Literature DB >> 32962530

The Tat system and its dependent cell division proteins are critical for virulence of extra-intestinal pathogenic Escherichia coli.

Jinjin Liu1, Fan Yin1, Te Liu1, Shaowen Li1,2, Chen Tan1,2,3,4, Lu Li1,2,3,4, Rui Zhou1,2,3,4, Qi Huang1,2,3,4.   

Abstract

The twin-arginine translocation (Tat) system is involved in a variety of important bacterial physiological processes. Conserved among bacteria and crucial for virulence, the Tat system is deemed as a promising anti-microbial drug target. However, the mechanism of how the Tat system functions in bacterial pathogenesis has not been fully understood. In this study, we showed that the Tat system was critical for the virulence of an extra-intestinal pathogenic E. coli (ExPEC) strain PCN033. A total of 20 Tat-related mutant strains were constructed, and competitive infection assays were performed to evaluate the relative virulence of these mutants. The results demonstrated that several Tat substrate mutants, including the ΔsufI, ΔamiAΔamiC double mutant as well as each single mutant, ΔyahJ, ΔcueO, and ΔnapG, were significantly outcompeted by the WT strain, among which the ΔsufI and ΔamiAΔamiC strains showed the lowest competitive index (CI) value. Results of individual mouse infection assay, in vitro cell adhesion assay, whole blood bactericidal assay, and serum bactericidal assay further confirmed the virulence attenuation phenotype of the ΔsufI and ΔamiAΔamiC strains. Moreover, the two mutants displayed chained morphology in the log phase resembling the Δtat and were defective in stress response. Our results suggest that the Tat system and its dependent cell division proteins SufI, AmiA, and AmiC play critical roles during ExPEC pathogenesis.

Entities:  

Keywords:  Tat substrate protein; Twin-arginine protein translocation (Tat) system; cell division; extra-intestinal pathogenic Escherichia coli (ExPEC); pathogenesis; stress response

Mesh:

Substances:

Year:  2020        PMID: 32962530      PMCID: PMC7549933          DOI: 10.1080/21505594.2020.1817709

Source DB:  PubMed          Journal:  Virulence        ISSN: 2150-5594            Impact factor:   5.882


Introduction

Protein translocation and secretion are critical for bacterial survival, environmental adaption, and pathogenesis [1,2]. So far, a variety of protein secretion systems have been discovered in bacteria, among which the twin-arginine translocation (Tat) system is a unique one that facilitates folded proteins to be inserted into or translocated across the cytoplasmic membrane [2-5]. The Tat system is present in most bacteria, plant chloroplasts, but absent in mammalian cells. It is composed of a core membrane protein TatC and one or two TatA-like proteins [6]. The proteins exported through the Tat pathway encompass an SRRxFLK motif at their N-terminus [7]. In E. coli, over 30 proteins have been verified or predicted to be transported through the Tat pathway, which are distributed in diverse physiological pathways [5,8]. Due to the diversity of Tat substrate proteins, Tat system disruption causes pleiotropic defects, affecting bacterial growth, cell division, motility, biofilm formation, iron acquisition, stress response, etc [9,10]. Moreover, the crucial role of the Tat system in pathogenesis has been reported in several important bacterial pathogens, including Pseudomonas aeruginosa [11], E. coli O157 [12], Salmonella enterica serovar Typhimurium [13,14], Citrobacter freundii [15], and Yersinia pseudotuberculosis [16]. Efforts have been made by several research groups to unravel how the Tat system affects bacterial virulence. Envelop defects are previously proposed to be the major cause of virulence attenuation in S. Typhimurium [17]. However, a recent study shows that it is the cell division defects under stress conditions in the gut that contribute to the in vivo fitness decrease of the tat mutant of S. Typhimurium [18]. Besides, the Tat system has been suggested to affect the efficiency of type III secretion in a plant pathogen P. syringae [19]. However, it is not the case in S. Typhimurium [17]. Therefore, the role of the Tat system during bacterial pathogenesis needs further investigation. Extra-intestinal pathogenic Escherichia coli (ExPEC) is one of the most important pathogens causing neonatal meningitis, urinary tract infections, and sepsis in humans [20]. Recently, ExPEC has also been frequently isolated from livestock which are believed as important reservoirs causing human infections [21-23]. A substantial amount of ExPEC isolates of animal origin were reported that possessed high-level antimicrobial resistance and were highly virulent, and some isolates share similar virulence factors with those of human origin [24-26]. Therefore, ExPEC is becoming a potential threat to food safety as well as public health. Understanding the pathogenesis of the ExPEC is of great significance. In this study, we reveal that the Tat system is critical for the virulence of ExPEC. By constructing Tat-related mutants and performing competitive infection assays, we showed that the Tat-dependent cell division proteins SufI, AmiA, and AmiC are the key Tat substrate proteins accounting for the virulence attenuation of the tat mutant. Further analysis suggests that ΔsufI and ΔamiAΔamiC displayed severe cell division defect in the log phase and their growth was compromised under different stress conditions.

Materials and methods

Bacterial strains and cell culture conditions

All strains used in this study are listed in Table 1. The ExPEC strain PCN033 was isolated from the brain of a diseased pig with meningitis as described previously [27,28], which exhibited meningitis and high virulence in the mouse infection model [29,30]. E. coli strain χ7213 is a diaminopimelic acid (DAP) autotrophic strain used for delivering plasmid into ExPEC PCN033 through transconjugation [31]. E. coli DH5α λpir was used as the host strain for the propagation of pRE112 [32] or its derived plasmids. E. coli DH5α was used as the host strain for routine cloning. The E. coli χ7213 is grown in LB supplemented with 50 μg/mL of DAP. Chloramphenicol and apramycin were used at a final concentration of 50 μg/ml. PK-15 (pig kidney epithelial cell) and BHK-21 (derived from baby hamster kidney) cells were cultured in Dulbecco’s modified Eagle’s medium (DMEM) (Invitrogen, Carlsbad, CA, USA) supplemented with 10% heat-inactivated fetal bovine serum in a 37°C incubator with 5% CO2.
Table 1.

Strains used in this study.

StrainDescriptionSource
E. coli PCN033Wild type ExPEC strain, highly virulent, isolated from pig brain[27]
E. coli DH5αCloning host strainVazyme Biotech Co., Ltd.
E. coli DH5α λpirCloning host strain[33]
E. coli χ7213Diaminopimelic acid autotrophic strain used in transconjugation.[31]
ΔtatAs E. coli PCN033, tatABC deleted.This work
Δtat-CmAs E. coli PCN033, tatABC replaced with chloramphenicol resistance cassette. CmR.This work
ΔamiAAs E. coli PCN033, amiA replaced with chloramphenicol resistance cassette. CmR.This work
ΔamiA2As E. coli PCN033, in-frame deletion of amiA.This work
ΔamiCAs E. coli PCN033, amiC replaced with chloramphenicol resistance cassette. CmR.This work
ΔamiAΔamiCAs ΔamiA2, amiC replaced with chloramphenicol resistance cassette. CmR.This work
ΔsufIAs E. coli PCN033, sufI replaced with chloramphenicol resistance cassette. CmR.This work
ΔmoaAAs E. coli PCN033, moaA replaced with chloramphenicol resistance cassette. CmR.This work
ΔcueOAs E. coli PCN033, cueO replaced with chloramphenicol resistance cassette. CmR.This work
ΔyahJAs E. coli PCN033, yahJ replaced with chloramphenicol resistance cassette. CmR.This work
ΔwcaMAs E. coli PCN033, wcaM replaced with chloramphenicol resistance cassette. CmR.This work
ΔmodDAs E. coli PCN033, modD replaced with chloramphenicol resistance cassette. CmR.This work
ΔfhuDAs E. coli PCN033, fhuD replaced with chloramphenicol resistance cassette. CmR.This work
ΔycbKAs E. coli PCN033, ycbK replaced with chloramphenicol resistance cassette. CmR.This work
ΔefeOBAs E. coli PCN033, efeOB replaced with chloramphenicol resistance cassette. CmR.This work
ΔfdnGAs E. coli PCN033, fdnG replaced with chloramphenicol resistance cassette. CmR.This work
ΔfdoGAs E. coli PCN033, fdoG replaced with chloramphenicol resistance cassette. CmR.This work
ΔhyaAAs E. coli PCN033, hyaA coding sequence replaced with chloramphenicol resistance gene coding sequence.This work
ΔnapGAs E. coli PCN033, napG replaced with chloramphenicol resistance cassette. CmR.This work
ΔhybAOAs E. coli PCN033, hybAO replaced with chloramphenicol resistance cassette. CmR.This work
ΔnrfCAs E. coli PCN033, nrfC coding sequence replaced with chloramphenicol resistance gene coding sequence.This work
ΔyagTAs E. coli PCN033, yagT coding sequence replaced with chloramphenicol resistance gene coding sequence.This work
ΔydhXAs E. coli PCN033, ydhX coding sequence replaced with chloramphenicol resistance gene coding sequence.This work
tatΔtatABC transformed with pHSG396-tatABCThis work
sufIΔsufI transformed with pHSG396Apra-sufIThis work
Strains used in this study.

Construction of plasmids and mutant strains

All primers and plasmids used in this study are listed in Table S1 and Table S2, respectively. Plasmids were constructed by seamless cloning using the ClonExpress® MultiS One Step Cloning Kit (Cat# C113, Vazyme Biotech Co., Ltd, Nanjing, China). All the mutant strains were constructed as described previously [30]. Briefly, E. coli χ7213 competent cells were transformed with a pRE112 derived plasmid, which served as the donor strain for transconjugation. Cells of donor strain and recipient strain were mixed with a ratio of 10:1 and dripped onto a sterile filter membrane disc (Φ 0.45 μm) which was then placed on LB agar plate containing 50 μg/ml of DAP followed by incubation at 37°C for 5 hours. The bacterial cells were washed off from the disc and the cells plated onto LB agar containing chloramphenicol followed by overnight growth at 37°C. The colonies were picked and single exchanged strains were identified by PCR. The double exchanged mutants were then screened by using LB agar plate containing 10% sucrose and PCR identification of the presence of the target gene.

Growth assay

To measure bacterial growth in liquid medium, overnight-grown cell culture was diluted in LB medium giving an initial OD600nm of 0.01 and grown at 37°C with shaking at 200 round/min (rpm). OD600nm was recorded at each time point using a spectrometer. When necessary, cell culture at certain time point was taken, diluted in LB, and plated onto LB plate for viable cell counting. When doing growth assay on agar plates, bacterial cells at the mid-log phase were diluted in LB to give an identical OD600nm value, which were subject to 10-fold dilution, and 3 μL of cells of each indicated strain were spotted onto each specific LB agar plate. When measuring bacterial resistance against porcine β-defensin 2 (PDB2), 5 × 103 CFU of bacterial cells were mixed with different concentrations of synthetic porcine β defensin at 37°C for 1 hour, and the samples were plated onto LB plate and the viable cells were counted. The plates were then grown at each indicated temperature. The assay was performed in triplicate.

Morphological analysis

Gram staining and fluorescence imaging were used to analyze bacterial morphology. For Gram staining, cells of each strain were grown in LB to the log phase, washed three times with PBS, stained with Gram staining reagents according to the regular procedure, and observed with an optical microscope. For fluorescence imaging, each strain was transformed with pQE80Apra-GFP plasmid which constitutively expresses green fluorescent protein. The cells were grown in LB and harvested at each indicated time point. The cells were washed three times with PBS and imaged using a fluorescence confocal microscope.

Bacterial swimming assay

The swimming assay was performed as previously described [18]. Briefly, 5 μL of cells of each indicated strain at the mid-log phase (OD600nm at 0.6) were spotted onto agar plate containing 10 g/L tryptone, 5 g/L yeast extract, 5 g/L NaCl, 0.5% glucose (w/v), and 0.45% agar (w/v). The plate was photographed after incubation at 37°C for 8 h.

Animal infection experiments

All animal experiments were approved by the Laboratory Animal Monitoring Committee of Huazhong Agricultural University and performed according to the recommendations in the Guide for the Care and Use of Laboratory Animals of Hubei Province, China. Female Kunming mice were purchased from the Experimental Animal Center, Huazhong Agricultural University, Wuhan, China. When evaluating the virulence of an individual ExPEC strain, bacterial cells were grown to the mid-log phase, pelleted, washed with sterile saline, and diluted in sterile saline to get an appropriate amount of viable cells which were then used to inject mouse intraperitoneally. The survival rate of the mice was recorded every 24 hours post-infection for 7 days. When calculating the in vivo bacterial loads, the mice were euthanized at each indicated time points and the organs were collected, weighed, homogenized in sterile saline, and plated on to LB for cell counting. Competitive infection assay, an accurate and sensitive approach to determine relative virulence, was used to determine whether the mutant was attenuated compared with the WT strain [17,34-36]. In the competitive infection assay, a similar amount of viable cells in the mid-log phase of the WT strain and each Tat-related mutant were mixed and used to inject mouse intraperitoneally. The mice were euthanized at each indicated time point, and the number of the WT strain and mutant strain in each organ were counted after plating on LB plate with or without chloramphenicol, respectively. The competitive index (CI) was calculated by dividing the ratio of the mutant cells to the WT cells recovered from the tissues by the ratio of the mutant cells to the WT cells in the injection mixture [output (CFUmutant/CFUWT)/Input (CFUmutant/CFUWT)]. When yagT, nrfC, hyaA and ydhX, which were located within operons, were in-frame substituted with Cmr coding sequence, the strains did not show chloramphenicol resistance. To calculate the competitive index for these strains, the numbers of the WT strain and the mutant strain in the recovered colonies were determined by using PCR.

In vitro cell adhesion assay, whole blood bactericidal assay, and serum bactericidal assay

PK-15 and BHK-21 cells were used to test the adhesion of the WT and the mutant strains as previously described [30]. Briefly, bacterial cells grown to mid-log phase were harvested and washed three times with DMEM. PK-15 cells and BHK-21 cells grown in 6-well plates were infected with cells of each indicated bacterial strain with a ratio of 10:1 followed by incubation at 37°C with 5% CO2 for 2 hours. The cells were then washed five times with PBS and lysed with sterile water. The input bacterial cells and the cell lysates were then diluted and plated onto LB plates for bacterial enumeration. The adhesion rate of the WT strain was set as 100%. Whole blood bactericidal assay was performed as previously described [37]. Briefly, 450 μL heparinized mouse whole blood were mixed with 50 μL bacterial cells of each indicated strain grown to mid-log phase (approximately 108 CFU/mL) and incubated at 37°C for 1 hour. The samples were then diluted and plated onto LB plates for bacterial enumeration. Serum bactericidal assay was performed as previously described [30,38]. Briefly, 100 μL bacterial cells of each indicated strain grown to mid-log phase (approximately 108 CFU/mL) were mixed with 100 μL of normal mouse serum (NS), or serum inactivated at 56°C for 30 min (IS) at 37°C, for 1 hour. The initial input samples and the incubated samples were then diluted and plated onto LB plates for bacterial enumeration. The survival rate was calculated as (CFUrecovered/CFUinput) × 100.

Statistical analysis

Statistical analysis was performed using GraphPad Prism (version 5) software. The Student’s t-test was used to calculate the differences between two groups. Error bars in the graphs represent the standard deviations of the means.

Results

The Tat system is essential for the virulence of ExPEC

In the genome of ExPEC strain PCN033, an operon encoding TatA, TatB and TatC was present. To test whether the Tat system was functional, we constructed a tatABC deletion mutant (Δtat) and its complement strain (CΔtat). As shown in Figure 1a, the Δtat formed chained morphology in contrast to the wild-type (WT) and the complement strains, which was consistent with the observation reported in previous studies [39,40]. This suggested that the Tat system was functional in the ExPEC PCN033 strain. The growth assay showed that the tat mutant exhibited similar growth to WT strain (Figure 1b). Next, a mouse infection assay was performed to test whether the deletion of the Tat system had any effect on the virulence of the ExPEC strain. Mice were intraperitoneally injected with 6 × 106 CFU of WT and Δtat strains, respectively. It was shown that the survival rate of the mice infected with Δtat strain kept 80% (4/5), while those infected with WT strain fell to 0 (0/5) within 5 days post-infection (Figure 1c). The ability of the WT and Δtat cells to survive within mice was further tested. Mice were intraperitoneally injected with 6.7 × 105 cells (a non-lethal dose) of WT and Δtat strain, respectively. As shown in Figure 1c, the bacterial loads of the Δtat strain in the brain, lung, spleen, and blood decreased drastically within 36 hours post-infection, and the cells were almost completely cleared at the end of the experiment. In contrast, a very high level of bacterial loads of WT strain were still observed in each organ at 36 hours post-infection (Figure 1d). The adhesion assay result further showed that the ability of the Δtat strain to adhere to host cells was dramatically decreased compared with the WT strain (Figure 3a). In the whole blood bactericidal assay, it was shown that, instead of being killed, the WT strain could even grow in mouse blood. In contrast, the number of viable bacteria of the Δtat strain significantly dropped after incubation in whole blood (Figure 3b). The ability of the Δtat strain to survive in serum was also significantly lower than that of the WT strain (Figure 3c). These results strongly suggested that the Tat system was essential for the virulence of ExPEC.
Figure 1.

Morphological, growth and virulence characterization of the parental ExPEC PCN033 strain and the tat mutant (Δtat).

Figure 3.

In vitro cell adhesion, and whole blood and serum bactericidal assays. (a). In vitro cell adhesion.

Morphological, growth and virulence characterization of the parental ExPEC PCN033 strain and the tat mutant (Δtat).

Tat substrates prediction and mutants construction

It is the Tat-exported substrate proteins, instead of the Tat system itself, that function in bacterial pathogenesis. The Tat system recognizes its substrate proteins via the N-terminally located signal sequence containing an SRRxFLK motif [5,7]. So, we performed a bioinformatics prediction by using TatP 1.0 server (http://www.cbs.dtu.dk/services/TatP/)[41] to search for Tat substrate proteins encoded in the genome of ExPEC PCN033 strain. As listed in Table 2, a total of 25 Tat substrates were found. We next constructed a series of Tat-related mutants. To facilitate in vivo competitive infection assay, we used a chloramphenicol resistance cassette to replace the target genes that are not present in the middle of an operon. As NapA, DmsA, TorA, TorZ, FdnG, FdoG, and YedY have been reported to be functional only when cofactor molybdenum (Mo) is incorporated with and have an overlapping function in respiration, single deletion of each of these genes may not have an obvious phenotype [42-46]. Therefore, a ΔmoaA mutant was constructed which was deficient in Mo cofactor biogenesis, in which the Tat substrates containing Mo as cofactor were functionally disrupted [36,47]. AmiA and AmiC are two amidases that are both exported through the Tat pathway and have overlapping functions [39]. Therefore, a double deletion mutant ΔamiAΔamiC was also constructed.
Table 2.

Predicted Tat substrates encoded in ExPEC PCN033 genome.

No.ProteinGene locusTat signal sequencePredicted function
1HyaAPPECC33_RS05345MNNEETFYQAMRRQGVTRRSFLKYCSLAAHydrogen oxidation
2HybOPPECC33_RS16535MTGDNTLIHSHGINRRDFMKLCAALAATMGLSSKAAAHydrogen oxidation
3HybAPPECC33_RS16530MNRRNFIKAASCGALLTGALPSVSHAAHydrogen oxidation
4NapGPPECC33_RS11870MSRSAKPQNGRRRFLRDVVRTAGGLAAVGVALGLQQQTARANitrate reduction
5NrfCPPECC33_RS22515MTWSRRQFLTGVGVLAAVSGTAGRVVANitrite reduction
6YagTPPECC33_RS01655MSNQGEYPEDNRVGKHEPHDFSLTRRDLIKVSAATAATAVVYPHSTLAASVPAAldehyde oxidoreductase
7YdhXPPECC33_RS09020MSFTRRKFVLGMGTVIFFTGSASSLLAUnknown
8TorA*PPECC33_RS05440MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATAAQATMAO reduction
9TorZ*PPECC33_RS10195MTLTRREFIKHSGIAAGALVVTSAAPLPAWATMAO reduction
10NapA*PPECC33_RS11875MKLSRRSFMKANAVAAAAAAAGLSVPGVANitrate reduction
11DmsA*PPECC33_RS04930MKTKIPDAVLAAEVSRRGLVKTTAIGGLAMASSALTLPFSRIAHADMSO reduction
12FdnG*PPECC33_RS08015MDVSRRQFFKICAGGMAGTTVAALGFAPKQALAFormate oxidation
13FdoG*PPECC33_RS21300MQVSRRQFFKICAGGMAGTTAAALGFAPSVALAFormate oxidation
14YedY*PPECC33_RS10665MKKNQFLKESDVTAESVFFMTRRQVLKALGISAAALSLPHAAHATMAO/DMSO reduction
15CueOPPECC33_RS00655MQRRDFLKYSVALGVASALPLWSRAVFACopper homeostasis
16SufIPPECC33_RS16630MSLSRRQFIQASGIALCAGAVPLKASACell division
17YahJPPECC33_RS01870MKESNSRREFLSQSGKMVTAAALFGTSVPLAHAUnknown
18WcaMPPECC33_RS11010MPFKKLSRRTFLTASSALAFLHTPFARAColanic acid biosynthesis
19MdoDPPECC33_RS07765MDRRRFIKGSMAMAAVCGTSGIASLFSQAAFAGlucans biosynthesis
20AmiAPPECC33_RS12925MSTFKPLKTLTSRRQVLKAGLAALTLSGMSQAIACell wall remodeling
21AmiCPPECC33_RS15135MSGSNTAISRRRLLQGAGAMWLLSVSQVSLACell wall remodeling
22FhuDPPECC33_RS00805MSGLPLISRRRLLTAMALSPLLWQMNTAQAFerrichrome binding
23YcbKPPECC33_RS05085MDKFDANRRKLLALGGVALGAAILPTPAFAUnknown
24EfeOPPECC33_RS05560MTINFRRNALQLSVAALFSSAFMANAFerrous iron transport
25EfeBPPECC33_RS05565MQYEDENGVNEPSRRRLLKGIGALALAGSCPVAHAFerrous iron transport

*Proteins that are reported to contain molybdenum as co-factor.

Predicted Tat substrates encoded in ExPEC PCN033 genome. *Proteins that are reported to contain molybdenum as co-factor. Competitive index (n = 5). Note: n is the number of animals in each group. CI = Output (CFUmutant/CFUWT)/Input (CFUmutant/CFUWT). * indicates p value < 0.05; ** indicates p value < 0.01; *** indicates p value < 0.001. NS indicates no statistical significance.

Competitive infection assay to assess the in vivo fitness of Tat-related mutants

To identify which Tat substrate protein accounted for the virulence attenuation of the tat mutant, we performed a series of competitive animal infection assays. As shown in Table 3, consistent with the result that disputing the Tat system significantly attenuated the virulence, the competitive infection assay also showed that the WT strain significantly outcompeted the Δtat strain (CI = 0.00568, p < 0.0001). Seven out of the 20 mutants, including ΔsufI, ΔamiA ΔamiC, ΔamiA, ΔamiC, ΔcueO, ΔyahJ, and ΔnapG, showed a CI less than 1 with statistical significance, indicating virulence attenuation compared with the WT strain. Among them ΔsufI displayed the lowest virulence, however, was not as avirulent as the Δtat strain. Double deletion of amiA and amiC genes resulted in the second most attenuated mutant which showed a lower CI value than each single amidase mutant. Individual deletion of yahJ, encoding an uncharacterized protein, and cueO, encoding a blue copper oxidase, also led to somewhat virulence attenuation. The remaining mutants, including 10 Tat substrate mutants and the ΔmoaA mutant, did not show significant virulence attenuation.
Table 3.

Competitive index (n = 5).

StrainMean CIp valueSignificance
Δtat-Cm0.005686.01E-10***
ΔsufI0.117057.72E-05***
ΔamiAΔamiC0.313520.00133**
ΔamiA0.385150.00281**
ΔamiC0.615800.00762**
ΔyahJ0.697390.02196*
ΔyagT0.813740.23846NS
ΔfhuD0.830350.19249NS
ΔcueO0.838680.02143*
ΔwcaM0.889630.46957NS
ΔefeOB0.900330.77743NS
ΔmdoD0.904400.62464NS
ΔfdoG0.923280.48688NS
ΔhybAO0.929620.36763NS
ΔnapG0.931110.03731*
ΔfdnG0.983740.78275NS
ΔydhX0.993690.86272NS
ΔnrfC1.065840.74763NS
ΔhyaA1.150420.27652NS
ΔmoaA1.165330.22838NS
ΔycbK1.562860.20617NS

Note: n is the number of animals in each group. CI = Output (CFUmutant/CFUWT)/Input (CFUmutant/CFUWT). * indicates p value < 0.05; ** indicates p value < 0.01; *** indicates p value < 0.001. NS indicates no statistical significance.

SufI as well as AmiA and AmiC play an important role in pathogenesis of ExPEC

As ΔsufI and ΔamiA ΔamiC showed the lowest CI value in the competitive infection assay, individual infection experiment was carried out to further assess their virulence. Three groups of mice were intraperitoneally injected with 9.4 × 105 CFU of WT, ΔsufI, ΔamiAΔamiC strains, respectively. As shown in Figure 2, at 24 hours post-infection, a very high level of WT bacteria was present in each indicated organs. In contrast, both ΔsufI and ΔamiAΔamiC strains were rapidly cleared in vivo. Growth assay showed that ΔsufI and ΔamiA ΔamiC strains exhibited a slightly slower growth rate than the WT strain during the log phase, but reached a similar cell density with the WT strain in the stationary phase (Figure 1b). We further compared the ability of cell adhesion, and the resistance to whole blood and serum killing between the WT and the sufI and ΔamiAΔamiC strains. As shown in Figure 3a, the abilities of adhesion to PK-15 and BHK-21 cells of the ΔsufI and ΔamiAΔamiC strains were significantly lower than that of the WT strain, but were comparable to that of the Δtat. The whole blood bactericidal and serum bactericidal assays further revealed that the ΔsufI and ΔamiAΔamiC strains were more vulnerable in blood and serum than the WT strain (Figure 3b,c). These results further confirmed that SufI, and the two amidases play an important role in the pathogenesis of ExPEC.
Figure 2.

Colonization of WT, ΔsufI, and ΔamiAΔamiC strains in mouse.

Colonization of WT, ΔsufI, and ΔamiAΔamiC strains in mouse. In vitro cell adhesion, and whole blood and serum bactericidal assays. (a). In vitro cell adhesion.

Motility was disrupted in the ΔamiAΔamiC strain but not in the ΔsufI

By performing a bacterial swimming assay, we found that the deletion of the Tat system caused severe defects in the motility of ExPEC (Figure 4). As the motility-related functions have been recognized as a critical virulence factor [48-51], we next tested whether the motility phenotype of the ΔsufI and ΔamiA ΔamiC mutants was deficient as well, thus causing virulence attenuation. As shown in Figure 4, the swimming phenotype was significantly affected in the ΔamiA ΔamiC strain, although was not completely disrupted as that of the Δtat strain. However, it was not disturbed in the ΔsufI strain. These results suggest that at least the virulence attenuation of the ΔsufI strain was not due to motility defect.
Figure 4.

Motility assay.

Motility assay.

Δsufi and ΔamiA ΔamiC displayed severe cell division defect in the log growth phase

As SufI and the Tat-dependent amidases have been reported to be involved in cell division [52-54], the morphology of the mutant strains was analyzed. As shown in Figure 5, at 1 hour of growth, all the strains showed normal cell morphology. However, at the early log phase (2.5 hours of growth), in contrast to the wild-type strain that still displayed normal separated cells, all the Δtat, ΔsufI and ΔamiA ΔamiC strains formed chained morphology suggesting abnormal cell division, among which the ΔsufI showed the most severe cell division defect. However, this chained morphology almost disappeared at 6 hours of growth. These results suggest that SufI, AmiA, and AmiC are critical for cell division, especially during the log phase.
Figure 5.

Live cell imaging of WT, Δtat, CΔtat, ΔsufI, and ΔamiAΔamiC strains.

Live cell imaging of WT, Δtat, CΔtat, ΔsufI, and ΔamiAΔamiC strains.

Δsufi and ΔamiA ΔamiC were defective in stress response

SDS sensitivity as an indicator of bacterial envelop integrity has been widely used, by which approach the Δtat strain is shown to have a defective envelop [17,55,56]. Therefore, we tested whether the above mutants have a similar defect. As shown in Figure 6a, consistent with previous reports, both the Δtat and ΔamiA ΔamiC showed high sensitivity to SDS, while the ΔsufI was as resistant as the WT strain. The growth of the strains in stress conditions was further investigated. Different stress conditions were generated, including high and low osmotic stresses, high-temperature stress, H2O2 induced oxidative stress, and porcine β-defensin 2 (PDB2) mediated antimicrobial stress. As shown in Figure 6b, all of Δtat, ΔsufI and ΔamiA ΔamiC were able to grow in the medium containing up to 5% NaCl. However, ΔsufI exhibited impaired growth in LB medium without NaCl at 42°C but not at 30°C (Figure 6c). Furthermore, ΔsufI as well as Δtat were sensitive to H2O2, while this sensitivity was only observed at 42°C, but not at 37°C (Figure 6d). None of Δtat, ΔsufI and ΔamiA ΔamiC showed a different resistance to PDB2 (Figure 6e).
Figure 6.

Stress response assay. (a). SDS resistance.

Stress response assay. (a). SDS resistance.

Discussion

In several important bacterial pathogens, the Tat system has been reported to be crucial for pathogenesis [8,14,17,35]. Consistently, our results also revealed that the deletion of the Tat system significantly attenuated the virulence of extra-intestinal pathogenic E. coli (ExPEC). In some pathogens, for example, Legionella pneumophila and Pseudomonas aeruginosa, the Tat system is involved in the secretion of exotoxins so as to contribute to virulence [57,58]. However, in the genome of the ExPEC PCN033 strain used in this study, we did not find any obvious virulence factors encompassing a Tat signal peptide through bioinformatics analysis. In order to reveal how the Tat system affects bacterial pathogenesis, by constructing a total of 20 Tat-related mutants and performing competitive infection experiments, we demonstrated that several Tat substrate mutants exhibited significant virulence attenuation. Among these mutants, ΔsufI and ΔamiAΔamiC showed the lowest CI value indicating the most severe virulence decrease. Similar findings have also been reported previously. In Y. pseudotuberculosis, several Tat substrates are identified critical to cause systematic infection, among which ΔsufI shows the largest attenuation [35]. In Citrobacter freundii, it has also been shown that sufI mutation results in a very significant in vivo fitness defect [15]. A recent study in S. Typhimurium demonstrates that the deletion of the two Tat-dependent amidase encoding genes leads to significant in vivo fitness attenuation, mainly due to cell division defect especially in the inflamed gut where stress conditions including high osmolarity and antimicrobial peptides are present [18]. However, a previous study which was also carried out in S. Typhimurium shows that neither the mutant devoid of sufI nor that lacking amidases alone, but the triple deletion mutant, display a defective virulence phenotype similar as the tat mutant, in which they propose that the virulence attenuation is primarily due to envelop defects [17]. Bacterial pathogens encounter a variety of stresses during infection, including antimicrobial peptides secreted by epithelial cells [59], hyperosmolarity [60], and ROS- or iNOS-mediated oxidative stress [61,62]. The ability of bacterial stress response contributes much to its in vivo fitness. In this study, ΔamiAΔamiC and ΔsufI both showed significant virulence attenuation. SufI and the Tat-exported amidases are both involved in cell division of E. coli. sufI serves as a genetic suppressor of ftsI which encodes an essential cell division protein and has been shown to function under stress conditions [53,54,63]. AmiA and AmiC are N-acetylmuramyl-L-alanine amidases involved in cell wall remodeling [52]. Consistent with their critical roles in cell division, our data demonstrate that the two mutant strains exhibited abnormal morphology in the log growth phase. It is worth noting that although AmiA and AmiC are paralogs functioning in cell septation and separation, they contribute differently to virulence as the two single mutants gave different CI values in the competitive infection assay. This has also been observed in a previous study [17]. Actually, it has been reported that the subcellular localization of AmiA and AmiC differs markedly and they play different roles in cleaving the glycan chains of peptidoglycan [64,65]. Additionally, both of the ΔamiAΔamiC and ΔsufI mutants are defective in stress response. Therefore, it is possible that the virulence attenuation in ExPEC caused by the disruption of the Tat substrates may be attributed to cell division defect-mediated compromise in stress response. Bacterial motility has been recognized as an important virulence factor [48-51]. In consistence with the data reported in previous studies, our results also reveal that the disruption of the Tat system severely compromises bacterial motility. Therefore, we tested whether ΔsufI and ΔamiAΔamiC possessed a similar non-motile phenotype as the Δtat mutant, which may as a result account for the virulence attenuation. Our results showed that the motility was deficient in the ΔamiAΔamiC strain, but not the ΔsufI. A similar motility defect in the ΔamiAΔamiC strain has been also revealed in S. Typhimurium [17]. However, considering flagella expression is down-regulated during S. Typhimurium infection, the motility defect is not believed as the cause of virulence attenuation of the ΔamiAΔamiC strain [17]. In ExPEC, our previous study has shown that the deletion of a flagella biosynthesis gene, flgD, causes significant virulence attenuation, indicating that motility is crucial for the virulence [51]. Therefore, whether and to which extent the motility defect can explain the virulence attenuation of the ΔamiAΔamiC needs further investigations. ΔcueO mutant was also significantly outcompeted by the WT strain in the competitive infection assay. cueO encodes a copper oxidase involved in bacterial copper homeostasis [66,67]. Although copper is an essential metal ion functioning as a cofactor of specific bacterial enzymes, too much copper is toxic. Copper is proposed to catalyze the production of hydroxyl radicals causing oxidative damage [68]. Excessive copper is also reported to interfere with disulfide bond formation in the periplasm of bacteria [69]. It has been shown that the copper level in the microenvironments within the host increases dramatically during bacterial infection [70]. Therefore, the ability of bacterial pathogens to tolerate high concentration copper may contribute to the pathogenicity. CueO itself is a copper-containing protein, therefore may contribute to copper efflux during its export through the Tat pathway which as a result decreases the copper concentration in the cytoplasm. Meanwhile, CueO, as an oxidase, is able to catalyze the toxic and membrane-permeable Cu(I) to the less toxic and less permeable Cu(II) [67,71]. Therefore, CueO may increase the copper tolerance of E. coli which contributes its survival in vivo. Iron acquisition is another important physiological process linked to bacterial pathogenesis [10,72,73]. Bacteria have evolved different strategies to acquire iron, among which the Efe system is an iron transporter responsible for ferrous iron uptake [74]. The Efe system encompasses a membrane protein EfeU and two periplasmic proteins EfeO and EfeB which both bear a Tat signal peptide [74]. The Efe system, or its homologous systems, has been revealed to be required for the virulence of several important bacterial pathogens, including Brucella abortus, Burkholderia [75,76]. In the genome of E. coli K-12 MG1655 strain, there is a frameshift within the efe operon leading to the inactivation of this iron transporting function, and restoring this function by replacing the native efeUOB operon with an in-frame one increased the growth of E. coli under iron-restricted conditions [77]. However, in the genome of ExPEC PCN033, the efeUOB is intact without any frameshift, suggesting that it may be functional. Therefore, it is interesting to test whether the EfeUOB transporter is important for the pathogenesis of ExPEC. However, our results showed that ΔefeOB had a comparable virulence to the WT strain, indicating the EfeO and EfeB are not critical for the virulence and therefore not responsible for the virulence attenuation of the tat mutant. A large proportion of the Tat substrates are co-factor containing redox enzymes, including trimethylamine N-oxide (TMAO) reductase TorA, dimethyl sulfoxide (DSMO) reductase DmsD, which mainly functions in electron transport chains in bacterial respiration [10]. In some pathogens, these redox enzymes have been shown to be crucial for virulence. In Actinobacillus pleuropneumoniae, the ΔdmsA mutant was significantly attenuated in a pig infection model [78]. In Vibrio cholera, deletion of torD, which encodes a chaperone protein required for the maturation of TorA, resulted in decrease in cholera toxin production and virulence, which was similar as the tat mutant [79]. In the genome of ExPEC PCN033 strain, seven Tat substrates, NapA, DmsA, TorA, TorZ, FdnG, FdoG, and YedY, are reported to be molybdenum-containing enzymes [45]. To assess the role of these enzymes in ExPEC virulence, instead of constructing every individual mutant, we deleted the moaA gene, which is responsible for molybdenum incorporation, therefore inactivates all of the above Tat substrates [44,47]. However, the animal infection experiment results showed that ΔmoaA did not outcompete the WT strain, indicating no obvious virulence attenuation. Therefore, the molybdenum-containing Tat substrate proteins are not involved in the virulence attenuation. In conclusion, our results demonstrate that the Tat system is critical for virulence of ExPEC, and SufI as well as AmiA and AmiC, are the key Tat substrates responsible for the virulence attenuation. Click here for additional data file. Click here for additional data file.
  79 in total

1.  Biosynthesis and Insertion of the Molybdenum Cofactor.

Authors:  Axel Magalon; Ralf R Mendel
Journal:  EcoSal Plus       Date:  2008-09

Review 2.  The flagellum in bacterial pathogens: For motility and a whole lot more.

Authors:  Bonnie Chaban; H Velocity Hughes; Morgan Beeby
Journal:  Semin Cell Dev Biol       Date:  2015-11-03       Impact factor: 7.727

3.  Competitive Index: Mixed Infection-Based Virulence Assays for Genetic Analysis in Pseudomonas syringae-Plant Interactions.

Authors:  Alberto P Macho; José S Rufián; Javier Ruiz-Albert; Carmen R Beuzón
Journal:  Methods Mol Biol       Date:  2016

4.  Genetic system for reversible integration of DNA constructs and lacZ gene fusions into the Escherichia coli chromosome.

Authors:  R Platt; C Drescher; S K Park; G J Phillips
Journal:  Plasmid       Date:  2000-01       Impact factor: 3.466

5.  Molecular genetic analysis of the moa operon of Escherichia coli K-12 required for molybdenum cofactor biosynthesis.

Authors:  S L Rivers; E McNairn; F Blasco; G Giordano; D H Boxer
Journal:  Mol Microbiol       Date:  1993-06       Impact factor: 3.501

6.  Elemental analysis of Mycobacterium avium-, Mycobacterium tuberculosis-, and Mycobacterium smegmatis-containing phagosomes indicates pathogen-induced microenvironments within the host cell's endosomal system.

Authors:  Dirk Wagner; Jörg Maser; Barry Lai; Zhonghou Cai; Clifton E Barry; Kerstin Höner Zu Bentrup; David G Russell; Luiz E Bermudez
Journal:  J Immunol       Date:  2005-02-01       Impact factor: 5.422

7.  CueO is a multi-copper oxidase that confers copper tolerance in Escherichia coli.

Authors:  G Grass; C Rensing
Journal:  Biochem Biophys Res Commun       Date:  2001-09-07       Impact factor: 3.575

8.  Iron uptake mechanisms as key virulence factors in bacterial fish pathogens.

Authors:  M L Lemos; M Balado
Journal:  J Appl Microbiol       Date:  2020-01-28       Impact factor: 3.772

9.  Daughter cell separation by penicillin-binding proteins and peptidoglycan amidases in Escherichia coli.

Authors:  Richa Priyadarshini; David L Popham; Kevin D Young
Journal:  J Bacteriol       Date:  2006-08       Impact factor: 3.490

10.  The Tat Protein Export Pathway.

Authors:  Tracy Palmer; Frank Sargent; Ben C Berks
Journal:  EcoSal Plus       Date:  2010-09
View more
  1 in total

1.  The Rcs System Contributes to the Motility Defects of the Twin-Arginine Translocation System Mutant of Extraintestinal Pathogenic Escherichia coli.

Authors:  Te Liu; Yuying Liu; Zixuan Bu; Fan Yin; Yongqing Zhang; Jinjin Liu; Shaowen Li; Chen Tan; Xiabing Chen; Lu Li; Rui Zhou; Qi Huang
Journal:  J Bacteriol       Date:  2022-03-21       Impact factor: 3.476

  1 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.