| Literature DB >> 32945974 |
Yun Ding1, Joey Paolo Ting1, Jinsha Liu1, Shams Al-Azzam2, Priyanka Pandya1, Sepideh Afshar3.
Abstract
With the developlass="Species">ment of modern chemistrEntities:
Keywords: Development; Discovery; Non-proteinogenic amino acid; Peptide therapeutic
Mesh:
Substances:
Year: 2020 PMID: 32945974 PMCID: PMC7544725 DOI: 10.1007/s00726-020-02890-9
Source DB: PubMed Journal: Amino Acids ISSN: 0939-4451 Impact factor: 3.520
Fig. 1Different strategies of non-proteogenic amino acids incorporation to improve the pharmacokinetic properties of peptide drugs. The wide array of available NPAAs can be introduced in the peptide therapeutics to increase stability, potency, and permeability, which can lead to improved oral bioavailability
Fig. 2Peptide building blocks and modifications. Different building blocks such as NAA and NPAA with an l or d configuration can be incorporated into the peptide chain. Some of these building blocks can be further modified using a variety of post-translational modifications
Fig. 3Schematic of orally bioavailable peptide therapeutics for local and systemic delivery. Non-proteinogenic amino acids are introduced in the peptide sequence to overcome challenges of oral delivery
Properties that derive peptide oral bioavailability and some peptide examples
| Peptide property improvement | Peptide example before modification | Non-proteinogenic amino acid introduced modification |
|---|---|---|
| Stability | Angiogenic heptapeptide (DRVYIHP) | Substitution of proteolytic liable residues |
| MP (KKVVFKVKFKK) | ||
| GLP-1 (HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR) | Substitution of proteolytic liable residues; side chain modification for half-life extension | |
| GLP-2 (HADGSFSDEMNTILDNLAARDFINWLIQTKITD) | Substitution of proteolytic liable residues; terminal residue modification | |
| Anti-angiogenic peptide F56 (WHSDMEWWYLLG) | Terminal residue modification for half-life extension | |
| YIK (EMTWEEWEKKIEEYIKKIEEILKKSQNQQLDL) | ||
| 279–287 sequence of glycoprotein-D (LLEDPVGTVA) of herpes simplex virus (HSV) | Cyclization | |
| LP1 (Ac-L(Ant)FFK-CONH2) | ||
| Potency | Compstatin (ICVVQDWGHHRCT) | Increase of hydrophobicity and polarity |
| HLA-DQ blocking peptide (ADAYDYESEELFAA) | Increase of hydrophobicity; NPAA incorporation for increasing affinity | |
| 12p1 (RINNIPWSEAMM) | ||
| GLP-1 (HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR) | NPAA incorporation for increasing affinity | |
| GLP-1 (HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR) and glucagon (HSQGTFTSDYSKYLDSRRAQDFVQWLMNT) | Introduction of dual-agonism, stabilization of peptide helicity | |
| Hemagglutinin binder (ARLPRTMVHPKPAQP) | Increase of hydrophobicity | |
| YIK (EMTWEEWEKKIEEYIKKIEEILKKSQNQQLDL) | ||
| C34 (WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLGSGC) | ||
| Permeability | AMP (Ac-KA∆FWK∆FVK∆FVK-CONH2) | Enhancement of peptide helicity |
| Cbf-14 (RLLRKFFRKLKKSV) | ||
| Octa-arginine analogs (RRRRRRRR) | ||
| BID BH3 peptide (EDIIRNIARHLAQVGDS-Nle-DRSIW) | Enhancement of peptide helicity and lipophilicity | |
| Bim BH3 peptide (IWIAQELRRIGDEFNAYYARR) | Enhancement of peptide helicity | |
| BBB shuttles (N-MePhe)n | Enhancement of hydrophobicity and lipophilicity | |
| Leu-Enk (YGGFL) | Enhancement of lipophilicity; terminal residue modification; glycosylation | |
| Met-Enk (YGGFM) | Glycosylation | |
| EM-1 (YPWF) | Terminal residue modification; enhancement of hydrophobicity and lipophilicity; glycosylation | |
| Cyclo (LLLLPY) | Cyclization | |
| Oral bioavailability | Somatostatin analog cyclo (-PF-(D-Trp)8K9TF11-) | Formation of intermolecular hydrogen bonds by cyclization |
| Cyclo (LLLLPY) | ||
| Tetrapeptide drug carfilzomib | ||
| PMX53 (ACF-Orn-P-DCha-WR) | Enhancement of lipophilicity | |
| Desmopressin (dDAVP, Mpa-(mercaptopropanoic acid)-YFQNCP(D-Arg)-G) | Enhancement of lipophilicity Enhancement of lipophilicity; side-chain modification for absorption enhancement | |
| Semaglutide (H-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVRGRG) | ||
| α-Conotoxin Vc1.1 (G1C2C3SDPRC8NYDHPEIC16) | Cyclization | |
| Ulimorelin (TZP-101) | Cyclization; conformational change |
Fig. 4Incorporation and utilization of NPAAs in peptide display platforms. NPAAs can be incorporated in different peptide display platforms such as OBOC, ribosome display, and mRNA display. These random peptide libraries can be used for affinity selection to identify hit candidates already containing NPAAs. Hit candidates can be improved for stability, potency, permeability, and oral bioavailability