 6Summary of the total peptides identified by top‐down and bottom‐up approaches. The 102 peptides were divided into neurotoxins, including NaScTxs, KScTxs, ClScTxs, CaScTx and toxin Acra, amphipathic peptide, myotropic neuropeptide, AMPs, and hypothetical secreted protein.
Fig. 7Percentage of B. occitanus peptides, which showed similarity of sequences with others from several scorpion genera.